Psyllid ID: psy8029


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690---
MESSLPLILRLTKRSNSLEIDCSHFVGVENSSSSNGSIYDRLPEQNLGPFNAVTFTFCPLPDENFISLFSKLNITTINTLAFSNSPSNVGVLSPPYFDGLHFVKHILLSHNKEITGLHKDIFKGTPQLESLNLRGNSITELYSGVFQYVPKLQVLDLGSNDVAYMDPEIFKNLTSLRILNLDHNQLINLTRAIFNNVPNLRSLDISGNNISILPSGVFSDLRKLQTFYANSNRFQMFPKDLFAEMKYLQVIKISYHKDSLKELPSGLFANLPLLNTVILGESSIAELPSDLFWNSTNITNIVLTGHKKLTSLPSTLFRDCKKLVKLELQRNKLKYLPENLFESLKELYTLNLKNNQLENITSLVGLSGLNSLDLSWNQLEQINLIAFDGLSSLNTVDLSHNLLTFDEYQYGYSPLKQCVNLETINLSYNRISSLFDDWISSMTSLKELDLRHNNFSFIPDQLDSIVSNKLTLDLSFNQIAIVDLRTLEIKAAAQDPNEDSTMVARSANIVILNDNPIACNCSNYDLIRFVSKKMTKTVYQMLELVTDNLECFGNAGVGINSVRPENLTCDTKPCPARCYCNFSPYYSIMSVNCSSASLTHMPDYLPVTYEDKKATSIQLILHNNSINHFLESPPESYKLITDLDLSYNNISHVDTMYPYLNHLELIDSEKIICHGSTKPLNGILLKNIQNTKT
ccccccHHHHcccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEccccccccccccccccccccccEEEccccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccHHHHcccccccEEEccccccccccHHHccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEEcccccccccccHHHccccccccEEEccccccccccHHHHcccccccEEccccccccccccHHHHcccccccEEEccccccccccHHHHcccccccEEEcccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHccccccccccccHHHcccccEEEccccccccccccHHHHHHHHHHHcHHHHHHHHccccccEEccccccccccccccccccccccccccccccccccccccEEEcccccccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccc
ccccccHHHHHHHccccccccHcccccccHHHHccccccccccHHHHccccEEEEccccccccccccccccccccccEEEEEEcccccccccccHHHcccccccEEEcccccccccccHHHHHccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHccccccEEEEcccccccccccHHHccccccEEEEEEccccccccccHHHHcccccccEEEcccccccccccHHHcccccccEEEccccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccHHHcccccccEEEcccccccccHHHHHccccccEEEEcccccccccccccccHHHcccccccEEEcccccccccccHHHccccccEEEEcccccccccccHHHccccccEEEEcccccccccccHHHcccccccEEEcccccccccccEEEcccccccccccHHHHHHHHHccccccccHHHcccccccccccccccccccccHHHccccccccccccccHHcccccccEEEccccccccccccccHHHHHHHHHHEEEEcccccccccccHHHcccccccEEEccccccccccHHHccccccEEEEccccccccccccccccHHHHHHHccc
MESSLPLILRLTKrsnsleidcshfvgvenssssngsiydrlpeqnlgpfnavtftfcplpdenFISLFSKLNITTINtlafsnspsnvgvlsppyfdglHFVKHILLSHNkeitglhkdifkgtpqleslnlrgnsiTELYSGvfqyvpklqvldlgsndvaymdpeIFKNLTSLRILNLDHNQLINLTRAIfnnvpnlrsldisgnnisilpsgvfSDLRKLQTFyansnrfqmfpKDLFAEMKYLQVIKISYHkdslkelpsglfanlpllntvilgessiaelpsdlfwnstnitnivltghkkltslpstlfrDCKKLVKLELQRNKLKYLPENLFESLKELYTLNlknnqlenitslvglsglnsldlSWNQLEQINLIAfdglsslntvdlshnlltfdeyqygysplkqcvNLETINLSYNRISSLFDDWISSMTSLKeldlrhnnfsfipdqldsivsnkltldlsfnqiAIVDLRTLEIKAaaqdpnedstmVARSANIVilndnpiacncsnydLIRFVSKKMTKTVYQMLELVTDNlecfgnagvginsvrpenltcdtkpcparcycnfspyysimsvncssaslthmpdylpvtyedkkATSIQLILHnnsinhflesppesyklitdldlsynnishvdtmypylnhlelidsekiichgstkplngillkniqntkt
MESSLPLILRLTKRSNSLEIDCSHFVGVENSSSSNGSIYDRLPEQNLGPFNAVTFTFCPLPDENFISLFSKLNITTINTLAFSNSPSNVGVLSPPYFDGLHFVKHILLSHNKEITGLHKDIFKGTPQLESLNLRGNSITELYSGVFQYVPKLQVLDLGSNDVAYMDPEIFKNLTSLRILNLDHNQLINLTRAIFNNVPNLRSLDISGNNISILPSGVFSDLRKLQTFYANSNRFQMFPKDLFAEMKYLQVIKISYHKDSLKELPSGLFANLPLLNTVILGESSIAELPSDLFWNSTNITNIVLTGHKKLTSLPSTLFRDCKKLVKLELQRNKLKYLPENLFESLKELYTLNLKNNQLENITSLVGLSGLNSLDLSWNQLEQINLIAFDGLSSLNTVDLSHNLLTFDEYQYGYSPLKQCVNLETINLSYNRISSLFDDWISSMTSLKELDLRHNNFSFIPDQLDSIVSNKLTLDLSFNQIAIVDLRTLEIKAaaqdpnedstMVARSANIVILNDNPIACNCSNYDLIRFVSKKMTKTVYQMLELVTDNLECFGNAGVGINSVRPENLTCDTKPCPARCYCNFSPYYSIMSVNCSSASLTHMPDYLPVTYEDKKATSIQLILHNNSINHFLESPPESYKLITDLDLSYNNISHVDTMYPYLNHLELIDSEKIICHGstkplngillkniqntkt
MESSLPLILRLTKRSNSLEIDCSHFvgvenssssngsIYDRLPEQNLGPFNAVTFTFCPLPDENFISLFSKLNITTINTLAFSNSPSNVGVLSPPYFDGLHFVKHILLSHNKEITGLHKDIFKGTPQLESLNLRGNSITELYSGVFQYVPKLQVLDLGSNDVAYMDPEIFKNLTSLRILNLDHNQLINLTRAIFNNVPNLRSLDISGNNISILPSGVFSDLRKLQTFYANSNRFQMFPKDLFAEMKYLQVIKISYHKDSLKELPSGLFANLPLLNTVILGESSIAELPSDLFWNSTNITNIVLTGHKKLTSLPSTLFRDCKKLVKLELQRNKLKYLPENLFESLKELYTLNLKNNQLENITSLVGLSGLNSLDLSWNQLEQINLIAFDGLSSLNTVDLSHNLLTFDEYQYGYSPLKQCVNLETINLSYNRISSLFDDWISSMTSLKELDLRHNNFSFIPDQLDSIVSNKLTLDLSFNQIAIVDLRTLEIKAAAQDPNEDSTMVARSANIVILNDNPIACNCSNYDLIRFVSKKMTKTVYQMLELVTDNLECFGNAGVGINSVRPENLTCDTKPCPARCYCNFSPYYSIMSVNCSSASLTHMPDYLPVTYEDKKATSIQLILHNNSINHFLESPPESYKLITDLDLSYNNISHVDTMYPYLNHLELIDSEKIICHGSTKPLNGILLKNIQNTKT
*********************************************NLGPFNAVTFTFCPLPDENFISLFSKLNITTINTLAFSNSPSNVGVLSPPYFDGLHFVKHILLSHNKEITGLHKDIFKGTPQLESLNLRGNSITELYSGVFQYVPKLQVLDLGSNDVAYMDPEIFKNLTSLRILNLDHNQLINLTRAIFNNVPNLRSLDISGNNISILPSGVFSDLRKLQTFYANSNRFQMFPKDLFAEMKYLQVIKISYHKDSLKELPSGLFANLPLLNTVILGESSIAELPSDLFWNSTNITNIVLTGHKKLTSLPSTLFRDCKKLVKLELQRNKLKYLPENLFESLKELYTLNLKNNQLENITSLVGLSGLNSLDLSWNQLEQINLIAFDGLSSLNTVDLSHNLLTFDEYQYGYSPLKQCVNLETINLSYNRISSLFDDWISSMTSLKELDLRHNNFSFIPDQLDSIVSNKLTLDLSFNQIAIVDLRTLEIKAA*********MVARSANIVILNDNPIACNCSNYDLIRFVSKKMTKTVYQMLELVTDNLECFGNAGVGINSVRPENLTCDTKPCPARCYCNFSPYYSIMSVNCSSASLTHMPDYLPVTYEDKKATSIQLILHNNSINHFLESPPESYKLITDLDLSYNNISHVDTMYPYLNHLELIDSEKIICHGSTKPLNGILLKN******
**SSLPLILRLTKRSNSLEIDCSHFVGVENSSSS******RLPEQNLGPFNAVTFTFCPLPDENFISLFSKLNITTINTLAFSNSPSNVGVLSPPYFDGLHFVKHILLSHNKEITGLHKDIFKGTPQLESLNLRGNSITELYSGVFQYVPKLQVLDLGSNDVAYMDPEIFKNLTSLRILNLDHNQLINLTRAIFNNVPNLRSLDISGNNISILPSGVFSDLRKLQTFYANSNRFQMFPKDLFAEMKYLQVIKISYHKDSLKELPSGLFANLPLLNTVILGESSIAELPSDLFWNSTNITNIVLTGHKKLTSLPSTLFRDCKKLVKLELQRNKLKYLPENLFESLKELYTLNLKNNQLENITSLVGLSGLNSLDLSWNQLEQINLIAFDGLSSLNTVDLSHNLLTFDEYQYGYSPLKQCVNLETINLSYNRISSLFDDWISSMTSLKELDLRHNNFSFIPDQLDSIVSNKLTLDLSFNQIAIVDLRTLEIKAAAQDPNEDSTMVARSANIVILNDNPIACNCSNYDLIRFVSKKMTKTVYQMLELVTDNLECFGNAGVGINSVRPENLTCDTKPCPARCYCNFSPYYSIMSVNCSSASLTHMPDYLPVTYEDKKATSIQLILHNNSINHFLESPPESYKLITDLDLSYNNISHVDTMYPYLNHLELIDSEKIICHGSTKPLNGILLKNIQNT**
MESSLPLILRLTKRSNSLEIDCSHFVGVENSSSSNGSIYDRLPEQNLGPFNAVTFTFCPLPDENFISLFSKLNITTINTLAFSNSPSNVGVLSPPYFDGLHFVKHILLSHNKEITGLHKDIFKGTPQLESLNLRGNSITELYSGVFQYVPKLQVLDLGSNDVAYMDPEIFKNLTSLRILNLDHNQLINLTRAIFNNVPNLRSLDISGNNISILPSGVFSDLRKLQTFYANSNRFQMFPKDLFAEMKYLQVIKISYHKDSLKELPSGLFANLPLLNTVILGESSIAELPSDLFWNSTNITNIVLTGHKKLTSLPSTLFRDCKKLVKLELQRNKLKYLPENLFESLKELYTLNLKNNQLENITSLVGLSGLNSLDLSWNQLEQINLIAFDGLSSLNTVDLSHNLLTFDEYQYGYSPLKQCVNLETINLSYNRISSLFDDWISSMTSLKELDLRHNNFSFIPDQLDSIVSNKLTLDLSFNQIAIVDLRTLEIKAAAQDPNEDSTMVARSANIVILNDNPIACNCSNYDLIRFVSKKMTKTVYQMLELVTDNLECFGNAGVGINSVRPENLTCDTKPCPARCYCNFSPYYSIMSVNCSSASLTHMPDYLPVTYEDKKATSIQLILHNNSINHFLESPPESYKLITDLDLSYNNISHVDTMYPYLNHLELIDSEKIICHGSTKPLNGILLKNIQNTKT
**SSLPLILRLTKRSNSLEIDCSHFVGVENSSSSNGSIYDRLPEQNLGPFNAVTFTFCPLPDENFISLFSKLNITTINTLAFSNSPSNVGVLSPPYFDGLHFVKHILLSHNKEITGLHKDIFKGTPQLESLNLRGNSITELYSGVFQYVPKLQVLDLGSNDVAYMDPEIFKNLTSLRILNLDHNQLINLTRAIFNNVPNLRSLDISGNNISILPSGVFSDLRKLQTFYANSNRFQMFPKDLFAEMKYLQVIKISYHKDSLKELPSGLFANLPLLNTVILGESSIAELPSDLFWNSTNITNIVLTGHKKLTSLPSTLFRDCKKLVKLELQRNKLKYLPENLFESLKELYTLNLKNNQLENITSLVGLSGLNSLDLSWNQLEQINLIAFDGLSSLNTVDLSHNLLTFDEYQYGYSPLKQCVNLETINLSYNRISSLFDDWISSMTSLKELDLRHNNFSFIPDQLDSIVSNKLTLDLSFNQIAIVDLRTLEIKAAAQDPNEDSTMVARSANIVILNDNPIACNCSNYDLIRFVSKKMTKTVYQMLELVTDNLECFGNAGVGINSVRPENLTCDTKPCPARCYCNFSPYYSIMSVNCSSASLTHMPDYLPVTYEDKKATSIQLILHNNSINHFLESPPESYKLITDLDLSYNNISHVDTMYPYLNHLELIDSEKIICHGSTKPLNGILLKNIQNT**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MESSLPLILRLTKRSNSLEIDCSHFVGVENSSSSNGSIYDRLPEQNLGPFNAVTFTFCPLPDENFISLFSKLNITTINTLAFSNSPSNVGVLSPPYFDGLHFVKHILLSHNKEITGLHKDIFKGTPQLESLNLRGNSITELYSGVFQYVPKLQVLDLGSNDVAYMDPEIFKNLTSLRILNLDHNQLINLTRAIFNNVPNLRSLDISGNNISILPSGVFSDLRKLQTFYANSNRFQMFPKDLFAEMKYLQVIKISYHKDSLKELPSGLFANLPLLNTVILGESSIAELPSDLFWNSTNITNIVLTGHKKLTSLPSTLFRDCKKLVKLELQRNKLKYLPENLFESLKELYTLNLKNNQLENITSLVGLSGLNSLDLSWNQLEQINLIAFDGLSSLNTVDLSHNLLTFDEYQYGYSPLKQCVNLETINLSYNRISSLFDDWISSMTSLKELDLRHNNFSFIPDQLDSIVSNKLTLDLSFNQIAIVDLRTLEIKAAAQDPNEDSTMVARSANIVILNDNPIACNCSNYDLIRFVSKKMTKTVYQMLELVTDNLECFGNAGVGINSVRPENLTCDTKPCPARCYCNFSPYYSIMSVNCSSASLTHMPDYLPVTYEDKKATSIQLILHNNSINHFLESPPESYKLITDLDLSYNNISHVDTMYPYLNHLELIDSEKIICHGSTKPLNGILLKNIQNTKT
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query693 2.2.26 [Sep-21-2011]
P08953 1097 Protein toll OS=Drosophil yes N/A 0.875 0.553 0.306 3e-60
O02833605 Insulin-like growth facto N/A N/A 0.670 0.768 0.262 8e-31
P35858605 Insulin-like growth facto yes N/A 0.692 0.793 0.261 8e-31
Q9DBB9547 Carboxypeptidase N subuni yes N/A 0.476 0.603 0.303 9e-30
P40197560 Platelet glycoprotein V O no N/A 0.516 0.639 0.292 1e-29
Q8R5M3578 Leucine-rich repeat-conta yes N/A 0.492 0.589 0.292 7e-29
Q80X72579 Leucine-rich repeat-conta no N/A 0.493 0.590 0.268 3e-28
P70389603 Insulin-like growth facto no N/A 0.542 0.623 0.274 4e-27
O08770567 Platelet glycoprotein V O no N/A 0.561 0.686 0.273 4e-27
Q8TF66581 Leucine-rich repeat-conta no N/A 0.406 0.485 0.292 4e-27
>sp|P08953|TOLL_DROME Protein toll OS=Drosophila melanogaster GN=Tl PE=1 SV=1 Back     alignment and function desciption
 Score =  233 bits (595), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 201/655 (30%), Positives = 321/655 (49%), Gaps = 48/655 (7%)

Query: 39  YDRLPEQ-NLGPFNAVTFTFCPLPDENFI-SLFSKLNITTINTLAFSNSPSNVGV-LSPP 95
           Y +LP++  +G  + V    C LP    I S+   L I +  TL F +   N+G+ ++  
Sbjct: 87  YQQLPKKLRIGEVDRVQMRRCMLPGHTPIASILDYLGIVSPTTLIFESD--NLGMNITRQ 144

Query: 96  YFDGLHFVKHILLSHNKEITGLHKDIFKGTPQLESLNLRGNSITELYSGVFQYVPKLQVL 155
           + D LH +K    +  + +T +  ++      L  L LR N I E+ S +F  +  L+ +
Sbjct: 145 HLDRLHGLKRFRFT-TRRLTHIPANLLTDMRNLSHLELRAN-IEEMPSHLFDDLENLESI 202

Query: 156 DLGSNDVAYMDPEIFKNLTSLRILNLDHNQLINLTRAIFNNVPNLRSLDISGNNISILPS 215
           + GSN +  M   IF  +  L+ LNL  NQL NLT+  F    ++  +DI  N I  LP 
Sbjct: 203 EFGSNKLRQMPRGIFGKMPKLKQLNLWSNQLHNLTKHDFEGATSVLGIDIHDNGIEQLPH 262

Query: 216 GVFSDLRKLQTFYANSNRFQMFPKDLFAEMKYLQVIKISYHKDSLKELPSGLFANLPLLN 275
            VF+ L  +     ++N F+  P+ LF   K+L  +++  ++  L  LPS LFAN P L 
Sbjct: 263 DVFAHLTNVTDINLSANLFRSLPQGLFDHNKHLNEVRLMNNRVPLATLPSRLFANQPELQ 322

Query: 276 TVILGESSIAELPSDLFWNSTNITNIVLTGHKKLTSLPSTLFRDCKKLVKLELQRNKLKY 335
            + L  + +  LP DLF +ST ITNI L G   L +LP+TL      L+ L+L  N+L +
Sbjct: 323 ILRL-RAELQSLPGDLFEHSTQITNISL-GDNLLKTLPATLLEHQVNLLSLDLSNNRLTH 380

Query: 336 LPENLFESLKELYTLNLKNNQLENITSLV--GLSGLNSLDLSWNQLEQINLIAF---DGL 390
           LP++LF     L  L L++N L  I+  +   L  L +L +S N+L  I+  AF   +GL
Sbjct: 381 LPDSLFAHTTNLTDLRLEDNLLTGISGDIFSNLGNLVTLVMSRNRLRTIDSRAFVSTNGL 440

Query: 391 SSL----NTVDLSHNLLTFDEYQYGYSPLKQCVNLETINLSYNRISSLFDDWISSMTSLK 446
             L    N +DL   LL         SP      L T+NL  N I  +++DW ++M  L+
Sbjct: 441 RHLHLDHNDIDLQQPLLDIMLQTQINSPFGYMHGLLTLNLRNNSIIFVYNDWKNTMLQLR 500

Query: 447 ELDLRHNNFSFIP-DQLDSIVSNKLTLDLSFNQIAIVDLRTLEIKAAAQDPNEDSTMVAR 505
           ELDL +NN S +  + L  +  N+L ++++ N+I  + L           P +       
Sbjct: 501 ELDLSYNNISSLGYEDLAFLSQNRLHVNMTHNKIRRIAL-----------PEDVHLGEGY 549

Query: 506 SANIVI--LNDNPIACNCSNYDLIRFVSKKMTKTVYQMLELVTDNLECFGN---AGVGIN 560
           + N+V   LNDNP+ C+C+    I+ V         +  +L TD L C       G  + 
Sbjct: 550 NNNLVHVDLNDNPLVCDCTILWFIQLVRGVHKPQYSRQFKLRTDRLVCSQPNVLEGTPVR 609

Query: 561 SVRPENLTC--------DTKPCPARCYCNFSPYYSIMSVNCSSASLTHMPDYLPVTYEDK 612
            + P+ L C          + CP  C C+   Y   + +NC S +LTH+P  LP  +++ 
Sbjct: 610 QIEPQTLICPLDFSDDPRERKCPRGCNCHVRTYDKALVINCHSGNLTHVP-RLPNLHKNM 668

Query: 613 KATSIQLILHNNSINHFLESPPESYKLITDLDLSYNNIS--HVDTMYPYLNHLEL 665
           +   ++L L NN++     +    Y+ +T L L+ NN++   VD +   L HL++
Sbjct: 669 QL--MELHLENNTLLRLPSANTPGYESVTSLHLAGNNLTSIDVDQLPTNLTHLDI 721




Component of the extracellular signaling pathway that establishes the dorsal-ventral pathway of the embryo. Three proteases; ndl, gd and snk process easter to create active easter. Active easter defines cell identities along the dorsal-ventral continuum by activating the spz ligand for the Tl receptor in the ventral region of the embryo. Promotes heterophilic cellular adhesion. Spz C-106 in the hemolymph controls expression of the antifungal peptide Drosomycin (Drs) by acting as a ligand of Tl and inducing an intracellular signaling pathway.
Drosophila melanogaster (taxid: 7227)
>sp|O02833|ALS_PAPHA Insulin-like growth factor-binding protein complex acid labile subunit OS=Papio hamadryas GN=IGFALS PE=2 SV=1 Back     alignment and function description
>sp|P35858|ALS_HUMAN Insulin-like growth factor-binding protein complex acid labile subunit OS=Homo sapiens GN=IGFALS PE=1 SV=1 Back     alignment and function description
>sp|Q9DBB9|CPN2_MOUSE Carboxypeptidase N subunit 2 OS=Mus musculus GN=Cpn2 PE=1 SV=2 Back     alignment and function description
>sp|P40197|GPV_HUMAN Platelet glycoprotein V OS=Homo sapiens GN=GP5 PE=1 SV=1 Back     alignment and function description
>sp|Q8R5M3|LRC15_RAT Leucine-rich repeat-containing protein 15 OS=Rattus norvegicus GN=Lrrc15 PE=2 SV=1 Back     alignment and function description
>sp|Q80X72|LRC15_MOUSE Leucine-rich repeat-containing protein 15 OS=Mus musculus GN=Lrrc15 PE=2 SV=1 Back     alignment and function description
>sp|P70389|ALS_MOUSE Insulin-like growth factor-binding protein complex acid labile subunit OS=Mus musculus GN=Igfals PE=2 SV=1 Back     alignment and function description
>sp|O08770|GPV_RAT Platelet glycoprotein V OS=Rattus norvegicus GN=Gp5 PE=3 SV=1 Back     alignment and function description
>sp|Q8TF66|LRC15_HUMAN Leucine-rich repeat-containing protein 15 OS=Homo sapiens GN=LRRC15 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query693
242022031 1092 protein toll precursor, putative [Pedicu 0.914 0.580 0.318 1e-79
332031266 1016 Protein toll [Acromyrmex echinatior] 0.845 0.576 0.317 6e-70
157116467 1124 toll [Aedes aegypti] gi|108876451|gb|EAT 0.799 0.492 0.318 9e-68
31200499 1152 AGAP001004-PA [Anopheles gambiae str. PE 0.868 0.522 0.302 3e-67
22651844 1124 Toll-related protein [Aedes aegypti] 0.799 0.492 0.316 5e-67
383859012 1072 PREDICTED: protein toll-like [Megachile 0.784 0.507 0.312 2e-66
156545700 1050 PREDICTED: protein toll [Nasonia vitripe 0.852 0.562 0.306 1e-65
340712913 1095 PREDICTED: protein toll-like [Bombus ter 0.786 0.497 0.316 2e-65
195450953 1095 GK13544 [Drosophila willistoni] gi|19416 0.898 0.568 0.317 3e-65
345479829 1028 PREDICTED: protein toll [Nasonia vitripe 0.874 0.589 0.318 5e-65
>gi|242022031|ref|XP_002431445.1| protein toll precursor, putative [Pediculus humanus corporis] gi|212516733|gb|EEB18707.1| protein toll precursor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  304 bits (779), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 212/665 (31%), Positives = 345/665 (51%), Gaps = 31/665 (4%)

Query: 25  FVGVENSSSSNGSIYDRLPEQNLGPFNAVTFTFCPLPDENFISLFSKLNITTINTLAFSN 84
           ++ ++ + +++ + Y+ L    +GP  +V F  CPLP+  F +L   + +   + L F +
Sbjct: 85  YIQIQCTYATHFTDYNLLNGLKVGPVISVNFRLCPLPNVPFSNLTRSIGVNFTSALLFQS 144

Query: 85  SPSNVGVLSPPYFDGLHFVKHILLSHNKEITGLHKDIFKGTPQLESLNLRGNSITELYSG 144
             +    L   +F  L+ +  ++LS N  +T L +D+ +    L  L+LRGN++  ++  
Sbjct: 145 YRNLSNTLERKHFRDLNNLTRLVLSSNG-LTDLPEDLLQDLANLTWLDLRGNNM-HVHDN 202

Query: 145 VFQYVPKLQVLDLGSNDVAYMDPEIFKNLTSLRILNLDHNQLINLTRAIFNNVPNLRSLD 204
            F  VPKLQ L+LG+N++  ++P +F+NL  L  LNL  NQL NL+R IF+++ NL+ LD
Sbjct: 203 FFNSVPKLQTLELGNNNLTRLEPGLFRNLKRLEHLNLWKNQLKNLSRDIFSHLTNLKELD 262

Query: 205 ISGNNISILPSGVFSDLRKLQTFYANSNRFQMFPKDLFAEMKYLQVIKISYHKDSLKELP 264
           +S N +  L   VF DL KL      +N F   P++LF+    L+V+++  ++ ++  LP
Sbjct: 263 VSSNGMENLSHDVFHDLPKLVRLSLYANNFSDVPENLFSNSINLEVLRLYDNRQTMV-LP 321

Query: 265 SGLFANLPLLNTVILGESSIAELPSDLFWNSTNITNIVLTGHKKLTSLPSTLFRDCKKLV 324
               +NL  L  V L  +++  +P ++ W S+ + N+ L G+  L ++   LFRD   L 
Sbjct: 322 DRFLSNLTRLKEVYLMRNNLQTVPENILWESSAVANLSLQGN-SLKNISENLFRDQFNLQ 380

Query: 325 KLELQRNKLKYLPENLFESLKELYTLNLKNNQLENITSLV--GLSGLNSLDLSWNQLEQI 382
            L+L  N L +LP+ +F++L +L  L L NN+L+ IT  V  GL+ L  LDL +N L  +
Sbjct: 381 TLDLSYNHLAHLPDRVFKNLNKLEFLRLGNNRLKTITQDVFQGLNKLELLDLEYNHLSYL 440

Query: 383 NLIAFDGLSSLNTVDLSHNLLTF----DEYQYGY---------SPLKQCVNLETINLSYN 429
           +  A   L  L     SHN+L+F       Q G+         SP + C+NLE + L+ N
Sbjct: 441 DSDALGHLEQLKHARFSHNMLSFLDDDGHPQGGFPYKDTFGNKSPFRHCINLEYLYLANN 500

Query: 430 RISSLFDDWISSMTSLKELDLRHNNFSFIPDQLDSIVSNKLTLDLSFNQIAIVDLRTLEI 489
            I+ +F DW   +  L+ LDL  NN  ++  Q    +S+ +++DL  N I IV+L  +E 
Sbjct: 501 SITEIFSDWRIVLVKLRVLDLSQNNIQYLVVQDVQFISDDVSVDLRQNNITIVNLYGVEA 560

Query: 490 KAAAQDPNEDSTMVARSANIVILNDNPIACNCSNYDLIRFVSKKMTKTVYQMLELVTDNL 549
            A  Q     +   ++    V+L  NP+ C+C  Y++IR+   K+   VY  + LV  NL
Sbjct: 561 LAVGQTTGLVNPRHSKRNVRVLLEGNPLKCDCQIYEMIRYFENKLESEVYVFVTLVPGNL 620

Query: 550 ECFGN---AGVGINSVRPENLTCDTKP----CPARCYCNFSPYYSIMSVNCSSASLTHMP 602
            C       G  +  V   +L CD  P    CP  C C        + VNC+  +LT +P
Sbjct: 621 TCHSPDVLKGSQVTRVDSHHLMCDLDPATYNCPKSCECKLRRADWGLIVNCTEKNLTEIP 680

Query: 603 DYLPVTYEDKKATSIQLILHNNSINHFLESPPESYKLITDLDLSYNNISHVDT--MYPYL 660
             LP+    K     +L L+ N I     S  + Y+ +T L LS N I ++DT  + P +
Sbjct: 681 VELPIV---KYTNHTELFLNGNDIRTLPNSTFKGYENVTHLYLSNNRIENIDTGLLSPKI 737

Query: 661 NHLEL 665
             L L
Sbjct: 738 QQLAL 742




Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|332031266|gb|EGI70800.1| Protein toll [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|157116467|ref|XP_001658507.1| toll [Aedes aegypti] gi|108876451|gb|EAT40676.1| AAEL007613-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|31200499|ref|XP_309197.1| AGAP001004-PA [Anopheles gambiae str. PEST] gi|17226676|gb|AAL37901.1|AF444780_1 Toll [Anopheles gambiae] gi|30178567|gb|EAA45376.1| AGAP001004-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|22651844|gb|AAM97775.1| Toll-related protein [Aedes aegypti] Back     alignment and taxonomy information
>gi|383859012|ref|XP_003704992.1| PREDICTED: protein toll-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|156545700|ref|XP_001604577.1| PREDICTED: protein toll [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|340712913|ref|XP_003394997.1| PREDICTED: protein toll-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|195450953|ref|XP_002072704.1| GK13544 [Drosophila willistoni] gi|194168789|gb|EDW83690.1| GK13544 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|345479829|ref|XP_001604871.2| PREDICTED: protein toll [Nasonia vitripennis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query693
FB|FBgn0262473 1097 Tl "Toll" [Drosophila melanoga 0.877 0.554 0.311 3.3e-65
UNIPROTKB|Q8TF66581 LRRC15 "Leucine-rich repeat-co 0.513 0.612 0.272 4.3e-33
FB|FBgn0029114 1346 Tollo "Tollo" [Drosophila mela 0.857 0.441 0.249 3.6e-32
RGD|70551578 Lrrc15 "leucine rich repeat co 0.493 0.591 0.290 4.8e-32
MGI|MGI:1921738579 Lrrc15 "leucine rich repeat co 0.464 0.556 0.289 1.1e-31
UNIPROTKB|F1NI07604 IGFALS "Uncharacterized protei 0.532 0.610 0.269 1.5e-31
UNIPROTKB|P40197560 GP5 "Platelet glycoprotein V" 0.516 0.639 0.292 3.2e-31
UNIPROTKB|Q1KS52606 ALS "Acid-labile subunit" [Sus 0.650 0.744 0.285 1.6e-30
FB|FBgn02612691092 conv "convoluted" [Drosophila 0.774 0.491 0.261 5.2e-30
UNIPROTKB|P22792545 CPN2 "Carboxypeptidase N subun 0.404 0.513 0.320 1.5e-29
FB|FBgn0262473 Tl "Toll" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 671 (241.3 bits), Expect = 3.3e-65, P = 3.3e-65
 Identities = 204/654 (31%), Positives = 325/654 (49%)

Query:    39 YDRLPEQ-NLGPFNAVTFTFCPLPDENFI-SLFSKLNITTINTLAFSNSPSNVGV-LSPP 95
             Y +LP++  +G  + V    C LP    I S+   L I +  TL F +   N+G+ ++  
Sbjct:    87 YQQLPKKLRIGEVDRVQMRRCMLPGHTPIASILDYLGIVSPTTLIFESD--NLGMNITRQ 144

Query:    96 YFDGLHFVKHILLSHNKEITGLHKDIFKGTPQLESLNLRGNSITELYSGVFQYVPKLQVL 155
             + D LH +K    +  + +T +  ++      L  L LR N I E+ S +F  +  L+ +
Sbjct:   145 HLDRLHGLKRFRFT-TRRLTHIPANLLTDMRNLSHLELRAN-IEEMPSHLFDDLENLESI 202

Query:   156 DLGSNDVAYMDPEIFKNLTSLRILNLDHNQLINLTRAIFNNVPNLRSLDISGNNISILPS 215
             + GSN +  M   IF  +  L+ LNL  NQL NLT+  F    ++  +DI  N I  LP 
Sbjct:   203 EFGSNKLRQMPRGIFGKMPKLKQLNLWSNQLHNLTKHDFEGATSVLGIDIHDNGIEQLPH 262

Query:   216 GVFSDLRKLQTFYANSNRFQMFPKDLFAEMKYLQVIKISYHKDSLKELPSGLFANLPLLN 275
              VF+ L  +     ++N F+  P+ LF   K+L  +++  ++  L  LPS LFAN P L 
Sbjct:   263 DVFAHLTNVTDINLSANLFRSLPQGLFDHNKHLNEVRLMNNRVPLATLPSRLFANQPELQ 322

Query:   276 TVILGESSIAELPSDLFWNSTNITNIVLTGHKKLTSLPSTLFRDCKKLVKLELQRNKLKY 335
              + L  + +  LP DLF +ST ITNI L G   L +LP+TL      L+ L+L  N+L +
Sbjct:   323 ILRL-RAELQSLPGDLFEHSTQITNISL-GDNLLKTLPATLLEHQVNLLSLDLSNNRLTH 380

Query:   336 LPENLFESLKELYTLNLKNNQLENITSLV--GLSGLNSLDLSWNQLEQINLIAF---DGL 390
             LP++LF     L  L L++N L  I+  +   L  L +L +S N+L  I+  AF   +GL
Sbjct:   381 LPDSLFAHTTNLTDLRLEDNLLTGISGDIFSNLGNLVTLVMSRNRLRTIDSRAFVSTNGL 440

Query:   391 SSL----NTVDLSHNLLTFDEYQYGYSPLKQCVNLETINLSYNRISSLFDDWISSMTSLK 446
               L    N +DL   LL         SP      L T+NL  N I  +++DW ++M  L+
Sbjct:   441 RHLHLDHNDIDLQQPLLDIMLQTQINSPFGYMHGLLTLNLRNNSIIFVYNDWKNTMLQLR 500

Query:   447 ELDLRHNNFSFIP-DQLDSIVSNKLTLDLSFNQIAIVDLRTLEIKAAAQDPNEDSTMVAR 505
             ELDL +NN S +  + L  +  N+L ++++ N+I  + L   E     +  N +   V  
Sbjct:   501 ELDLSYNNISSLGYEDLAFLSQNRLHVNMTHNKIRRIALP--EDVHLGEGYNNNLVHVD- 557

Query:   506 SANIVILNDNPIACNCSNYDLIRFVSKKMTKTVY-QMLELVTDNLECFG-NA--GVGINS 561
                   LNDNP+ C+C+    I+ V + + K  Y +  +L TD L C   N   G  +  
Sbjct:   558 ------LNDNPLVCDCTILWFIQLV-RGVHKPQYSRQFKLRTDRLVCSQPNVLEGTPVRQ 610

Query:   562 VRPENLTCDT--------KPCPARCYCNFSPYYSIMSVNCSSASLTHMPDYLPVTYEDKK 613
             + P+ L C          + CP  C C+   Y   + +NC S +LTH+P  LP  +++ +
Sbjct:   611 IEPQTLICPLDFSDDPRERKCPRGCNCHVRTYDKALVINCHSGNLTHVPR-LPNLHKNMQ 669

Query:   614 ATSIQLILHNNSINHFLESPPESYKLITDLDLSYNNISHVDT-MYPY-LNHLEL 665
                ++L L NN++     +    Y+ +T L L+ NN++ +D    P  L HL++
Sbjct:   670 L--MELHLENNTLLRLPSANTPGYESVTSLHLAGNNLTSIDVDQLPTNLTHLDI 721


GO:0019730 "antimicrobial humoral response" evidence=IGI
GO:0019732 "antifungal humoral response" evidence=IMP
GO:0006963 "positive regulation of antibacterial peptide biosynthetic process" evidence=IMP
GO:0006967 "positive regulation of antifungal peptide biosynthetic process" evidence=IMP
GO:0004888 "transmembrane signaling receptor activity" evidence=IEA;NAS
GO:0008063 "Toll signaling pathway" evidence=IEA;NAS
GO:0005887 "integral to plasma membrane" evidence=NAS
GO:0006952 "defense response" evidence=NAS;TAS
GO:0009950 "dorsal/ventral axis specification" evidence=IMP;NAS;TAS
GO:0030097 "hemopoiesis" evidence=TAS
GO:0007416 "synapse assembly" evidence=IMP
GO:0006955 "immune response" evidence=TAS
GO:0009620 "response to fungus" evidence=TAS
GO:0016021 "integral to membrane" evidence=NAS
GO:0009880 "embryonic pattern specification" evidence=TAS
GO:0070976 "TIR domain binding" evidence=IPI
GO:0009617 "response to bacterium" evidence=NAS
GO:0050832 "defense response to fungus" evidence=TAS
GO:0045087 "innate immune response" evidence=IDA;NAS;TAS
GO:0019955 "cytokine binding" evidence=TAS
GO:0050830 "defense response to Gram-positive bacterium" evidence=IEA;TAS
GO:0035007 "regulation of melanization defense response" evidence=TAS
GO:0035172 "hemocyte proliferation" evidence=IMP;TAS
GO:0000910 "cytokinesis" evidence=IMP
GO:0007352 "zygotic specification of dorsal/ventral axis" evidence=IEA;NAS
GO:0045610 "regulation of hemocyte differentiation" evidence=IMP
GO:0007507 "heart development" evidence=IMP
GO:0005515 "protein binding" evidence=IPI
GO:0043234 "protein complex" evidence=IPI
GO:0005886 "plasma membrane" evidence=IDA
GO:0033565 "ESCRT-0 complex" evidence=IDA
GO:0016201 "synaptic target inhibition" evidence=IMP
GO:0009897 "external side of plasma membrane" evidence=IDA
UNIPROTKB|Q8TF66 LRRC15 "Leucine-rich repeat-containing protein 15" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
FB|FBgn0029114 Tollo "Tollo" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
RGD|70551 Lrrc15 "leucine rich repeat containing 15" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1921738 Lrrc15 "leucine rich repeat containing 15" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1NI07 IGFALS "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P40197 GP5 "Platelet glycoprotein V" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q1KS52 ALS "Acid-labile subunit" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
FB|FBgn0261269 conv "convoluted" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|P22792 CPN2 "Carboxypeptidase N subunit 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query693
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-13
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-12
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-11
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-10
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-10
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 4e-10
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 5e-10
PRK15370754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 4e-08
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-07
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 5e-07
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 7e-07
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 7e-06
PRK15387788 PRK15387, PRK15387, E3 ubiquitin-protein ligase Ss 8e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 9e-06
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-05
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 5e-05
PRK15370 754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 9e-05
pfam13306128 pfam13306, LRR_5, Leucine rich repeats (6 copies) 2e-04
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 2e-04
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 3e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 4e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 4e-04
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 6e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 7e-04
PRK15370754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 8e-04
pfam13306128 pfam13306, LRR_5, Leucine rich repeats (6 copies) 0.001
pfam13306128 pfam13306, LRR_5, Leucine rich repeats (6 copies) 0.002
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 0.002
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 0.003
PRK15387788 PRK15387, PRK15387, E3 ubiquitin-protein ligase Ss 0.004
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score = 74.5 bits (183), Expect = 1e-13
 Identities = 122/495 (24%), Positives = 188/495 (37%), Gaps = 121/495 (24%)

Query: 90  GVLSPPYFDGLHFVKHILLSHNKEITGLHKDIFKGTPQLESLNLRGN---------SITE 140
           G +S   F  L +++ I LS+N+    +  DIF  +  L  LNL  N         SI  
Sbjct: 83  GKISSAIF-RLPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPRGSIPN 141

Query: 141 LYS----------------GVFQYVPKLQVLDLGSNDVAYMDPEIFKNLTSLRILNLDHN 184
           L +                G F     L+VLDLG N +    P    NLTSL  L L  N
Sbjct: 142 LETLDLSNNMLSGEIPNDIGSFS---SLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASN 198

Query: 185 QLI---------------------NLTRAIFNNVPNLRS---LDISGNNIS--ILPSGVF 218
           QL+                     NL+  I   +  L S   LD+  NN++  I  S   
Sbjct: 199 QLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSS--L 256

Query: 219 SDLRKLQTFYANSNRFQ-MFPKDLF-----------------------AEMKYLQVIKIS 254
            +L+ LQ  +   N+     P  +F                        +++ L+++ + 
Sbjct: 257 GNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHL- 315

Query: 255 YHKDSLKELPSGLFANLPLLNTVILGESSIA-ELPSDL---------------------- 291
           +  +   ++P  L  +LP L  + L  +  + E+P +L                      
Sbjct: 316 FSNNFTGKIPVAL-TSLPRLQVLQLWSNKFSGEIPKNLGKHNNLTVLDLSTNNLTGEIPE 374

Query: 292 -FWNSTNITNIVLTGHKKLTSLPSTLFRDCKKLVKLELQRNKLKYLPENLFESLKELYTL 350
              +S N+  ++L  +     +P +L   C+ L ++ LQ N       + F  L  +Y L
Sbjct: 375 GLCSSGNLFKLILFSNSLEGEIPKSL-GACRSLRRVRLQDNSFSGELPSEFTKLPLVYFL 433

Query: 351 NLKNNQLE-NITSLV-GLSGLNSLDLSWNQLEQINLIAFDGLSSLNTVDLSHNLLTFDEY 408
           ++ NN L+  I S    +  L  L L+ N+     L    G   L  +DLS N  +    
Sbjct: 434 DISNNNLQGRINSRKWDMPSLQMLSLARNKFFG-GLPDSFGSKRLENLDLSRNQFS---- 488

Query: 409 QYGYSPLK--QCVNLETINLSYNRISSLFDDWISSMTSLKELDLRHNNFS-FIPDQLDSI 465
             G  P K      L  + LS N++S    D +SS   L  LDL HN  S  IP     +
Sbjct: 489 --GAVPRKLGSLSELMQLKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEM 546

Query: 466 VSNKLTLDLSFNQIA 480
                 LDLS NQ++
Sbjct: 547 PVLSQ-LDLSQNQLS 560


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|185285 PRK15387, PRK15387, E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|205486 pfam13306, LRR_5, Leucine rich repeats (6 copies) Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|205486 pfam13306, LRR_5, Leucine rich repeats (6 copies) Back     alignment and domain information
>gnl|CDD|205486 pfam13306, LRR_5, Leucine rich repeats (6 copies) Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|185285 PRK15387, PRK15387, E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 693
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194|consensus 873 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194|consensus 873 100.0
KOG4237|consensus498 100.0
KOG0472|consensus565 100.0
KOG0472|consensus565 100.0
KOG0618|consensus 1081 99.97
KOG0618|consensus 1081 99.96
KOG0444|consensus 1255 99.96
KOG0444|consensus 1255 99.96
KOG4237|consensus498 99.96
PLN032101153 Resistant to P. syringae 6; Provisional 99.86
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.86
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.86
PLN032101153 Resistant to P. syringae 6; Provisional 99.86
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.79
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.77
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.69
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.62
KOG0617|consensus264 99.55
KOG0617|consensus264 99.52
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.31
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.29
KOG1909|consensus382 99.16
KOG1259|consensus490 99.14
KOG1909|consensus382 99.12
KOG3207|consensus505 99.1
KOG3207|consensus505 99.05
KOG1259|consensus490 99.05
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.03
KOG0531|consensus414 99.0
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 98.98
KOG0531|consensus414 98.92
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.92
KOG0532|consensus722 98.92
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.91
KOG0532|consensus 722 98.86
KOG4658|consensus889 98.85
KOG4658|consensus889 98.77
KOG1859|consensus 1096 98.73
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 98.71
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 98.67
PLN03150623 hypothetical protein; Provisional 98.67
KOG1859|consensus 1096 98.58
PLN03150623 hypothetical protein; Provisional 98.57
KOG2120|consensus419 98.27
KOG1644|consensus233 98.2
KOG2120|consensus419 98.2
KOG4341|consensus483 98.19
KOG4341|consensus483 98.17
KOG1644|consensus233 98.15
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.05
TIGR00864 2740 PCC polycystin cation channel protein. Note: this 98.04
KOG2982|consensus418 98.01
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.99
KOG4579|consensus177 97.95
KOG2982|consensus418 97.92
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.88
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.81
KOG4579|consensus177 97.8
PRK15386426 type III secretion protein GogB; Provisional 97.73
KOG3665|consensus699 97.66
PRK15386426 type III secretion protein GogB; Provisional 97.6
KOG3665|consensus 699 97.36
KOG2739|consensus260 97.33
KOG2123|consensus388 97.29
smart0008251 LRRCT Leucine rich repeat C-terminal domain. 97.27
KOG2739|consensus260 97.26
KOG2123|consensus388 97.2
KOG1947|consensus482 96.65
KOG1947|consensus482 96.51
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 95.12
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.84
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 93.94
KOG4308|consensus478 93.12
PF0146228 LRRNT: Leucine rich repeat N-terminal domain; Inte 93.04
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 92.7
smart0037026 LRR Leucine-rich repeats, outliers. 92.7
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 92.13
KOG3864|consensus221 92.08
KOG3864|consensus221 91.46
smart0037026 LRR Leucine-rich repeats, outliers. 91.31
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 91.31
KOG4308|consensus478 91.23
smart0001333 LRRNT Leucine rich repeat N-terminal domain. 90.78
KOG0473|consensus326 85.49
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 84.5
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 83.95
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 83.94
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 83.06
KOG0473|consensus326 83.03
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=3.6e-50  Score=477.82  Aligned_cols=544  Identities=20%  Similarity=0.187  Sum_probs=392.5

Q ss_pred             eccCCeEEEEecCCCCCCCccCCCCCCCCCccEEEEEcCCCCCccHHHHhhhcCcccccEEEeecCCCCcc-CCCCccCC
Q psy8029          20 IDCSHFVGVENSSSSNGSIYDRLPEQNLGPFNAVTFTFCPLPDENFISLFSKLNITTINTLAFSNSPSNVG-VLSPPYFD   98 (693)
Q Consensus        20 ~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~L~l~~c~l~~~~~~~~~~~~~~~~L~~L~l~~~~~~i~-~l~~~~~~   98 (693)
                      .+||.|.++.|.+              .++++.|+++++.+.......   ...++.|+.|++++|  .++ .++...+.
T Consensus        55 ~~~c~w~gv~c~~--------------~~~v~~L~L~~~~i~~~~~~~---~~~l~~L~~L~Ls~n--~~~~~ip~~~~~  115 (968)
T PLN00113         55 ADVCLWQGITCNN--------------SSRVVSIDLSGKNISGKISSA---IFRLPYIQTINLSNN--QLSGPIPDDIFT  115 (968)
T ss_pred             CCCCcCcceecCC--------------CCcEEEEEecCCCccccCChH---HhCCCCCCEEECCCC--ccCCcCChHHhc
Confidence            5788888888843              136788888888765432121   235778888888887  776 56656666


Q ss_pred             CcccccEEEccCCcCcccccccccCCCCCCcEEEeeCCcccccCcccCCCCCCCcEEEcCCCCCCccChhhhCCCCCCCE
Q psy8029          99 GLHFVKHILLSHNKEITGLHKDIFKGTPQLESLNLRGNSITELYSGVFQYVPKLQVLDLGSNDVAYMDPEIFKNLTSLRI  178 (693)
Q Consensus        99 ~l~~L~~L~Ls~n~~i~~~~~~~~~~l~~L~~L~L~~n~i~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~  178 (693)
                      ++.+|++|++++| .+++..+  ...+++|++|++++|.+++..+..++++++|++|++++|.+.+..|..+.++++|++
T Consensus       116 ~l~~L~~L~Ls~n-~l~~~~p--~~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~  192 (968)
T PLN00113        116 TSSSLRYLNLSNN-NFTGSIP--RGSIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEF  192 (968)
T ss_pred             cCCCCCEEECcCC-ccccccC--ccccCCCCEEECcCCcccccCChHHhcCCCCCEEECccCcccccCChhhhhCcCCCe
Confidence            8888888888888 7765333  245778888888888887644455788888888888888887777777888888888


Q ss_pred             EEccCCCCCCCChhhcCCCCCCcEEECcCCCCCcCCCCcCCCCCCCcEEEcCCCccccCChhhhhcccCceEEEEecCCC
Q psy8029         179 LNLDHNQLINLTRAIFNNVPNLRSLDISGNNISILPSGVFSDLRKLQTFYANSNRFQMFPKDLFAEMKYLQVIKISYHKD  258 (693)
Q Consensus       179 L~L~~n~l~~~~~~~~~~l~~L~~L~L~~n~i~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~~~~L~~L~l~~n~~  258 (693)
                      |++++|++++..+..++.+++|++|++++|.+++..+..+.++++|++|++++|.+....+..|.++++|++|++++|.+
T Consensus       193 L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l  272 (968)
T PLN00113        193 LTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKL  272 (968)
T ss_pred             eeccCCCCcCcCChHHcCcCCccEEECcCCccCCcCChhHhcCCCCCEEECcCceeccccChhHhCCCCCCEEECcCCee
Confidence            88888888877777788888888888888888876666678888888888888888765555678888888888888874


Q ss_pred             cccccCccccCCCCCccEEEcCCCCCcccCcccccCCCCccEEEecCCCCCCcCChhhhcCCCCCcEEEccCCCCCCCCh
Q psy8029         259 SLKELPSGLFANLPLLNTVILGESSIAELPSDLFWNSTNITNIVLTGHKKLTSLPSTLFRDCKKLVKLELQRNKLKYLPE  338 (693)
Q Consensus       259 ~~~~i~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~~~~L~~L~l~~n~~l~~l~~~~~~~~~~L~~L~l~~n~l~~~~~  338 (693)
                      .. .+|. .+..+++|+.|++++|.+.+..+..+..+++|+.|++++| .+....+..+..+++|+.|++++|.+....+
T Consensus       273 ~~-~~p~-~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n-~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~p  349 (968)
T PLN00113        273 SG-PIPP-SIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSN-NFTGKIPVALTSLPRLQVLQLWSNKFSGEIP  349 (968)
T ss_pred             ec-cCch-hHhhccCcCEEECcCCeeccCCChhHcCCCCCcEEECCCC-ccCCcCChhHhcCCCCCEEECcCCCCcCcCC
Confidence            32 3443 3667788888888888877666666777888888888888 5543333445778888888888888774434


Q ss_pred             hhhccCccCceEeccCCcCcc-ccCc-cCCCCCCeEeCCCCccccccccccCCCCCCcEEECCCCcCcccccccCCCCcc
Q psy8029         339 NLFESLKELYTLNLKNNQLEN-ITSL-VGLSGLNSLDLSWNQLEQINLIAFDGLSSLNTVDLSHNLLTFDEYQYGYSPLK  416 (693)
Q Consensus       339 ~~~~~~~~L~~L~Ls~n~l~~-l~~~-~~l~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~~~~  416 (693)
                      ..+..+++|+.|++++|++++ +|.. ..+++|+.|++++|.+.+..+..+..+++|+.|++++|.+++.    .+..+.
T Consensus       350 ~~l~~~~~L~~L~Ls~n~l~~~~p~~~~~~~~L~~L~l~~n~l~~~~p~~~~~~~~L~~L~L~~n~l~~~----~p~~~~  425 (968)
T PLN00113        350 KNLGKHNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNSFSGE----LPSEFT  425 (968)
T ss_pred             hHHhCCCCCcEEECCCCeeEeeCChhHhCcCCCCEEECcCCEecccCCHHHhCCCCCCEEECcCCEeeeE----CChhHh
Confidence            456777888888888888775 4443 5667788888888888877777777888888888888887755    355677


Q ss_pred             CCCCCcEEECCCCCCCcCChhHHhcCCCCcEEECCCCCCccCCCcccccCCCccEEECCCCCCceeeccchhhhcccCCC
Q psy8029         417 QCVNLETINLSYNRISSLFDDWISSMTSLKELDLRHNNFSFIPDQLDSIVSNKLTLDLSFNQIAIVDLRTLEIKAAAQDP  496 (693)
Q Consensus       417 ~l~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~L~~N~l~~~~~~~~~~l~~L~~L~L~~N~l~~~~~~~~~~l~~~~~~  496 (693)
                      .+++|+.|++++|.+++..+..+..+++|+.|++++|++.+..+..+ ..++|+.|++++|++++..+..+..+      
T Consensus       426 ~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~n~~~~~~p~~~-~~~~L~~L~ls~n~l~~~~~~~~~~l------  498 (968)
T PLN00113        426 KLPLVYFLDISNNNLQGRINSRKWDMPSLQMLSLARNKFFGGLPDSF-GSKRLENLDLSRNQFSGAVPRKLGSL------  498 (968)
T ss_pred             cCCCCCEEECcCCcccCccChhhccCCCCcEEECcCceeeeecCccc-ccccceEEECcCCccCCccChhhhhh------
Confidence            78888888888888888777777778888888888888876655533 34677888888888877666555444      


Q ss_pred             CCccccccccCcEEEcCCCcccccCCcHHHHHHHhcccccceeeeeeeccCceeecCCCCccccccCCCCCcccCCCCCC
Q psy8029         497 NEDSTMVARSANIVILNDNPIACNCSNYDLIRFVSKKMTKTVYQMLELVTDNLECFGNAGVGINSVRPENLTCDTKPCPA  576 (693)
Q Consensus       497 ~~~~~~~~~~l~~l~l~~Np~~c~C~~~~~~~~~~~~~~~~~~~~~~~~~~~~~c~~~~~~~~~~l~~~~l~c~~~~cp~  576 (693)
                              .+++.+++++|.+....             +.                                        
T Consensus       499 --------~~L~~L~Ls~N~l~~~~-------------p~----------------------------------------  517 (968)
T PLN00113        499 --------SELMQLKLSENKLSGEI-------------PD----------------------------------------  517 (968)
T ss_pred             --------hccCEEECcCCcceeeC-------------Ch----------------------------------------
Confidence                    34667777777643100             00                                        


Q ss_pred             CcEeeecCCCceEEEEcCCCCcc-cCCCCCCCCccccCceEEEEEecCCccccCCCCCCcccccCcEEEccCCccc-ccc
Q psy8029         577 RCYCNFSPYYSIMSVNCSSASLT-HMPDYLPVTYEDKKATSIQLILHNNSINHFLESPPESYKLITDLDLSYNNIS-HVD  654 (693)
Q Consensus       577 ~~~~~~~~~~~l~~l~ls~n~l~-~ip~~~~~l~~~~~~~l~~L~Ls~N~l~~~~~~~~~~l~~L~~L~Ls~N~l~-~i~  654 (693)
                          .+..+.+++++++++|.++ .+|..+..+     ..++.|+|++|++++..|..+.++++|+.|++++|+++ .+|
T Consensus       518 ----~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l-----~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l~ls~N~l~~~~p  588 (968)
T PLN00113        518 ----ELSSCKKLVSLDLSHNQLSGQIPASFSEM-----PVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLP  588 (968)
T ss_pred             ----HHcCccCCCEEECCCCcccccCChhHhCc-----ccCCEEECCCCcccccCChhHhcCcccCEEeccCCcceeeCC
Confidence                0111334677788888887 667666665     66777888888888777777777888888888888887 677


Q ss_pred             C--cCCCccEEEeeCCc
Q psy8029         655 T--MYPYLNHLELIDSE  669 (693)
Q Consensus       655 ~--~~~~L~~L~l~~N~  669 (693)
                      .  .+..+....+.+|+
T Consensus       589 ~~~~~~~~~~~~~~~n~  605 (968)
T PLN00113        589 STGAFLAINASAVAGNI  605 (968)
T ss_pred             CcchhcccChhhhcCCc
Confidence            6  33455555666776



>KOG4194|consensus Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194|consensus Back     alignment and domain information
>KOG4237|consensus Back     alignment and domain information
>KOG0472|consensus Back     alignment and domain information
>KOG0472|consensus Back     alignment and domain information
>KOG0618|consensus Back     alignment and domain information
>KOG0618|consensus Back     alignment and domain information
>KOG0444|consensus Back     alignment and domain information
>KOG0444|consensus Back     alignment and domain information
>KOG4237|consensus Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617|consensus Back     alignment and domain information
>KOG0617|consensus Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG1909|consensus Back     alignment and domain information
>KOG1259|consensus Back     alignment and domain information
>KOG1909|consensus Back     alignment and domain information
>KOG3207|consensus Back     alignment and domain information
>KOG3207|consensus Back     alignment and domain information
>KOG1259|consensus Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0531|consensus Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0531|consensus Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0532|consensus Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0532|consensus Back     alignment and domain information
>KOG4658|consensus Back     alignment and domain information
>KOG4658|consensus Back     alignment and domain information
>KOG1859|consensus Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG1859|consensus Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG2120|consensus Back     alignment and domain information
>KOG1644|consensus Back     alignment and domain information
>KOG2120|consensus Back     alignment and domain information
>KOG4341|consensus Back     alignment and domain information
>KOG4341|consensus Back     alignment and domain information
>KOG1644|consensus Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>TIGR00864 PCC polycystin cation channel protein Back     alignment and domain information
>KOG2982|consensus Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4579|consensus Back     alignment and domain information
>KOG2982|consensus Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG4579|consensus Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665|consensus Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665|consensus Back     alignment and domain information
>KOG2739|consensus Back     alignment and domain information
>KOG2123|consensus Back     alignment and domain information
>smart00082 LRRCT Leucine rich repeat C-terminal domain Back     alignment and domain information
>KOG2739|consensus Back     alignment and domain information
>KOG2123|consensus Back     alignment and domain information
>KOG1947|consensus Back     alignment and domain information
>KOG1947|consensus Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4308|consensus Back     alignment and domain information
>PF01462 LRRNT: Leucine rich repeat N-terminal domain; InterPro: IPR000372 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG3864|consensus Back     alignment and domain information
>KOG3864|consensus Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG4308|consensus Back     alignment and domain information
>smart00013 LRRNT Leucine rich repeat N-terminal domain Back     alignment and domain information
>KOG0473|consensus Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>KOG0473|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query693
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 6e-21
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 2e-11
3zyi_A452 Netring2 In Complex With Ngl2 Length = 452 4e-18
3zyo_A411 Crystal Structure Of The N-Terminal Leucine Rich Re 3e-17
3zyo_A411 Crystal Structure Of The N-Terminal Leucine Rich Re 5e-08
3zyn_A321 Crystal Structure Of The N-Terminal Leucine Rich Re 4e-17
3zyn_A321 Crystal Structure Of The N-Terminal Leucine Rich Re 4e-08
3m18_A251 Crystal Structure Of Variable Lymphocyte Receptor V 7e-17
3m18_A251 Crystal Structure Of Variable Lymphocyte Receptor V 1e-12
3m18_A251 Crystal Structure Of Variable Lymphocyte Receptor V 5e-07
3m19_A251 Crystal Structure Of Variable Lymphocyte Receptor V 8e-17
3m19_A251 Crystal Structure Of Variable Lymphocyte Receptor V 1e-12
3m19_A251 Crystal Structure Of Variable Lymphocyte Receptor V 2e-07
3o6n_A390 Crystal Structure Of Apl1 Leucine-Rich Repeat Domai 4e-14
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 1e-13
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 6e-13
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 1e-10
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 5e-07
2id5_A477 Crystal Structure Of The Lingo-1 Ectodomain Length 1e-13
2id5_A477 Crystal Structure Of The Lingo-1 Ectodomain Length 3e-11
3oja_B597 Crystal Structure Of Lrim1APL1C COMPLEX Length = 59 2e-13
3zyj_A440 Netring1 In Complex With Ngl1 Length = 440 2e-13
3cig_A697 Crystal Structure Of Mouse Tlr3 Ectodomain Length = 8e-13
3t6q_A606 Crystal Structure Of Mouse Rp105MD-1 Complex Length 2e-12
3rfj_A279 Design Of A Binding Scaffold Based On Variable Lymp 3e-12
3rfj_A279 Design Of A Binding Scaffold Based On Variable Lymp 7e-11
2o6s_A208 Structural Diversity Of The Hagfish Variable Lympho 4e-12
2o6s_A208 Structural Diversity Of The Hagfish Variable Lympho 9e-10
2o6s_A208 Structural Diversity Of The Hagfish Variable Lympho 7e-05
3v47_A455 Crystal Structure Of The N-Tetminal Fragment Of Zeb 1e-11
3j0a_A844 Homology Model Of Human Toll-Like Receptor 5 Fitted 5e-11
3j0a_A 844 Homology Model Of Human Toll-Like Receptor 5 Fitted 1e-07
3j0a_A 844 Homology Model Of Human Toll-Like Receptor 5 Fitted 3e-04
3kj4_A286 Structure Of Rat Nogo Receptor Bound To 1d9 Antagon 5e-11
3kj4_A286 Structure Of Rat Nogo Receptor Bound To 1d9 Antagon 7e-08
1p8t_A285 Crystal Structure Of Nogo-66 Receptor Length = 285 1e-10
1p8t_A285 Crystal Structure Of Nogo-66 Receptor Length = 285 2e-10
1p8t_A285 Crystal Structure Of Nogo-66 Receptor Length = 285 2e-08
1ozn_A285 1.5a Crystal Structure Of The Nogo Receptor Ligand 1e-10
1ozn_A285 1.5a Crystal Structure Of The Nogo Receptor Ligand 2e-10
1ozn_A285 1.5a Crystal Structure Of The Nogo Receptor Ligand 2e-08
1m10_B290 Crystal Structure Of The Complex Of Glycoprotein Ib 2e-10
1m10_B290 Crystal Structure Of The Complex Of Glycoprotein Ib 3e-05
1m10_B290 Crystal Structure Of The Complex Of Glycoprotein Ib 4e-04
1m0z_A290 Crystal Structure Of The Von Willebrand Factor Bind 2e-10
1m0z_A290 Crystal Structure Of The Von Willebrand Factor Bind 3e-05
1m0z_A290 Crystal Structure Of The Von Willebrand Factor Bind 3e-04
1p9a_G290 Crystal Structure Of N-terminal Domain Of Human Pla 3e-10
1p9a_G290 Crystal Structure Of N-terminal Domain Of Human Pla 9e-05
1p9a_G290 Crystal Structure Of N-terminal Domain Of Human Pla 4e-04
1p8v_A279 Crystal Structure Of The Complex Of Platelet Recept 3e-10
1p8v_A279 Crystal Structure Of The Complex Of Platelet Recept 2e-04
1p8v_A279 Crystal Structure Of The Complex Of Platelet Recept 6e-04
1gwb_B281 Structure Of Glycoprotein 1b Length = 281 3e-10
1gwb_B281 Structure Of Glycoprotein 1b Length = 281 2e-04
1gwb_B281 Structure Of Glycoprotein 1b Length = 281 4e-04
3p72_A269 Structure Of Platelet Glycoprotein 1b Alpha With A 3e-10
3p72_A269 Structure Of Platelet Glycoprotein 1b Alpha With A 4e-05
3p72_A269 Structure Of Platelet Glycoprotein 1b Alpha With A 2e-04
1sq0_B288 Crystal Structure Of The Complex Of The Wild-Type V 3e-10
1sq0_B288 Crystal Structure Of The Complex Of The Wild-Type V 1e-04
1sq0_B288 Crystal Structure Of The Complex Of The Wild-Type V 8e-04
1u0n_D265 The Ternary Von Willebrand Factor A1-Glycoprotein I 3e-10
1u0n_D265 The Ternary Von Willebrand Factor A1-Glycoprotein I 4e-05
1u0n_D265 The Ternary Von Willebrand Factor A1-Glycoprotein I 2e-04
3pmh_G290 Mechanism Of Sulfotyrosine-Mediated Glycoprotein Ib 3e-10
3pmh_G290 Mechanism Of Sulfotyrosine-Mediated Glycoprotein Ib 1e-04
3pmh_G290 Mechanism Of Sulfotyrosine-Mediated Glycoprotein Ib 6e-04
1ook_G290 Crystal Structure Of The Complex Of Platelet Recept 3e-10
1ook_G290 Crystal Structure Of The Complex Of Platelet Recept 1e-04
1ook_G290 Crystal Structure Of The Complex Of Platelet Recept 6e-04
3e6j_A229 Crystal Structure Of Variable Lymphocyte Receptor ( 9e-10
3e6j_A229 Crystal Structure Of Variable Lymphocyte Receptor ( 9e-08
3e6j_A229 Crystal Structure Of Variable Lymphocyte Receptor ( 9e-06
4arn_A279 Crystal Structure Of The N-terminal Domain Of Droso 4e-09
4arn_A279 Crystal Structure Of The N-terminal Domain Of Droso 5e-06
4arn_A279 Crystal Structure Of The N-terminal Domain Of Droso 5e-05
2o6r_A177 Structural Diversity Of The Hagfish Variable Lympho 5e-09
2o6r_A177 Structural Diversity Of The Hagfish Variable Lympho 4e-06
2ft3_A332 Crystal Structure Of The Biglycan Dimer Core Protei 6e-09
2ft3_A332 Crystal Structure Of The Biglycan Dimer Core Protei 2e-07
3b2d_A603 Crystal Structure Of Human Rp105MD-1 Complex Length 2e-08
3rgx_A768 Structural Insight Into Brassinosteroid Perception 2e-08
2omu_A462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 2e-08
1ziw_A680 Human Toll-Like Receptor 3 Extracellular Domain Str 2e-08
1ziw_A 680 Human Toll-Like Receptor 3 Extracellular Domain Str 1e-05
2z80_A353 Crystal Structure Of The Tlr1-Tlr2 Heterodimer Indu 2e-08
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 2e-08
3ulu_A694 Structure Of Quaternary Complex Of Human Tlr3ecd Wi 3e-08
2a0z_A705 The Molecular Structure Of Toll-like Receptor 3 Lig 3e-08
2a0z_A 705 The Molecular Structure Of Toll-like Receptor 3 Lig 1e-05
3v44_A407 Crystal Structure Of The N-Terminal Fragment Of Zeb 3e-08
2omv_A461 Crystal Structure Of Inla S192n Y369s/hec1 Complex 6e-08
2v70_A220 Third Lrr Domain Of Human Slit2 Length = 220 6e-08
2v70_A220 Third Lrr Domain Of Human Slit2 Length = 220 7e-05
2wfh_A193 The Human Slit 2 Dimerization Domain D4 Length = 19 6e-08
2wfh_A193 The Human Slit 2 Dimerization Domain D4 Length = 19 2e-04
1xku_A330 Crystal Structure Of The Dimeric Protein Core Of De 7e-08
1xku_A330 Crystal Structure Of The Dimeric Protein Core Of De 8e-07
1xku_A330 Crystal Structure Of The Dimeric Protein Core Of De 5e-04
1xcd_A329 Dimeric Bovine Tissue-Extracted Decorin, Crystal Fo 7e-08
1xcd_A329 Dimeric Bovine Tissue-Extracted Decorin, Crystal Fo 1e-06
1xcd_A329 Dimeric Bovine Tissue-Extracted Decorin, Crystal Fo 6e-04
3ul8_A279 Crystal Structure Of The Tv3 Mutant V134l Length = 9e-08
3g3b_A170 Structure Of A Lamprey Variable Lymphocyte Receptor 1e-07
2omz_A466 Crystal Structure Of Inla Y369a/hec1 Complex Length 1e-07
2omt_A462 Crystal Structure Of Inla G194s+sHEC1 COMPLEX Lengt 1e-07
2xot_A361 Crystal Structure Of Neuronal Leucine Rich Repeat P 1e-07
2omx_A462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 1e-07
3ul7_A278 Crystal Structure Of The Tv3 Mutant F63w Length = 2 1e-07
2v9t_B220 Complex Between The Second Lrr Domain Of Slit2 And 2e-07
2v9t_B220 Complex Between The Second Lrr Domain Of Slit2 And 9e-06
3ula_A279 Crystal Structure Of The Tv3 Mutant F63w-Md-2-Erito 2e-07
3ul9_A278 Structure Of The Tv3 Mutant M41e Length = 278 2e-07
2z62_A276 Crystal Structure Of The Tv3 Hybrid Of Human Tlr4 A 2e-07
3g39_A170 Structure Of A Lamprey Variable Lymphocyte Receptor 2e-07
2v9s_A220 Second Lrr Domain Of Human Slit2 Length = 220 2e-07
2v9s_A220 Second Lrr Domain Of Human Slit2 Length = 220 9e-06
3g3a_A178 Structure Of A Lamprey Variable Lymphocyte Receptor 3e-07
1o6s_A466 Internalin (Listeria Monocytogenes) E-Cadherin (Hum 3e-07
2omy_A461 Crystal Structure Of Inla S192n/hec1 Complex Length 3e-07
2z63_A570 Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 A 4e-07
3twi_D179 Variable Lymphocyte Receptor Recognition Of The Imm 1e-06
3rg1_A612 Crystal Structure Of The Rp105MD-1 Complex Length = 2e-06
2z66_A306 Crystal Structure Of The Vt3 Hybrid Of Human Tlr4 A 5e-06
2z66_A306 Crystal Structure Of The Vt3 Hybrid Of Human Tlr4 A 2e-05
3vq1_A606 Crystal Structure Of Mouse Tlr4MD-2LIPID IVA COMPLE 7e-06
2z64_A599 Crystal Structure Of Mouse Tlr4 And Mouse Md-2 Comp 8e-06
4g8a_A635 Crystal Structure Of Human Tlr4 Polymorphic Variant 8e-06
4g8a_A635 Crystal Structure Of Human Tlr4 Polymorphic Variant 2e-04
3fxi_A605 Crystal Structure Of The Human Tlr4-Human Md-2-E.Co 9e-06
3fxi_A605 Crystal Structure Of The Human Tlr4-Human Md-2-E.Co 2e-04
2r9u_A174 Crystal Structure Of Lamprey Variable Lymphocyte Re 2e-05
2r9u_A174 Crystal Structure Of Lamprey Variable Lymphocyte Re 2e-04
4fho_A231 Crystal Structure Of An Internalin C2 (Inlc2) From 2e-05
1w8a_A192 Third Lrr Domain Of Drosophila Slit Length = 192 2e-05
4ay9_X350 Structure Of Follicle-Stimulating Hormone In Comple 2e-05
2z7x_B520 Crystal Structure Of The Tlr1-Tlr2 Heterodimer Indu 2e-05
1h6u_A308 Internalin H: Crystal Structure Of Fused N-Terminal 3e-05
1xwd_C252 Crystal Structure Of Human Follicle Stimulating Hor 9e-05
4fmz_A347 Crystal Structure Of An Internalin (Inlf) From List 1e-04
3g06_A622 The Salmonella Virulence Effector Ssph2 Functions A 2e-04
4eco_A636 Crystal Structure Of A Hypothetical Protein (Bacegg 3e-04
3oja_A487 Crystal Structure Of Lrim1APL1C COMPLEX Length = 48 5e-04
3o53_A317 Crystal Structure Of Lrim1 Leucine-Rich Repeat Doma 6e-04
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure

Iteration: 1

Score = 99.4 bits (246), Expect = 6e-21, Method: Compositional matrix adjust. Identities = 64/170 (37%), Positives = 97/170 (57%), Gaps = 4/170 (2%) Query: 192 AIFNNVP-NLRSLDISGNNISILPSGVFSDLRKLQTFYANSNRFQMFPKDLFAEMKYLQV 250 AI +N+P + + LD+ N +S LPS F L KL+ Y N N+ Q P +F E+K L+ Sbjct: 30 AIPSNIPADTKKLDLQSNKLSSLPSKAFHRLTKLRLLYLNDNKLQTLPAGIFKELKNLET 89 Query: 251 IKISYHKDSLKELPSGLFANLPLLNTVILGESSIAELPSDLFWNSTNITNIVLTGHKKLT 310 + ++ +K L+ LP G+F L L + L + + LP +F + T +T + L G+ +L Sbjct: 90 LWVTDNK--LQALPIGVFDQLVNLAELRLDRNQLKSLPPRVFDSLTKLTYLSL-GYNELQ 146 Query: 311 SLPSTLFRDCKKLVKLELQRNKLKYLPENLFESLKELYTLNLKNNQLENI 360 SLP +F L +L L N+LK +PE F+ L EL TL L NNQL+ + Sbjct: 147 SLPKGVFDKLTSLKELRLYNNQLKRVPEGAFDKLTELKTLKLDNNQLKRV 196
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|3ZYI|A Chain A, Netring2 In Complex With Ngl2 Length = 452 Back     alignment and structure
>pdb|3ZYO|A Chain A, Crystal Structure Of The N-Terminal Leucine Rich Repeats And Immunoglobulin Domain Of Netrin-G Ligand-3 Length = 411 Back     alignment and structure
>pdb|3ZYO|A Chain A, Crystal Structure Of The N-Terminal Leucine Rich Repeats And Immunoglobulin Domain Of Netrin-G Ligand-3 Length = 411 Back     alignment and structure
>pdb|3ZYN|A Chain A, Crystal Structure Of The N-Terminal Leucine Rich Repeats Of Netrin-G Ligand-3 Length = 321 Back     alignment and structure
>pdb|3ZYN|A Chain A, Crystal Structure Of The N-Terminal Leucine Rich Repeats Of Netrin-G Ligand-3 Length = 321 Back     alignment and structure
>pdb|3M18|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R2.1 In Complex With Hen Egg Lysozyme Length = 251 Back     alignment and structure
>pdb|3M18|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R2.1 In Complex With Hen Egg Lysozyme Length = 251 Back     alignment and structure
>pdb|3M18|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R2.1 In Complex With Hen Egg Lysozyme Length = 251 Back     alignment and structure
>pdb|3M19|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R5.1 Length = 251 Back     alignment and structure
>pdb|3M19|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R5.1 Length = 251 Back     alignment and structure
>pdb|3M19|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R5.1 Length = 251 Back     alignment and structure
>pdb|3O6N|A Chain A, Crystal Structure Of Apl1 Leucine-Rich Repeat Domain Length = 390 Back     alignment and structure
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure
>pdb|2ID5|A Chain A, Crystal Structure Of The Lingo-1 Ectodomain Length = 477 Back     alignment and structure
>pdb|2ID5|A Chain A, Crystal Structure Of The Lingo-1 Ectodomain Length = 477 Back     alignment and structure
>pdb|3OJA|B Chain B, Crystal Structure Of Lrim1APL1C COMPLEX Length = 597 Back     alignment and structure
>pdb|3ZYJ|A Chain A, Netring1 In Complex With Ngl1 Length = 440 Back     alignment and structure
>pdb|3CIG|A Chain A, Crystal Structure Of Mouse Tlr3 Ectodomain Length = 697 Back     alignment and structure
>pdb|3T6Q|A Chain A, Crystal Structure Of Mouse Rp105MD-1 Complex Length = 606 Back     alignment and structure
>pdb|3RFJ|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 279 Back     alignment and structure
>pdb|3RFJ|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 279 Back     alignment and structure
>pdb|2O6S|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B59 Length = 208 Back     alignment and structure
>pdb|2O6S|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B59 Length = 208 Back     alignment and structure
>pdb|2O6S|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B59 Length = 208 Back     alignment and structure
>pdb|3V47|A Chain A, Crystal Structure Of The N-Tetminal Fragment Of Zebrafish Tlr5 In Complex With Salmonella Flagellin Length = 455 Back     alignment and structure
>pdb|3J0A|A Chain A, Homology Model Of Human Toll-Like Receptor 5 Fitted Into An Electron Microscopy Single Particle Reconstruction Length = 844 Back     alignment and structure
>pdb|3J0A|A Chain A, Homology Model Of Human Toll-Like Receptor 5 Fitted Into An Electron Microscopy Single Particle Reconstruction Length = 844 Back     alignment and structure
>pdb|3J0A|A Chain A, Homology Model Of Human Toll-Like Receptor 5 Fitted Into An Electron Microscopy Single Particle Reconstruction Length = 844 Back     alignment and structure
>pdb|3KJ4|A Chain A, Structure Of Rat Nogo Receptor Bound To 1d9 Antagonist Antibody Length = 286 Back     alignment and structure
>pdb|3KJ4|A Chain A, Structure Of Rat Nogo Receptor Bound To 1d9 Antagonist Antibody Length = 286 Back     alignment and structure
>pdb|1P8T|A Chain A, Crystal Structure Of Nogo-66 Receptor Length = 285 Back     alignment and structure
>pdb|1P8T|A Chain A, Crystal Structure Of Nogo-66 Receptor Length = 285 Back     alignment and structure
>pdb|1P8T|A Chain A, Crystal Structure Of Nogo-66 Receptor Length = 285 Back     alignment and structure
>pdb|1OZN|A Chain A, 1.5a Crystal Structure Of The Nogo Receptor Ligand Binding Domain Reveals A Convergent Recognition Scaffold Mediating Inhibition Of Myelination Length = 285 Back     alignment and structure
>pdb|1OZN|A Chain A, 1.5a Crystal Structure Of The Nogo Receptor Ligand Binding Domain Reveals A Convergent Recognition Scaffold Mediating Inhibition Of Myelination Length = 285 Back     alignment and structure
>pdb|1OZN|A Chain A, 1.5a Crystal Structure Of The Nogo Receptor Ligand Binding Domain Reveals A Convergent Recognition Scaffold Mediating Inhibition Of Myelination Length = 285 Back     alignment and structure
>pdb|1M10|B Chain B, Crystal Structure Of The Complex Of Glycoprotein Ib Alpha And The Von Willebrand Factor A1 Domain Length = 290 Back     alignment and structure
>pdb|1M10|B Chain B, Crystal Structure Of The Complex Of Glycoprotein Ib Alpha And The Von Willebrand Factor A1 Domain Length = 290 Back     alignment and structure
>pdb|1M10|B Chain B, Crystal Structure Of The Complex Of Glycoprotein Ib Alpha And The Von Willebrand Factor A1 Domain Length = 290 Back     alignment and structure
>pdb|1M0Z|A Chain A, Crystal Structure Of The Von Willebrand Factor Binding Domain Of Glycoprotein Ib Alpha Length = 290 Back     alignment and structure
>pdb|1M0Z|A Chain A, Crystal Structure Of The Von Willebrand Factor Binding Domain Of Glycoprotein Ib Alpha Length = 290 Back     alignment and structure
>pdb|1M0Z|A Chain A, Crystal Structure Of The Von Willebrand Factor Binding Domain Of Glycoprotein Ib Alpha Length = 290 Back     alignment and structure
>pdb|1P9A|G Chain G, Crystal Structure Of N-terminal Domain Of Human Platelet Receptor Glycoprotein Ib-alpha At 1.7 Angstrom Resolution Length = 290 Back     alignment and structure
>pdb|1P9A|G Chain G, Crystal Structure Of N-terminal Domain Of Human Platelet Receptor Glycoprotein Ib-alpha At 1.7 Angstrom Resolution Length = 290 Back     alignment and structure
>pdb|1P9A|G Chain G, Crystal Structure Of N-terminal Domain Of Human Platelet Receptor Glycoprotein Ib-alpha At 1.7 Angstrom Resolution Length = 290 Back     alignment and structure
>pdb|1P8V|A Chain A, Crystal Structure Of The Complex Of Platelet Receptor Gpib-alpha And Alpha-thrombin At 2.6a Length = 279 Back     alignment and structure
>pdb|1P8V|A Chain A, Crystal Structure Of The Complex Of Platelet Receptor Gpib-alpha And Alpha-thrombin At 2.6a Length = 279 Back     alignment and structure
>pdb|1P8V|A Chain A, Crystal Structure Of The Complex Of Platelet Receptor Gpib-alpha And Alpha-thrombin At 2.6a Length = 279 Back     alignment and structure
>pdb|1GWB|B Chain B, Structure Of Glycoprotein 1b Length = 281 Back     alignment and structure
>pdb|1GWB|B Chain B, Structure Of Glycoprotein 1b Length = 281 Back     alignment and structure
>pdb|1GWB|B Chain B, Structure Of Glycoprotein 1b Length = 281 Back     alignment and structure
>pdb|3P72|A Chain A, Structure Of Platelet Glycoprotein 1b Alpha With A Bound Peptide Inhibitor Length = 269 Back     alignment and structure
>pdb|3P72|A Chain A, Structure Of Platelet Glycoprotein 1b Alpha With A Bound Peptide Inhibitor Length = 269 Back     alignment and structure
>pdb|3P72|A Chain A, Structure Of Platelet Glycoprotein 1b Alpha With A Bound Peptide Inhibitor Length = 269 Back     alignment and structure
>pdb|1SQ0|B Chain B, Crystal Structure Of The Complex Of The Wild-Type Von Willebrand Factor A1 Domain And Glycoprotein Ib Alpha At 2.6 Angstrom Resolution Length = 288 Back     alignment and structure
>pdb|1SQ0|B Chain B, Crystal Structure Of The Complex Of The Wild-Type Von Willebrand Factor A1 Domain And Glycoprotein Ib Alpha At 2.6 Angstrom Resolution Length = 288 Back     alignment and structure
>pdb|1SQ0|B Chain B, Crystal Structure Of The Complex Of The Wild-Type Von Willebrand Factor A1 Domain And Glycoprotein Ib Alpha At 2.6 Angstrom Resolution Length = 288 Back     alignment and structure
>pdb|1U0N|D Chain D, The Ternary Von Willebrand Factor A1-Glycoprotein Ibalpha- Botrocetin Complex Length = 265 Back     alignment and structure
>pdb|1U0N|D Chain D, The Ternary Von Willebrand Factor A1-Glycoprotein Ibalpha- Botrocetin Complex Length = 265 Back     alignment and structure
>pdb|1U0N|D Chain D, The Ternary Von Willebrand Factor A1-Glycoprotein Ibalpha- Botrocetin Complex Length = 265 Back     alignment and structure
>pdb|3PMH|G Chain G, Mechanism Of Sulfotyrosine-Mediated Glycoprotein Ib Interaction With Two Distinct Alpha-Thrombin Sites Length = 290 Back     alignment and structure
>pdb|3PMH|G Chain G, Mechanism Of Sulfotyrosine-Mediated Glycoprotein Ib Interaction With Two Distinct Alpha-Thrombin Sites Length = 290 Back     alignment and structure
>pdb|3PMH|G Chain G, Mechanism Of Sulfotyrosine-Mediated Glycoprotein Ib Interaction With Two Distinct Alpha-Thrombin Sites Length = 290 Back     alignment and structure
>pdb|1OOK|G Chain G, Crystal Structure Of The Complex Of Platelet Receptor Gpib-alpha And Human Alpha-thrombin Length = 290 Back     alignment and structure
>pdb|1OOK|G Chain G, Crystal Structure Of The Complex Of Platelet Receptor Gpib-alpha And Human Alpha-thrombin Length = 290 Back     alignment and structure
>pdb|1OOK|G Chain G, Crystal Structure Of The Complex Of Platelet Receptor Gpib-alpha And Human Alpha-thrombin Length = 290 Back     alignment and structure
>pdb|3E6J|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor (Vlr) Rbc36 In Complex With H-Trisaccharide Length = 229 Back     alignment and structure
>pdb|3E6J|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor (Vlr) Rbc36 In Complex With H-Trisaccharide Length = 229 Back     alignment and structure
>pdb|3E6J|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor (Vlr) Rbc36 In Complex With H-Trisaccharide Length = 229 Back     alignment and structure
>pdb|4ARN|A Chain A, Crystal Structure Of The N-terminal Domain Of Drosophila Toll Receptor Length = 279 Back     alignment and structure
>pdb|4ARN|A Chain A, Crystal Structure Of The N-terminal Domain Of Drosophila Toll Receptor Length = 279 Back     alignment and structure
>pdb|4ARN|A Chain A, Crystal Structure Of The N-terminal Domain Of Drosophila Toll Receptor Length = 279 Back     alignment and structure
>pdb|2O6R|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B61 Length = 177 Back     alignment and structure
>pdb|2O6R|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B61 Length = 177 Back     alignment and structure
>pdb|2FT3|A Chain A, Crystal Structure Of The Biglycan Dimer Core Protein Length = 332 Back     alignment and structure
>pdb|2FT3|A Chain A, Crystal Structure Of The Biglycan Dimer Core Protein Length = 332 Back     alignment and structure
>pdb|3B2D|A Chain A, Crystal Structure Of Human Rp105MD-1 Complex Length = 603 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure
>pdb|1ZIW|A Chain A, Human Toll-Like Receptor 3 Extracellular Domain Structure Length = 680 Back     alignment and structure
>pdb|1ZIW|A Chain A, Human Toll-Like Receptor 3 Extracellular Domain Structure Length = 680 Back     alignment and structure
>pdb|2Z80|A Chain A, Crystal Structure Of The Tlr1-Tlr2 Heterodimer Induced By Binding Of A Tri-Acylated Lipopeptide Length = 353 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3ULU|A Chain A, Structure Of Quaternary Complex Of Human Tlr3ecd With Three Fabs (Form1) Length = 694 Back     alignment and structure
>pdb|2A0Z|A Chain A, The Molecular Structure Of Toll-like Receptor 3 Ligand Binding Domain Length = 705 Back     alignment and structure
>pdb|2A0Z|A Chain A, The Molecular Structure Of Toll-like Receptor 3 Ligand Binding Domain Length = 705 Back     alignment and structure
>pdb|3V44|A Chain A, Crystal Structure Of The N-Terminal Fragment Of Zebrafish Tlr5 Length = 407 Back     alignment and structure
>pdb|2OMV|A Chain A, Crystal Structure Of Inla S192n Y369s/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2V70|A Chain A, Third Lrr Domain Of Human Slit2 Length = 220 Back     alignment and structure
>pdb|2V70|A Chain A, Third Lrr Domain Of Human Slit2 Length = 220 Back     alignment and structure
>pdb|2WFH|A Chain A, The Human Slit 2 Dimerization Domain D4 Length = 193 Back     alignment and structure
>pdb|2WFH|A Chain A, The Human Slit 2 Dimerization Domain D4 Length = 193 Back     alignment and structure
>pdb|1XKU|A Chain A, Crystal Structure Of The Dimeric Protein Core Of Decorin, The Archetypal Small Leucine-Rich Repeat Proteoglycan Length = 330 Back     alignment and structure
>pdb|1XKU|A Chain A, Crystal Structure Of The Dimeric Protein Core Of Decorin, The Archetypal Small Leucine-Rich Repeat Proteoglycan Length = 330 Back     alignment and structure
>pdb|1XKU|A Chain A, Crystal Structure Of The Dimeric Protein Core Of Decorin, The Archetypal Small Leucine-Rich Repeat Proteoglycan Length = 330 Back     alignment and structure
>pdb|1XCD|A Chain A, Dimeric Bovine Tissue-Extracted Decorin, Crystal Form 1 Length = 329 Back     alignment and structure
>pdb|1XCD|A Chain A, Dimeric Bovine Tissue-Extracted Decorin, Crystal Form 1 Length = 329 Back     alignment and structure
>pdb|1XCD|A Chain A, Dimeric Bovine Tissue-Extracted Decorin, Crystal Form 1 Length = 329 Back     alignment and structure
>pdb|3UL8|A Chain A, Crystal Structure Of The Tv3 Mutant V134l Length = 279 Back     alignment and structure
>pdb|3G3B|A Chain A, Structure Of A Lamprey Variable Lymphocyte Receptor Mutant In Complex With A Protein Antigen Length = 170 Back     alignment and structure
>pdb|2OMZ|A Chain A, Crystal Structure Of Inla Y369a/hec1 Complex Length = 466 Back     alignment and structure
>pdb|2OMT|A Chain A, Crystal Structure Of Inla G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2XOT|A Chain A, Crystal Structure Of Neuronal Leucine Rich Repeat Protein Amigo-1 Length = 361 Back     alignment and structure
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|3UL7|A Chain A, Crystal Structure Of The Tv3 Mutant F63w Length = 278 Back     alignment and structure
>pdb|2V9T|B Chain B, Complex Between The Second Lrr Domain Of Slit2 And The First Ig Domain From Robo1 Length = 220 Back     alignment and structure
>pdb|2V9T|B Chain B, Complex Between The Second Lrr Domain Of Slit2 And The First Ig Domain From Robo1 Length = 220 Back     alignment and structure
>pdb|3ULA|A Chain A, Crystal Structure Of The Tv3 Mutant F63w-Md-2-Eritoran Complex Length = 279 Back     alignment and structure
>pdb|3UL9|A Chain A, Structure Of The Tv3 Mutant M41e Length = 278 Back     alignment and structure
>pdb|2Z62|A Chain A, Crystal Structure Of The Tv3 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 276 Back     alignment and structure
>pdb|3G39|A Chain A, Structure Of A Lamprey Variable Lymphocyte Receptor Length = 170 Back     alignment and structure
>pdb|2V9S|A Chain A, Second Lrr Domain Of Human Slit2 Length = 220 Back     alignment and structure
>pdb|2V9S|A Chain A, Second Lrr Domain Of Human Slit2 Length = 220 Back     alignment and structure
>pdb|3G3A|A Chain A, Structure Of A Lamprey Variable Lymphocyte Receptor In Complex With A Protein Antigen Length = 178 Back     alignment and structure
>pdb|1O6S|A Chain A, Internalin (Listeria Monocytogenes) E-Cadherin (Human) Recognition Complex Length = 466 Back     alignment and structure
>pdb|2OMY|A Chain A, Crystal Structure Of Inla S192n/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2Z63|A Chain A, Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 570 Back     alignment and structure
>pdb|3TWI|D Chain D, Variable Lymphocyte Receptor Recognition Of The Immunodominant Glycoprotein Of Bacillus Anthracis Spores Length = 179 Back     alignment and structure
>pdb|3RG1|A Chain A, Crystal Structure Of The Rp105MD-1 Complex Length = 612 Back     alignment and structure
>pdb|2Z66|A Chain A, Crystal Structure Of The Vt3 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 306 Back     alignment and structure
>pdb|2Z66|A Chain A, Crystal Structure Of The Vt3 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 306 Back     alignment and structure
>pdb|3VQ1|A Chain A, Crystal Structure Of Mouse Tlr4MD-2LIPID IVA COMPLEX Length = 606 Back     alignment and structure
>pdb|2Z64|A Chain A, Crystal Structure Of Mouse Tlr4 And Mouse Md-2 Complex Length = 599 Back     alignment and structure
>pdb|4G8A|A Chain A, Crystal Structure Of Human Tlr4 Polymorphic Variant D299g And T399i In Complex With Md-2 And Lps Length = 635 Back     alignment and structure
>pdb|4G8A|A Chain A, Crystal Structure Of Human Tlr4 Polymorphic Variant D299g And T399i In Complex With Md-2 And Lps Length = 635 Back     alignment and structure
>pdb|3FXI|A Chain A, Crystal Structure Of The Human Tlr4-Human Md-2-E.Coli Lps Ra Complex Length = 605 Back     alignment and structure
>pdb|3FXI|A Chain A, Crystal Structure Of The Human Tlr4-Human Md-2-E.Coli Lps Ra Complex Length = 605 Back     alignment and structure
>pdb|2R9U|A Chain A, Crystal Structure Of Lamprey Variable Lymphocyte Receptor 2913 Ectodomain Length = 174 Back     alignment and structure
>pdb|2R9U|A Chain A, Crystal Structure Of Lamprey Variable Lymphocyte Receptor 2913 Ectodomain Length = 174 Back     alignment and structure
>pdb|4FHO|A Chain A, Crystal Structure Of An Internalin C2 (Inlc2) From Listeria Monocytogenes Str. 4b F2365 At 1.90 A Resolution Length = 231 Back     alignment and structure
>pdb|1W8A|A Chain A, Third Lrr Domain Of Drosophila Slit Length = 192 Back     alignment and structure
>pdb|4AY9|X Chain X, Structure Of Follicle-Stimulating Hormone In Complex With The Entire Ectodomain Of Its Receptor Length = 350 Back     alignment and structure
>pdb|2Z7X|B Chain B, Crystal Structure Of The Tlr1-Tlr2 Heterodimer Induced By Binding Of A Tri-Acylated Lipopeptide Length = 520 Back     alignment and structure
>pdb|1H6U|A Chain A, Internalin H: Crystal Structure Of Fused N-Terminal Domains Length = 308 Back     alignment and structure
>pdb|1XWD|C Chain C, Crystal Structure Of Human Follicle Stimulating Hormone Complexed With Its Receptor Length = 252 Back     alignment and structure
>pdb|4FMZ|A Chain A, Crystal Structure Of An Internalin (Inlf) From Listeria Monocytogenes Str. 4b F2365 At 1.91 A Resolution Length = 347 Back     alignment and structure
>pdb|3G06|A Chain A, The Salmonella Virulence Effector Ssph2 Functions As A Novel E3 Ligase Length = 622 Back     alignment and structure
>pdb|4ECO|A Chain A, Crystal Structure Of A Hypothetical Protein (Bacegg_03329) From Bacteroides Eggerthii Dsm 20697 At 2.70 A Resolution Length = 636 Back     alignment and structure
>pdb|3OJA|A Chain A, Crystal Structure Of Lrim1APL1C COMPLEX Length = 487 Back     alignment and structure
>pdb|3O53|A Chain A, Crystal Structure Of Lrim1 Leucine-Rich Repeat Domain Length = 317 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query693
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-66
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 9e-63
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-60
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-49
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-20
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-64
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-61
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-61
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-55
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 7e-25
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 6e-22
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-62
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-60
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-32
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 8e-29
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-06
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 4e-59
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-58
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-53
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-46
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-25
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-22
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-56
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-47
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-21
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-54
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-51
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-49
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-43
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-35
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-25
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-54
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-53
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 9e-32
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-26
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-23
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-23
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 5e-04
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-54
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-48
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-47
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-30
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-27
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-26
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-25
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 1e-53
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 5e-51
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-36
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-20
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 9e-52
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-49
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-44
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-38
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-28
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 9e-06
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-51
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-46
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-43
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-35
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-22
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-50
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 3e-42
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 8e-37
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-29
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-27
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-15
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-13
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-49
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-48
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-39
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-26
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-10
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 8e-48
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-41
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-35
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-33
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 2e-05
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-46
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-43
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-39
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-38
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-29
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 7e-17
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 1e-06
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 9e-46
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-37
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-27
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-20
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 7e-16
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-45
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-42
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-39
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-38
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-29
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-16
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-06
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 8e-45
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 6e-32
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-27
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-27
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-44
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 8e-37
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-35
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-33
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-28
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-04
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-42
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-39
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-36
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-34
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 8e-32
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 8e-16
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-07
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-41
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-38
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-30
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-41
4fmz_A347 Internalin; leucine rich repeat, structural genomi 4e-39
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-36
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-31
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 9e-40
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-35
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-34
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-33
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-30
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-24
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-24
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 5e-17
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-16
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-38
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-36
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-29
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-28
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-14
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 5e-13
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-37
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-31
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-26
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-13
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-10
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-36
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-25
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-22
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 9e-13
1o6v_A466 Internalin A; bacterial infection, extracellular r 7e-36
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-35
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-30
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-20
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-35
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-35
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-31
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-27
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-24
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-24
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-16
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 7e-16
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-15
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-34
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-32
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 7e-31
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-26
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-14
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-33
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-31
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-28
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 8e-28
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 7e-27
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-21
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 6e-21
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 7e-32
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-30
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-28
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-18
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-15
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-12
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-31
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-30
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-29
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-26
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-25
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-24
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 9e-22
2o6q_A 270 Variable lymphocyte receptor A; leucine-rich repea 4e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-30
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-28
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-23
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-20
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-20
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-30
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-29
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 9e-27
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-25
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-22
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 7e-12
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-04
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-29
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-27
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-23
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-21
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-28
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 3e-28
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-26
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-25
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-25
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-23
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 7e-04
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-26
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-19
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-18
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-17
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-26
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 6e-26
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-20
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-19
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 5e-13
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 7e-09
2v9t_B 220 SLIT homolog 2 protein N-product; structural prote 1e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-24
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-23
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-20
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-19
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-19
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 5e-19
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-15
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 8e-14
2v70_A 220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-23
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-21
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-18
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-18
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 3e-17
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 3e-17
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 3e-10
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-23
3m19_A251 Variable lymphocyte receptor A diversity region; a 5e-23
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-22
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-21
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-20
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-19
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-18
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-14
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-06
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 4e-23
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 5e-23
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 8e-23
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 3e-15
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 4e-09
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-21
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-21
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-20
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-18
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-21
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-21
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 7e-16
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 1e-07
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-21
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-21
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-18
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-16
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-19
3e6j_A229 Variable lymphocyte receptor diversity region; var 5e-17
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-16
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-16
3e6j_A229 Variable lymphocyte receptor diversity region; var 5e-14
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-11
3e6j_A229 Variable lymphocyte receptor diversity region; var 6e-10
3e6j_A229 Variable lymphocyte receptor diversity region; var 9e-10
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 4e-19
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 7e-19
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 4e-19
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-18
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 7e-18
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 7e-15
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 5e-14
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 4e-10
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 5e-08
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-17
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-17
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-14
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-12
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 2e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-17
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-17
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-12
4ezg_A197 Putative uncharacterized protein; internalin-A, le 4e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-10
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 7e-17
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 8e-13
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-12
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-12
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 8e-17
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 5e-15
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-10
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-10
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 8e-08
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 6e-07
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 7e-04
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 8e-17
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-16
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-14
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-11
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-10
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-08
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-06
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 8e-06
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 8e-17
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 4e-16
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 8e-14
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 1e-12
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 2e-12
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 1e-11
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 3e-10
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-16
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-13
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-13
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-11
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-07
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-07
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 3e-04
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-16
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-16
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-14
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-13
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 5e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-15
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-10
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-09
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-15
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-15
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-11
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-10
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-15
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 7e-14
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 7e-13
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 7e-11
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-10
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 5e-10
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-09
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 3e-09
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-14
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-12
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-10
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-10
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 7e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-04
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 3e-13
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 3e-10
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 2e-09
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 3e-08
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 9e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-13
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-05
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 7e-13
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 7e-10
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 7e-10
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 3e-09
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 2e-08
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 1e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 3e-12
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 1e-07
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 5e-06
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 6e-06
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 3e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-11
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-11
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-09
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-07
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 6e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 5e-11
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 7e-11
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-09
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-09
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-07
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-05
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-10
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 9e-10
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-06
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 5e-06
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 1e-05
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 7e-10
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 7e-09
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 4e-08
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 9e-10
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 4e-08
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 2e-09
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-07
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 6e-06
4fdw_A401 Leucine rich hypothetical protein; putative cell s 6e-08
4fdw_A401 Leucine rich hypothetical protein; putative cell s 5e-06
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 1e-06
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 4e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 5e-04
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 6e-05
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 3e-04
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 5e-04
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 5e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 1e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 3e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 5e-04
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 1e-04
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 8e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 4e-04
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
 Score =  229 bits (587), Expect = 4e-66
 Identities = 99/480 (20%), Positives = 190/480 (39%), Gaps = 38/480 (7%)

Query: 67  SLFSKLNITTINTLAFSNSPSNVGVLSPPYFDGLHFVKHILLSHNKEITGLHKDIFKG-- 124
                   +++  L  S++   +   SP  F  +  +  + L++ +    L + +     
Sbjct: 163 EELDIFANSSLKKLELSSN--QIKEFSPGCFHAIGRLFGLFLNNVQLGPSLTEKLCLELA 220

Query: 125 TPQLESLNLRGNSITELYSGVFQ--YVPKLQVLDLGSNDVAYMDPEIFKNLTSLRILNLD 182
              + +L+L  + ++   +  F       L +LDL  N++  +  + F  L  L    L+
Sbjct: 221 NTSIRNLSLSNSQLSTTSNTTFLGLKWTNLTMLDLSYNNLNVVGNDSFAWLPQLEYFFLE 280

Query: 183 HNQLINLTRAIFNNVPNLRSLD---------ISGNNISILPSGVFSDLRKLQTFYANSNR 233
           +N + +L     + + N+R L+         IS  ++  +    F  L+ L+      N 
Sbjct: 281 YNNIQHLFSHSLHGLFNVRYLNLKRSFTKQSISLASLPKIDDFSFQWLKCLEHLNMEDND 340

Query: 234 FQMFPKDLFAEMKYLQVIKISYHKDSLKELPSGLFANLPL--LNTVILGESSIAELPSDL 291
                 ++F  +  L+ + +S    SL+ L +  F +L    L+ + L ++ I+++ SD 
Sbjct: 341 IPGIKSNMFTGLINLKYLSLSNSFTSLRTLTNETFVSLAHSPLHILNLTKNKISKIESDA 400

Query: 292 FWNSTNITNIVLTGHKKLTSLPSTLFRDCKKLVKLELQRNKLKYLPENLFESLKELYTLN 351
           F    ++  + L  ++    L    +R  + + ++ L  NK   L  N F  +  L  L 
Sbjct: 401 FSWLGHLEVLDLGLNEIGQELTGQEWRGLENIFEIYLSYNKYLQLTRNSFALVPSLQRLM 460

Query: 352 LKNNQLENITS----LVGLSGLNSLDLSWNQLEQINLIAFDGLSSLNTVDLSHNLLTFDE 407
           L+   L+N+ S       L  L  LDLS N +  IN    +GL  L  +DL HN L    
Sbjct: 461 LRRVALKNVDSSPSPFQPLRNLTILDLSNNNIANINDDMLEGLEKLEILDLQHNNLARLW 520

Query: 408 YQYG----YSPLKQCVNLETINLSYNRISSLFDDWISSMTSLKELDLRHNNFSFIPDQLD 463
                      LK   +L  +NL  N    +  +    +  LK +DL  NN + +P  + 
Sbjct: 521 KHANPGGPIYFLKGLSHLHILNLESNGFDEIPVEVFKDLFELKIIDLGLNNLNTLPASVF 580

Query: 464 SIVSNKLTLDLSFNQIAIVDLRTLEIKAAAQDPNEDSTMVARSANIVILNDNPIACNCSN 523
           +   +  +L+L  N I  V+ +                   R+   + +  NP  C C +
Sbjct: 581 NNQVSLKSLNLQKNLITSVEKKVFGP-------------AFRNLTELDMRFNPFDCTCES 627


>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Length = 329 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Length = 329 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Length = 329 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Length = 401 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Length = 401 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Length = 130 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Length = 130 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Length = 130 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Length = 130 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Length = 267 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Length = 267 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query693
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
4fmz_A347 Internalin; leucine rich repeat, structural genomi 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 100.0
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 100.0
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 100.0
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 100.0
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 100.0
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.98
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.97
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.97
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.97
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.96
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.95
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.95
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.95
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.95
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.95
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.94
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.94
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.94
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.94
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.94
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.93
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.93
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.93
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.92
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.92
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.92
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.92
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.91
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.91
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.91
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.91
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.91
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.9
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.9
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.9
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.9
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.9
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.9
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.89
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.89
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.89
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.89
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.89
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.88
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.88
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.88
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.87
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.86
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.86
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.86
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.85
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.85
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.85
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.85
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.85
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.84
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.84
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.84
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.83
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.83
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.83
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.81
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.81
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.81
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.8
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.8
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.79
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.79
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.79
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.79
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.79
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.78
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.77
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.77
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.77
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.75
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.75
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.74
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.73
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.73
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.73
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.72
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.71
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.68
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.67
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.66
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.63
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.63
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.63
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.62
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.61
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.61
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.58
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.58
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.56
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.54
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.53
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.53
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.53
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.52
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.49
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.43
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.42
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.34
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.32
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.28
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.25
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 99.16
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.15
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.65
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.65
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.48
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 98.47
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.44
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.18
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.13
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.04
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.8
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.43
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.42
2lz0_A100 Uncharacterized protein; hypothetical leucine rich 94.08
2lz0_A100 Uncharacterized protein; hypothetical leucine rich 91.33
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=2.1e-58  Score=533.46  Aligned_cols=624  Identities=20%  Similarity=0.172  Sum_probs=368.2

Q ss_pred             EeccCCeEEEEecCCCCCCCccCCCCCCCCCccEEEEEcCCCCCccHHHHh-hhcCcccccEEEeecCCCCccCCCCccC
Q psy8029          19 EIDCSHFVGVENSSSSNGSIYDRLPEQNLGPFNAVTFTFCPLPDENFISLF-SKLNITTINTLAFSNSPSNVGVLSPPYF   97 (693)
Q Consensus        19 ~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~L~l~~c~l~~~~~~~~~-~~~~~~~L~~L~l~~~~~~i~~l~~~~~   97 (693)
                      ..|||.|.+|.|.  .             ++|+.|+++++.+... +..+. ....++.|+.++++.+  .+..++ ..|
T Consensus        36 ~~~~C~w~gv~C~--~-------------~~v~~L~L~~~~l~g~-~~~l~~~l~~L~~L~~l~~~~~--~~~~l~-~~~   96 (768)
T 3rgz_A           36 NKNPCTFDGVTCR--D-------------DKVTSIDLSSKPLNVG-FSAVSSSLLSLTGLESLFLSNS--HINGSV-SGF   96 (768)
T ss_dssp             TSCGGGSTTEEEE--T-------------TEEEEEECTTSCCCEE-HHHHHHHTTTCTTCCEEECTTS--CEEECC-CCC
T ss_pred             CCCCcCCcceEEC--C-------------CcEEEEECCCCCcCCc-cCccChhHhccCcccccCCcCC--CcCCCc-hhh
Confidence            4689999999995  1             4688889988887653 11111 2234566666666655  444433 457


Q ss_pred             CCcccccEEEccCCcCccccccc--ccCCCCCCcEEEeeCCcccc-cCcccCCCCCCCcEEEcCCCCCCccChhh---hC
Q psy8029          98 DGLHFVKHILLSHNKEITGLHKD--IFKGTPQLESLNLRGNSITE-LYSGVFQYVPKLQVLDLGSNDVAYMDPEI---FK  171 (693)
Q Consensus        98 ~~l~~L~~L~Ls~n~~i~~~~~~--~~~~l~~L~~L~L~~n~i~~-~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~---~~  171 (693)
                      +++++|++|+|++| .+++..+.  .++++++|++|++++|.+++ ++...+.++++|++|++++|.+++..+..   +.
T Consensus        97 ~~l~~L~~L~Ls~n-~l~~~~~~~~~l~~l~~L~~L~Ls~n~l~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~~~  175 (768)
T 3rgz_A           97 KCSASLTSLDLSRN-SLSGPVTTLTSLGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEVLDLSANSISGANVVGWVLSD  175 (768)
T ss_dssp             CCCTTCCEEECCSS-EEEEEGGGGGGGGGCTTCCEEECCSSEEECCSSCCSCCCCTTCSEEECCSSCCEEETHHHHHHTT
T ss_pred             ccCCCCCEEECCCC-cCCCcCCChHHHhCCCCCCEEECcCCccCCcCCHHHhccCCCCCEEECCCCccCCcCChhhhhhc
Confidence            77777777777777 66653333  56677777777777777665 33333366777777777777776666555   56


Q ss_pred             CCCCCCEEEccCCCCCCCChhhcCCCCCCcEEECcCCCCCcCCCCcCCCCCCCcEEEcCCCccccCChhhhhcccCceEE
Q psy8029         172 NLTSLRILNLDHNQLINLTRAIFNNVPNLRSLDISGNNISILPSGVFSDLRKLQTFYANSNRFQMFPKDLFAEMKYLQVI  251 (693)
Q Consensus       172 ~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~n~i~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~~~~L~~L  251 (693)
                      ++++|++|++++|++++..+  +..+++|++|++++|.+++..+. +..+++|++|++++|.++...+..|..+++|++|
T Consensus       176 ~l~~L~~L~Ls~n~l~~~~~--~~~l~~L~~L~Ls~n~l~~~~~~-l~~l~~L~~L~Ls~n~l~~~~~~~l~~l~~L~~L  252 (768)
T 3rgz_A          176 GCGELKHLAISGNKISGDVD--VSRCVNLEFLDVSSNNFSTGIPF-LGDCSALQHLDISGNKLSGDFSRAISTCTELKLL  252 (768)
T ss_dssp             CCTTCCEEECCSSEEESCCB--CTTCTTCCEEECCSSCCCSCCCB-CTTCCSCCEEECCSSCCCSCHHHHTTTCSSCCEE
T ss_pred             cCCCCCEEECCCCcccccCC--cccCCcCCEEECcCCcCCCCCcc-cccCCCCCEEECcCCcCCCcccHHHhcCCCCCEE
Confidence            66666666666666655443  25566666666666666654444 5666666666666666665444555556666666


Q ss_pred             EEecCCCc--------------------cc-ccCccccCCCCCccEEEcCCCCCcccCcccccCCCCccEEEecCCCCCC
Q psy8029         252 KISYHKDS--------------------LK-ELPSGLFANLPLLNTVILGESSIAELPSDLFWNSTNITNIVLTGHKKLT  310 (693)
Q Consensus       252 ~l~~n~~~--------------------~~-~i~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~~~~L~~L~l~~n~~l~  310 (693)
                      ++++|.+.                    +. .+|...+..+++|++|++++|.+.+..+..|..+++|++|++++| .+.
T Consensus       253 ~Ls~n~l~~~~~~~~l~~L~~L~L~~n~l~~~ip~~~~~~~~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~L~~n-~l~  331 (768)
T 3rgz_A          253 NISSNQFVGPIPPLPLKSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLESLALSSN-NFS  331 (768)
T ss_dssp             ECCSSCCEESCCCCCCTTCCEEECCSSEEEESCCCCSCTTCTTCSEEECCSSEEEECCCGGGGGCTTCCEEECCSS-EEE
T ss_pred             ECCCCcccCccCccccCCCCEEECcCCccCCccCHHHHhhcCcCCEEECcCCcCCCccchHHhcCCCccEEECCCC-ccc
Confidence            66555532                    11 444443334467777777777776655566677777777777777 443


Q ss_pred             -cCChhhhcCCCCCcEEEccCCCCC-CCChhhhccCc-cCceEeccCCcCcc-ccCc-c--CCCCCCeEeCCCCcccccc
Q psy8029         311 -SLPSTLFRDCKKLVKLELQRNKLK-YLPENLFESLK-ELYTLNLKNNQLEN-ITSL-V--GLSGLNSLDLSWNQLEQIN  383 (693)
Q Consensus       311 -~l~~~~~~~~~~L~~L~l~~n~l~-~~~~~~~~~~~-~L~~L~Ls~n~l~~-l~~~-~--~l~~L~~L~Ls~n~l~~~~  383 (693)
                       .+|...|..+++|++|++++|.++ .+|.. +..++ +|+.|++++|++++ ++.. .  .+++|++|++++|.+++..
T Consensus       332 ~~ip~~~l~~l~~L~~L~Ls~n~l~~~~p~~-l~~l~~~L~~L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~  410 (768)
T 3rgz_A          332 GELPMDTLLKMRGLKVLDLSFNEFSGELPES-LTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKI  410 (768)
T ss_dssp             EECCHHHHTTCTTCCEEECCSSEEEECCCTT-HHHHTTTCSEEECCSSEEEEECCTTTTCSTTCCCCEEECCSSEEEEEC
T ss_pred             CcCCHHHHhcCCCCCEEeCcCCccCccccHH-HHhhhcCCcEEEccCCCcCCCcChhhhhcccCCccEEECCCCcccccc
Confidence             677666677777777777777766 44443 33443 56666666665543 2221 1  1455666666666666655


Q ss_pred             ccccCCCCCCcEEECCCCcCcccccccCCCCccCCCCCcEEECCCCCCCcCChhHHhcCCCCcEEECCCCCCccCCCccc
Q psy8029         384 LIAFDGLSSLNTVDLSHNLLTFDEYQYGYSPLKQCVNLETINLSYNRISSLFDDWISSMTSLKELDLRHNNFSFIPDQLD  463 (693)
Q Consensus       384 ~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~L~~N~l~~~~~~~~  463 (693)
                      +..+..+++|++|++++|.+++.    .+..+..+++|++|++++|.+++..|..+..+++|+.|++++|++++..+..+
T Consensus       411 p~~l~~l~~L~~L~Ls~N~l~~~----~p~~l~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l  486 (768)
T 3rgz_A          411 PPTLSNCSELVSLHLSFNYLSGT----IPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGL  486 (768)
T ss_dssp             CGGGGGCTTCCEEECCSSEEESC----CCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGG
T ss_pred             CHHHhcCCCCCEEECcCCcccCc----ccHHHhcCCCCCEEECCCCcccCcCCHHHcCCCCceEEEecCCcccCcCCHHH
Confidence            65666666666666666665543    23344445555555555555554444444445555555555555554444444


Q ss_pred             ccCCCccEEECCCCCCceeeccchhhhcccCC---CCCc-------cccccccCcEEEcCCCcccccCCcHHHHHHHhcc
Q psy8029         464 SIVSNKLTLDLSFNQIAIVDLRTLEIKAAAQD---PNED-------STMVARSANIVILNDNPIACNCSNYDLIRFVSKK  533 (693)
Q Consensus       464 ~~l~~L~~L~L~~N~l~~~~~~~~~~l~~~~~---~~~~-------~~~~~~~l~~l~l~~Np~~c~C~~~~~~~~~~~~  533 (693)
                      ..+++|+.|++++|++++..+.++..++....   ....       .....++++.+++++|++.+.++..++.......
T Consensus       487 ~~l~~L~~L~L~~N~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~  566 (768)
T 3rgz_A          487 SNCTNLNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIA  566 (768)
T ss_dssp             GGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEEECCGGGGGCTTCCEEECCSSEEESBCCGGGGTTTTCBC
T ss_pred             hcCCCCCEEEccCCccCCcCChHHhcCCCCCEEECCCCcccCcCCHHHcCCCCCCEEECCCCccCCcCChHHhcccchhh
Confidence            44444555555555544443333333221110   0000       0011256889999999998877654432110000


Q ss_pred             cccce-eeeeeeccCce--eecCC------CC---cccccc--------CCCCCcccCCCCCCCcEeeecCCCceEEEEc
Q psy8029         534 MTKTV-YQMLELVTDNL--ECFGN------AG---VGINSV--------RPENLTCDTKPCPARCYCNFSPYYSIMSVNC  593 (693)
Q Consensus       534 ~~~~~-~~~~~~~~~~~--~c~~~------~~---~~~~~l--------~~~~l~c~~~~cp~~~~~~~~~~~~l~~l~l  593 (693)
                      ..... ...........  .|...      .+   ..+..+        ..+.+....   |.    .+..+..++.+|+
T Consensus       567 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~---~~----~~~~l~~L~~LdL  639 (768)
T 3rgz_A          567 ANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHT---SP----TFDNNGSMMFLDM  639 (768)
T ss_dssp             CSTTCSCEEEEEECCSCCTTCCSSEEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEEC---CC----SCSSSBCCCEEEC
T ss_pred             hhccccccccccccccccccccccccccccccccchhhhccccccccccccceecccC---ch----hhhccccccEEEC
Confidence            00000 00000000000  00000      00   000000        001111111   11    1334567899999


Q ss_pred             CCCCcc-cCCCCCCCCccccCceEEEEEecCCccccCCCCCCcccccCcEEEccCCccc-cccC---cCCCccEEEeeCC
Q psy8029         594 SSASLT-HMPDYLPVTYEDKKATSIQLILHNNSINHFLESPPESYKLITDLDLSYNNIS-HVDT---MYPYLNHLELIDS  668 (693)
Q Consensus       594 s~n~l~-~ip~~~~~l~~~~~~~l~~L~Ls~N~l~~~~~~~~~~l~~L~~L~Ls~N~l~-~i~~---~~~~L~~L~l~~N  668 (693)
                      ++|+++ .+|..++.+     ..++.|+|++|+++|.+|..++++++|+.|||++|+++ .||.   .+++|++||+++|
T Consensus       640 s~N~l~g~ip~~l~~l-----~~L~~L~Ls~N~l~g~ip~~l~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~ls~N  714 (768)
T 3rgz_A          640 SYNMLSGYIPKEIGSM-----PYLFILNLGHNDISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNN  714 (768)
T ss_dssp             CSSCCBSCCCGGGGGC-----TTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCEECCCGGGGGCCCCSEEECCSS
T ss_pred             cCCcccccCCHHHhcc-----ccCCEEeCcCCccCCCCChHHhCCCCCCEEECCCCcccCcCChHHhCCCCCCEEECcCC
Confidence            999999 899988887     78899999999999999999999999999999999999 7887   6789999999999


Q ss_pred             ceeEecCCCcccccc
Q psy8029         669 EKIICHGSTKPLNGI  683 (693)
Q Consensus       669 ~l~~~~~~~~~~~~~  683 (693)
                      +++...+++..+...
T Consensus       715 ~l~g~iP~~~~~~~~  729 (768)
T 3rgz_A          715 NLSGPIPEMGQFETF  729 (768)
T ss_dssp             EEEEECCSSSSGGGS
T ss_pred             cccccCCCchhhccC
Confidence            999887777665543



>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>2lz0_A Uncharacterized protein; hypothetical leucine rich repeat protein, structural genomic unknown function; NMR {Bacteroides capillosus} Back     alignment and structure
>2lz0_A Uncharacterized protein; hypothetical leucine rich repeat protein, structural genomic unknown function; NMR {Bacteroides capillosus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 693
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-19
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 9e-19
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-07
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-04
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 0.002
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 3e-16
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-15
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 8e-11
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 8e-07
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-04
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-11
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 5e-09
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 4e-08
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-06
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 9e-05
d1ozna_ 284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-10
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-10
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 1e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 6e-06
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 3e-04
d1p9ag_ 266 c.10.2.7 (G:) von Willebrand factor binding domain 0.002
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 8e-10
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 1e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 4e-04
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.002
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 1e-08
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 2e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 6e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 7e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-08
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 8e-08
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 0.004
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 9e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 6e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 8e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.001
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.003
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 1e-07
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 3e-07
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 4e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 6e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-07
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-07
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 7e-04
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 2e-07
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 1e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 3e-04
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 2e-06
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 1e-04
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 3e-04
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 8e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-05
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 0.003
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 1e-04
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 8e-04
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 0.004
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 1e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 3e-04
d2omxa2199 c.10.2.1 (A:37-235) Internalin B {Listeria monocyt 0.004
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: Decorin
species: Cow (Bos taurus) [TaxId: 9913]
 Score = 86.6 bits (213), Expect = 4e-19
 Identities = 63/299 (21%), Positives = 123/299 (41%), Gaps = 25/299 (8%)

Query: 175 SLRILNLDHNQLINLTRAIFNNVPNLRSLDISGNNISILPSGVFSDLRKLQTFYANSNRF 234
            LR++      L  + + +    P+   LD+  N I+ +  G F +L+ L T    +N+ 
Sbjct: 11  HLRVVQCSDLGLEKVPKDLP---PDTALLDLQNNKITEIKDGDFKNLKNLHTLILINNKI 67

Query: 235 QMFPKDLFAEMKYLQVIKISYHKDSLKELPSGLFANLPLLNTVILGESSIAELPSDLFWN 294
                  FA +  L+ + +S ++  LKELP  +   L  L      E+ I ++   +F  
Sbjct: 68  SKISPGAFAPLVKLERLYLSKNQ--LKELPEKMPKTLQELRV---HENEITKVRKSVFNG 122

Query: 295 STNITNIVLTGHK-KLTSLPSTLFRDCKKLVKLELQRNKLKYLPENLFESLKELYTLNLK 353
              +  + L  +  K + + +  F+  KKL  + +    +  +P+ L  SL EL+   L 
Sbjct: 123 LNQMIVVELGTNPLKSSGIENGAFQGMKKLSYIRIADTNITTIPQGLPPSLTELH---LD 179

Query: 354 NNQLENI--TSLVGLSGLNSLDLSWNQLEQINLIAFDGLSSLNTVDLSHNLLTFDEYQYG 411
            N++  +   SL GL+ L  L LS+N +  ++  +      L  + L++N L        
Sbjct: 180 GNKITKVDAASLKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLNNNKLVKVPGGLA 239

Query: 412 YSPLKQCVNLETINLSYNRISSLFDD------WISSMTSLKELDLRHNNFSFIPDQLDS 464
                    ++ + L  N IS++  +      + +   S   + L  N   +   Q  +
Sbjct: 240 -----DHKYIQVVYLHNNNISAIGSNDFCPPGYNTKKASYSGVSLFSNPVQYWEIQPST 293


>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 199 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query693
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.97
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.97
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.96
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.96
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.95
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.94
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.91
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.89
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.88
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.87
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.86
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.85
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.85
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.82
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.81
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.8
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.78
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.77
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.77
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.74
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.74
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.74
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.72
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.7
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.69
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.58
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.57
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.52
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.5
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.49
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.46
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.4
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.38
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.3
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.29
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.27
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.29
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.27
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.88
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.88
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.29
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.08
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
Probab=99.97  E-value=1.2e-29  Score=266.72  Aligned_cols=343  Identities=24%  Similarity=0.355  Sum_probs=163.3

Q ss_pred             CCcccccEEEccCCcCcccccccccCCCCCCcEEEeeCCcccccCcccCCCCCCCcEEEcCCCCCCccChhhhCCCCCCC
Q psy8029          98 DGLHFVKHILLSHNKEITGLHKDIFKGTPQLESLNLRGNSITELYSGVFQYVPKLQVLDLGSNDVAYMDPEIFKNLTSLR  177 (693)
Q Consensus        98 ~~l~~L~~L~Ls~n~~i~~~~~~~~~~l~~L~~L~L~~n~i~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~l~~L~  177 (693)
                      ..+.+|++|+++++ +|+++..  ++.+++|++|++++|+|+++++  |+++++|++|++++|.+.++.+  ++++++|+
T Consensus        41 ~~l~~l~~L~l~~~-~I~~l~g--l~~L~nL~~L~Ls~N~l~~l~~--l~~L~~L~~L~L~~n~i~~i~~--l~~l~~L~  113 (384)
T d2omza2          41 TDLDQVTTLQADRL-GIKSIDG--VEYLNNLTQINFSNNQLTDITP--LKNLTKLVDILMNNNQIADITP--LANLTNLT  113 (384)
T ss_dssp             HHHTTCCEEECCSS-CCCCCTT--GGGCTTCCEEECCSSCCCCCGG--GTTCTTCCEEECCSSCCCCCGG--GTTCTTCC
T ss_pred             HHhCCCCEEECCCC-CCCCccc--cccCCCCCEEeCcCCcCCCCcc--ccCCcccccccccccccccccc--cccccccc
Confidence            34556667777766 6666532  5556666777777666666653  5666666666666666665543  56666666


Q ss_pred             EEEccCCCCCCCChhhcCCCCCCcEEECcCCCCCcCCCCcCCCCCCCcEEEcCCCccccCChhhhhcccCceEEEEecCC
Q psy8029         178 ILNLDHNQLINLTRAIFNNVPNLRSLDISGNNISILPSGVFSDLRKLQTFYANSNRFQMFPKDLFAEMKYLQVIKISYHK  257 (693)
Q Consensus       178 ~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~n~i~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~~~~L~~L~l~~n~  257 (693)
                      .|+++++.++++..  ......+.......+.+..+......................     .+.............+.
T Consensus       114 ~L~~~~~~~~~~~~--~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~-----~~~~~~~~~~~~~~~~~  186 (384)
T d2omza2         114 GLTLFNNQITDIDP--LKNLTNLNRLELSSNTISDISALSGLTSLQQLSFGNQVTDLK-----PLANLTTLERLDISSNK  186 (384)
T ss_dssp             EEECCSSCCCCCGG--GTTCTTCSEEEEEEEEECCCGGGTTCTTCSEEEEEESCCCCG-----GGTTCTTCCEEECCSSC
T ss_pred             cccccccccccccc--ccccccccccccccccccccccccccccccccccccccchhh-----hhccccccccccccccc
Confidence            66666666665543  233445555555555444333221111111111111111111     11222222233333222


Q ss_pred             CcccccCccccCCCCCccEEEcCCCCCcccCcccccCCCCccEEEecCCCCCCcCChhhhcCCCCCcEEEccCCCCCCCC
Q psy8029         258 DSLKELPSGLFANLPLLNTVILGESSIAELPSDLFWNSTNITNIVLTGHKKLTSLPSTLFRDCKKLVKLELQRNKLKYLP  337 (693)
Q Consensus       258 ~~~~~i~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~~~~L~~L~l~~n~~l~~l~~~~~~~~~~L~~L~l~~n~l~~~~  337 (693)
                        .  .....+..+++++.+++++|.++.+++  +..+++|+.+++++| .++.++.  +..+++|+.+++++|.++.++
T Consensus       187 --~--~~~~~~~~l~~~~~l~l~~n~i~~~~~--~~~~~~L~~L~l~~n-~l~~~~~--l~~l~~L~~L~l~~n~l~~~~  257 (384)
T d2omza2         187 --V--SDISVLAKLTNLESLIATNNQISDITP--LGILTNLDELSLNGN-QLKDIGT--LASLTNLTDLDLANNQISNLA  257 (384)
T ss_dssp             --C--CCCGGGGGCTTCSEEECCSSCCCCCGG--GGGCTTCCEEECCSS-CCCCCGG--GGGCTTCSEEECCSSCCCCCG
T ss_pred             --c--ccccccccccccceeeccCCccCCCCc--ccccCCCCEEECCCC-CCCCcch--hhcccccchhccccCccCCCC
Confidence              1  111123444555555555555544432  233444555555555 4444432  334455555555555554444


Q ss_pred             hhhhccCccCceEeccCCcCccccCccCCCCCCeEeCCCCccccccccccCCCCCCcEEECCCCcCcccccccCCCCccC
Q psy8029         338 ENLFESLKELYTLNLKNNQLENITSLVGLSGLNSLDLSWNQLEQINLIAFDGLSSLNTVDLSHNLLTFDEYQYGYSPLKQ  417 (693)
Q Consensus       338 ~~~~~~~~~L~~L~Ls~n~l~~l~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~~~~~  417 (693)
                      +  +..+++|+.|++++++++.++....++.++.++++.|.++++.  .+..+++++.|++++|++++.      .++..
T Consensus       258 ~--~~~~~~L~~L~l~~~~l~~~~~~~~~~~l~~l~~~~n~l~~~~--~~~~~~~l~~L~ls~n~l~~l------~~l~~  327 (384)
T d2omza2         258 P--LSGLTKLTELKLGANQISNISPLAGLTALTNLELNENQLEDIS--PISNLKNLTYLTLYFNNISDI------SPVSS  327 (384)
T ss_dssp             G--GTTCTTCSEEECCSSCCCCCGGGTTCTTCSEEECCSSCCSCCG--GGGGCTTCSEEECCSSCCSCC------GGGGG
T ss_pred             c--ccccccCCEeeccCcccCCCCcccccccccccccccccccccc--ccchhcccCeEECCCCCCCCC------ccccc
Confidence            3  3444555555555555554444444445555555555544432  233444455555555544421      12444


Q ss_pred             CCCCcEEECCCCCCCcCChhHHhcCCCCcEEECCCCCCccCCCcccccCCCccEEECCCC
Q psy8029         418 CVNLETINLSYNRISSLFDDWISSMTSLKELDLRHNNFSFIPDQLDSIVSNKLTLDLSFN  477 (693)
Q Consensus       418 l~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~L~~N~l~~~~~~~~~~l~~L~~L~L~~N  477 (693)
                      +++|++|++++|+++++.  .+.++++|++|++++|+|+++++  +..+++|+.|+|++|
T Consensus       328 l~~L~~L~L~~n~l~~l~--~l~~l~~L~~L~l~~N~l~~l~~--l~~l~~L~~L~L~~N  383 (384)
T d2omza2         328 LTKLQRLFFANNKVSDVS--SLANLTNINWLSAGHNQISDLTP--LANLTRITQLGLNDQ  383 (384)
T ss_dssp             CTTCCEEECCSSCCCCCG--GGGGCTTCCEEECCSSCCCBCGG--GTTCTTCSEEECCCE
T ss_pred             CCCCCEEECCCCCCCCCh--hHcCCCCCCEEECCCCcCCCChh--hccCCCCCEeeCCCC
Confidence            455555555555554432  24445555555555555554433  344444555555444



>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure