Psyllid ID: psy8031


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------
MFPKDLFAEMKYLQVIKISYHKDSLKELPSGLFANLPLLNTVILGESSIAELPSDLFWNSTNITNIVLTGHKKLTSLPSTLFRDCKKLVKLELQRNKLKYLPENLFESLKELYTLNLKNNQLENITR
ccccccccccccccEEccccccccccccccccccccccccEEEccccccccccHHHccccccccEEcccccccccccccccccccccccEEEcccccccccccHHccccccccEEEccccccccccc
cccccHHHccccccEEEEEccccccccccccHHHccccccEEEccccccccccccHHHccccccEEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccc
MFPKDLFAEMKYLQVIKISYHkdslkelpsglfanlpllntvilgessiaelpsdlfwnstnitnivltghkkltslpstlfrDCKKLVKLELQRNKLKYLPENLFESLKELYTLNlknnqlenitr
MFPKDLFAEMKYLQVIKISYHKDSLKELPSGLFANLPLLNTVILGESSIAELPSDLFWNSTNITNIVLTGHKKLTSLPSTLFRDCKKLVKLELQRNKLKYLPENLFESLKElytlnlknnqlenitr
MFPKDLFAEMKYLQVIKISYHKDSLKELPSGLFANLPLLNTVILGESSIAELPSDLFWNSTNITNIVLTGHKKLTSLPSTLFRDCKKLVKLELQRNKLKYLPENLFESLKELYTLNLKNNQLENITR
*****LFAEMKYLQVIKISYHKDSLKELPSGLFANLPLLNTVILGESSIAELPSDLFWNSTNITNIVLTGHKKLTSLPSTLFRDCKKLVKLELQRNKLKYLPENLFESLKELYTLNLK*********
MFPKDLFAEMKYLQVIKISYHKDSLKELPSGLFANLPLLNTVILGESSIAELPSDLFWNSTNITNIVLTGHKKLTSLPSTLFRDCKKLVKLELQRNKLKYLPENLFESLKELYTLNLKNNQLENIT*
MFPKDLFAEMKYLQVIKISYHKDSLKELPSGLFANLPLLNTVILGESSIAELPSDLFWNSTNITNIVLTGHKKLTSLPSTLFRDCKKLVKLELQRNKLKYLPENLFESLKELYTLNLKNNQLENITR
MFPKDLFAEMKYLQVIKISYHKDSLKELPSGLFANLPLLNTVILGESSIAELPSDLFWNSTNITNIVLTGHKKLTSLPSTLFRDCKKLVKLELQRNKLKYLPENLFESLKELYTLNLKNNQL*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFPKDLFAEMKYLQVIKISYHKDSLKELPSGLFANLPLLNTVILGESSIAELPSDLFWNSTNITNIVLTGHKKLTSLPSTLFRDCKKLVKLELQRNKLKYLPENLFESLKELYTLNLKNNQLENITR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query127 2.2.26 [Sep-21-2011]
P08953 1097 Protein toll OS=Drosophil yes N/A 0.968 0.112 0.392 2e-13
O08770 567 Platelet glycoprotein V O yes N/A 0.921 0.206 0.310 4e-09
Q9DBB9 547 Carboxypeptidase N subuni yes N/A 0.952 0.221 0.338 5e-09
Q6EMK4 673 Vasorin OS=Homo sapiens G yes N/A 0.779 0.147 0.31 8e-09
Q9WVB4 1523 Slit homolog 3 protein OS no N/A 0.881 0.073 0.300 1e-08
Q8TF66 581 Leucine-rich repeat-conta no N/A 0.960 0.209 0.278 1e-08
O88280 1523 Slit homolog 3 protein OS no N/A 0.881 0.073 0.300 1e-08
Q9CZT5 673 Vasorin OS=Mus musculus G no N/A 0.787 0.148 0.306 3e-08
Q9N0E3 473 Reticulon-4 receptor OS=M N/A N/A 0.763 0.205 0.336 4e-08
Q80WD0 445 Reticulon-4 receptor-like no N/A 0.818 0.233 0.342 5e-08
>sp|P08953|TOLL_DROME Protein toll OS=Drosophila melanogaster GN=Tl PE=1 SV=1 Back     alignment and function desciption
 Score = 74.3 bits (181), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 49/125 (39%), Positives = 71/125 (56%), Gaps = 2/125 (1%)

Query: 2   FPKDLFAEMKYLQVIKISYHKDSLKELPSGLFANLPLLNTVILGESSIAELPSDLFWNST 61
            P+ LF   K+L  +++  ++  L  LPS LFAN P L  + L  + +  LP DLF +ST
Sbjct: 284 LPQGLFDHNKHLNEVRLMNNRVPLATLPSRLFANQPELQILRL-RAELQSLPGDLFEHST 342

Query: 62  NITNIVLTGHKKLTSLPSTLFRDCKKLVKLELQRNKLKYLPENLFESLKELYTLNLKNNQ 121
            ITNI L G   L +LP+TL      L+ L+L  N+L +LP++LF     L  L L++N 
Sbjct: 343 QITNISL-GDNLLKTLPATLLEHQVNLLSLDLSNNRLTHLPDSLFAHTTNLTDLRLEDNL 401

Query: 122 LENIT 126
           L  I+
Sbjct: 402 LTGIS 406




Component of the extracellular signaling pathway that establishes the dorsal-ventral pathway of the embryo. Three proteases; ndl, gd and snk process easter to create active easter. Active easter defines cell identities along the dorsal-ventral continuum by activating the spz ligand for the Tl receptor in the ventral region of the embryo. Promotes heterophilic cellular adhesion. Spz C-106 in the hemolymph controls expression of the antifungal peptide Drosomycin (Drs) by acting as a ligand of Tl and inducing an intracellular signaling pathway.
Drosophila melanogaster (taxid: 7227)
>sp|O08770|GPV_RAT Platelet glycoprotein V OS=Rattus norvegicus GN=Gp5 PE=3 SV=1 Back     alignment and function description
>sp|Q9DBB9|CPN2_MOUSE Carboxypeptidase N subunit 2 OS=Mus musculus GN=Cpn2 PE=1 SV=2 Back     alignment and function description
>sp|Q6EMK4|VASN_HUMAN Vasorin OS=Homo sapiens GN=VASN PE=1 SV=1 Back     alignment and function description
>sp|Q9WVB4|SLIT3_MOUSE Slit homolog 3 protein OS=Mus musculus GN=Slit3 PE=2 SV=2 Back     alignment and function description
>sp|Q8TF66|LRC15_HUMAN Leucine-rich repeat-containing protein 15 OS=Homo sapiens GN=LRRC15 PE=1 SV=2 Back     alignment and function description
>sp|O88280|SLIT3_RAT Slit homolog 3 protein OS=Rattus norvegicus GN=Slit3 PE=2 SV=1 Back     alignment and function description
>sp|Q9CZT5|VASN_MOUSE Vasorin OS=Mus musculus GN=Vasn PE=2 SV=2 Back     alignment and function description
>sp|Q9N0E3|RTN4R_MACFA Reticulon-4 receptor OS=Macaca fascicularis GN=RTN4R PE=2 SV=1 Back     alignment and function description
>sp|Q80WD0|R4RL1_RAT Reticulon-4 receptor-like 1 OS=Rattus norvegicus GN=Rtn4rl1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query127
194745081 1098 GF16456 [Drosophila ananassae] gi|190628 0.968 0.112 0.424 4e-15
156545700 1050 PREDICTED: protein toll [Nasonia vitripe 0.968 0.117 0.403 8e-15
307210111 1094 Protein toll [Harpegnathos saltator] 0.976 0.113 0.384 3e-13
332031266 1016 Protein toll [Acromyrmex echinatior] 0.976 0.122 0.376 1e-12
194907829 1097 GG11504 [Drosophila erecta] gi|190656275 0.968 0.112 0.392 1e-12
195113121 1104 GI22147 [Drosophila mojavensis] gi|19391 0.968 0.111 0.392 2e-12
195349768 653 GM10345 [Drosophila sechellia] gi|194123 0.968 0.188 0.4 2e-12
284010539 259 variable lymphocyte receptor A [Eptatret 0.913 0.447 0.411 3e-12
195061331 1111 GH14238 [Drosophila grimshawi] gi|193891 0.968 0.110 0.392 3e-12
345479829 1028 PREDICTED: protein toll [Nasonia vitripe 0.960 0.118 0.430 4e-12
>gi|194745081|ref|XP_001955021.1| GF16456 [Drosophila ananassae] gi|190628058|gb|EDV43582.1| GF16456 [Drosophila ananassae] Back     alignment and taxonomy information
 Score = 85.9 bits (211), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 76/125 (60%), Gaps = 2/125 (1%)

Query: 2   FPKDLFAEMKYLQVIKISYHKDSLKELPSGLFANLPLLNTVILGESSIAELPSDLFWNST 61
            P+ LF    +LQ ++IS ++  L  LPS LFANLP L  + L ++ +  LP DL   ST
Sbjct: 286 LPEGLFEHNTHLQQVRISNNRAKLTTLPSRLFANLPELKVLFL-KTDLESLPGDLLEGST 344

Query: 62  NITNIVLTGHKKLTSLPSTLFRDCKKLVKLELQRNKLKYLPENLFESLKELYTLNLKNNQ 121
            ITNI L  ++ LT+LP+ L      L+ L+L  N+L +LP+ +FE  KEL  LNL++N 
Sbjct: 345 GITNISLASNR-LTTLPAKLLEYQSNLLSLDLSHNQLTHLPDGIFEHNKELKDLNLESNY 403

Query: 122 LENIT 126
           L  I+
Sbjct: 404 LTGIS 408




Source: Drosophila ananassae

Species: Drosophila ananassae

Genus: Drosophila

Family: Drosophilidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|156545700|ref|XP_001604577.1| PREDICTED: protein toll [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|307210111|gb|EFN86808.1| Protein toll [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|332031266|gb|EGI70800.1| Protein toll [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|194907829|ref|XP_001981637.1| GG11504 [Drosophila erecta] gi|190656275|gb|EDV53507.1| GG11504 [Drosophila erecta] Back     alignment and taxonomy information
>gi|195113121|ref|XP_002001117.1| GI22147 [Drosophila mojavensis] gi|193917711|gb|EDW16578.1| GI22147 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|195349768|ref|XP_002041414.1| GM10345 [Drosophila sechellia] gi|194123109|gb|EDW45152.1| GM10345 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|284010539|dbj|BAI66749.1| variable lymphocyte receptor A [Eptatretus burgeri] Back     alignment and taxonomy information
>gi|195061331|ref|XP_001995975.1| GH14238 [Drosophila grimshawi] gi|193891767|gb|EDV90633.1| GH14238 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|345479829|ref|XP_001604871.2| PREDICTED: protein toll [Nasonia vitripennis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query127
FB|FBgn0262473 1097 Tl "Toll" [Drosophila melanoga 0.960 0.111 0.395 1.5e-14
MGI|MGI:1919006 547 Cpn2 "carboxypeptidase N, poly 0.937 0.217 0.346 8.7e-12
UNIPROTKB|P22792 545 CPN2 "Carboxypeptidase N subun 0.944 0.220 0.325 1.8e-11
FB|FBgn0259677 1639 CG42346 [Drosophila melanogast 0.921 0.071 0.346 3.8e-11
UNIPROTKB|F1RR92 1340 SLIT3 "Uncharacterized protein 0.881 0.083 0.300 2.2e-10
WB|WBGene00002282 773 let-4 [Caenorhabditis elegans 0.952 0.156 0.314 2.9e-10
UNIPROTKB|F1MMM6 1339 SLIT3 "Uncharacterized protein 0.881 0.083 0.300 3.5e-10
UNIPROTKB|Q8WXD0 754 RXFP2 "Relaxin receptor 2" [Ho 0.960 0.161 0.333 3.5e-10
MGI|MGI:1315202 1523 Slit3 "slit homolog 3 (Drosoph 0.881 0.073 0.300 4.1e-10
RGD|69311 1523 Slit3 "slit homolog 3 (Drosoph 0.881 0.073 0.300 5.2e-10
FB|FBgn0262473 Tl "Toll" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 199 (75.1 bits), Expect = 1.5e-14, P = 1.5e-14
 Identities = 49/124 (39%), Positives = 71/124 (57%)

Query:     3 PKDLFAEMKYLQVIKISYHKDSLKELPSGLFANLPLLNTVILGESSIAELPSDLFWNSTN 62
             P+ LF   K+L  +++  ++  L  LPS LFAN P L  + L  + +  LP DLF +ST 
Sbjct:   285 PQGLFDHNKHLNEVRLMNNRVPLATLPSRLFANQPELQILRL-RAELQSLPGDLFEHSTQ 343

Query:    63 ITNIVLTGHKKLTSLPSTLFRDCKKLVKLELQRNKLKYLPENLFESLKELYTLNLKNNQL 122
             ITNI L G   L +LP+TL      L+ L+L  N+L +LP++LF     L  L L++N L
Sbjct:   344 ITNISL-GDNLLKTLPATLLEHQVNLLSLDLSNNRLTHLPDSLFAHTTNLTDLRLEDNLL 402

Query:   123 ENIT 126
               I+
Sbjct:   403 TGIS 406


GO:0019730 "antimicrobial humoral response" evidence=IGI
GO:0019732 "antifungal humoral response" evidence=IMP
GO:0006963 "positive regulation of antibacterial peptide biosynthetic process" evidence=IMP
GO:0006967 "positive regulation of antifungal peptide biosynthetic process" evidence=IMP
GO:0004888 "transmembrane signaling receptor activity" evidence=IEA;NAS
GO:0008063 "Toll signaling pathway" evidence=IEA;NAS
GO:0005887 "integral to plasma membrane" evidence=NAS
GO:0006952 "defense response" evidence=NAS;TAS
GO:0009950 "dorsal/ventral axis specification" evidence=IMP;NAS;TAS
GO:0030097 "hemopoiesis" evidence=TAS
GO:0007416 "synapse assembly" evidence=IMP
GO:0006955 "immune response" evidence=TAS
GO:0009620 "response to fungus" evidence=TAS
GO:0016021 "integral to membrane" evidence=NAS
GO:0009880 "embryonic pattern specification" evidence=TAS
GO:0070976 "TIR domain binding" evidence=IPI
GO:0009617 "response to bacterium" evidence=NAS
GO:0050832 "defense response to fungus" evidence=TAS
GO:0045087 "innate immune response" evidence=IDA;NAS;TAS
GO:0019955 "cytokine binding" evidence=TAS
GO:0050830 "defense response to Gram-positive bacterium" evidence=IEA;TAS
GO:0035007 "regulation of melanization defense response" evidence=TAS
GO:0035172 "hemocyte proliferation" evidence=IMP;TAS
GO:0000910 "cytokinesis" evidence=IMP
GO:0007352 "zygotic specification of dorsal/ventral axis" evidence=IEA;NAS
GO:0045610 "regulation of hemocyte differentiation" evidence=IMP
GO:0007507 "heart development" evidence=IMP
GO:0005515 "protein binding" evidence=IPI
GO:0043234 "protein complex" evidence=IPI
GO:0005886 "plasma membrane" evidence=IDA
GO:0033565 "ESCRT-0 complex" evidence=IDA
GO:0016201 "synaptic target inhibition" evidence=IMP
GO:0009897 "external side of plasma membrane" evidence=IDA
MGI|MGI:1919006 Cpn2 "carboxypeptidase N, polypeptide 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|P22792 CPN2 "Carboxypeptidase N subunit 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
FB|FBgn0259677 CG42346 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F1RR92 SLIT3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
WB|WBGene00002282 let-4 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|F1MMM6 SLIT3 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q8WXD0 RXFP2 "Relaxin receptor 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1315202 Slit3 "slit homolog 3 (Drosophila)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|69311 Slit3 "slit homolog 3 (Drosophila)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query127
pfam13306128 pfam13306, LRR_5, Leucine rich repeats (6 copies) 1e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-05
PRK15370 754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 6e-04
pfam13306128 pfam13306, LRR_5, Leucine rich repeats (6 copies) 0.004
>gnl|CDD|205486 pfam13306, LRR_5, Leucine rich repeats (6 copies) Back     alignment and domain information
 Score = 44.1 bits (105), Expect = 1e-06
 Identities = 22/93 (23%), Positives = 42/93 (45%), Gaps = 6/93 (6%)

Query: 23  DSLKELPSGLFANLPLLNTVILGESSIAELPSDLFWNSTNITNIVLTGHKKLTSLPSTLF 82
            S+  +    F+    L ++ L  SS+  + S  F+N +++T+I +     LTS+    F
Sbjct: 20  SSVTSIGEYAFSGCTSLKSITLP-SSLTSIGSYAFYNCSSLTSITI--PSSLTSIGEYAF 76

Query: 83  RDCKKLVKLELQRNKLKYLPENLFE--SLKELY 113
            +C  L  + +  + L  +    F   SLK + 
Sbjct: 77  SNCSSLTSITIP-SNLTTIGSYAFSNCSLKSIT 108


This family includes a number of leucine rich repeats. This family contains a large number of BSPA-like surface antigens from Trichomonas vaginalis. Length = 128

>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|205486 pfam13306, LRR_5, Leucine rich repeats (6 copies) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 127
KOG4194|consensus 873 99.68
KOG4194|consensus 873 99.65
KOG4237|consensus 498 99.59
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.51
KOG4237|consensus 498 99.5
KOG0617|consensus264 99.49
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 99.42
KOG0617|consensus264 99.42
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 99.41
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.4
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.37
KOG0472|consensus565 99.32
KOG0472|consensus 565 99.31
KOG0444|consensus 1255 99.31
KOG0444|consensus 1255 99.29
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.26
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 99.23
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.08
KOG0618|consensus 1081 99.05
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 99.02
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.01
PLN03150623 hypothetical protein; Provisional 99.0
KOG0532|consensus 722 98.97
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 98.97
KOG0618|consensus 1081 98.9
KOG1259|consensus490 98.87
KOG0532|consensus 722 98.85
KOG1259|consensus490 98.84
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 98.79
PLN03210 1153 Resistant to P. syringae 6; Provisional 98.75
PLN03150 623 hypothetical protein; Provisional 98.71
PLN03210 1153 Resistant to P. syringae 6; Provisional 98.71
KOG4579|consensus177 98.71
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.66
KOG1644|consensus 233 98.65
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.64
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.57
KOG1644|consensus233 98.52
KOG4579|consensus177 98.51
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 98.44
KOG1859|consensus 1096 98.43
COG4886 394 Leucine-rich repeat (LRR) protein [Function unknow 98.38
KOG1859|consensus 1096 98.38
KOG0531|consensus 414 98.38
cd00116 319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 98.37
KOG4658|consensus 889 98.34
KOG0531|consensus 414 98.29
KOG4658|consensus 889 98.16
KOG3207|consensus 505 98.14
KOG1909|consensus 382 98.1
KOG3207|consensus 505 98.07
KOG1909|consensus382 97.89
KOG3665|consensus 699 97.66
KOG3665|consensus 699 97.6
PRK15386 426 type III secretion protein GogB; Provisional 97.33
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.11
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 97.08
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 97.02
KOG2982|consensus 418 96.98
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 96.93
smart0037026 LRR Leucine-rich repeats, outliers. 96.72
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 96.72
KOG2123|consensus 388 96.62
KOG2123|consensus 388 96.59
KOG2739|consensus 260 96.59
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 96.58
smart0037026 LRR Leucine-rich repeats, outliers. 96.58
KOG2982|consensus 418 96.55
KOG2739|consensus 260 96.25
PRK15386 426 type III secretion protein GogB; Provisional 96.13
KOG2120|consensus419 95.98
KOG2120|consensus 419 95.5
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 94.47
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 93.57
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 93.57
KOG0473|consensus 326 92.39
KOG0473|consensus 326 92.37
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 91.61
KOG3864|consensus221 90.5
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 87.69
>KOG4194|consensus Back     alignment and domain information
Probab=99.68  E-value=9.6e-18  Score=113.98  Aligned_cols=124  Identities=17%  Similarity=0.329  Sum_probs=86.0

Q ss_pred             CCchhhhcCCccceEEEecCCcCcccccCccccCCCCCCcEEEecCCcccccChhhhcCCCCCcEEEecCCCCCeeecch
Q psy8031           1 MFPKDLFAEMKYLQVIKISYHKDSLKELPSGLFANLPLLNTVILGESSIAELPSDLFWNSTNITNIVLTGHKKLTSLPST   80 (127)
Q Consensus         1 ~i~~~~~~~~~~l~~l~l~~~~~~~~~~~~~~~~~~~~l~~l~l~~n~~~~~~~~~~~~~~~l~~l~l~~~n~~~~~~~~   80 (127)
                      ++|..+|..+++|+.|++-.|.+.  .+.-..|.++++++.+.+..|.+..+.+++|.++..++.+++. .|+++.+..+
T Consensus       211 tLp~r~Fk~L~~L~~LdLnrN~ir--ive~ltFqgL~Sl~nlklqrN~I~kL~DG~Fy~l~kme~l~L~-~N~l~~vn~g  287 (873)
T KOG4194|consen  211 TLPQRSFKRLPKLESLDLNRNRIR--IVEGLTFQGLPSLQNLKLQRNDISKLDDGAFYGLEKMEHLNLE-TNRLQAVNEG  287 (873)
T ss_pred             ccCHHHhhhcchhhhhhcccccee--eehhhhhcCchhhhhhhhhhcCcccccCcceeeecccceeecc-cchhhhhhcc
Confidence            356666776777777777666654  4444456666666666667777777776677777777777777 7777777665


Q ss_pred             hhccCCCCcEEEecCccccccChhhhcCCccccEEeccCCcccccCC
Q psy8031          81 LFRDCKKLVKLELQRNKLKYLPENLFESLKELYTLNLKNNQLENITR  127 (127)
Q Consensus        81 ~~~~~~~l~~l~l~~n~~~~~~~~~~~~~~~l~~l~l~~n~i~~~~~  127 (127)
                      +..+++.|++++++.|.+..+..+.|.-+++|.+|+++.|.|+.+++
T Consensus       288 ~lfgLt~L~~L~lS~NaI~rih~d~WsftqkL~~LdLs~N~i~~l~~  334 (873)
T KOG4194|consen  288 WLFGLTSLEQLDLSYNAIQRIHIDSWSFTQKLKELDLSSNRITRLDE  334 (873)
T ss_pred             cccccchhhhhccchhhhheeecchhhhcccceeEeccccccccCCh
Confidence            55667777777777777776666656677788888888888777663



>KOG4194|consensus Back     alignment and domain information
>KOG4237|consensus Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG4237|consensus Back     alignment and domain information
>KOG0617|consensus Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0617|consensus Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0472|consensus Back     alignment and domain information
>KOG0472|consensus Back     alignment and domain information
>KOG0444|consensus Back     alignment and domain information
>KOG0444|consensus Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0618|consensus Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0532|consensus Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0618|consensus Back     alignment and domain information
>KOG1259|consensus Back     alignment and domain information
>KOG0532|consensus Back     alignment and domain information
>KOG1259|consensus Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG4579|consensus Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG1644|consensus Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1644|consensus Back     alignment and domain information
>KOG4579|consensus Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1859|consensus Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1859|consensus Back     alignment and domain information
>KOG0531|consensus Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG4658|consensus Back     alignment and domain information
>KOG0531|consensus Back     alignment and domain information
>KOG4658|consensus Back     alignment and domain information
>KOG3207|consensus Back     alignment and domain information
>KOG1909|consensus Back     alignment and domain information
>KOG3207|consensus Back     alignment and domain information
>KOG1909|consensus Back     alignment and domain information
>KOG3665|consensus Back     alignment and domain information
>KOG3665|consensus Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2982|consensus Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG2123|consensus Back     alignment and domain information
>KOG2123|consensus Back     alignment and domain information
>KOG2739|consensus Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>KOG2982|consensus Back     alignment and domain information
>KOG2739|consensus Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2120|consensus Back     alignment and domain information
>KOG2120|consensus Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG0473|consensus Back     alignment and domain information
>KOG0473|consensus Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG3864|consensus Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query127
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 7e-12
2o6q_A 270 Structural Diversity Of The Hagfish Variable Lympho 5e-04
3rfj_A279 Design Of A Binding Scaffold Based On Variable Lymp 1e-11
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 6e-11
3m19_A251 Crystal Structure Of Variable Lymphocyte Receptor V 2e-10
3m19_A 251 Crystal Structure Of Variable Lymphocyte Receptor V 6e-04
3m18_A251 Crystal Structure Of Variable Lymphocyte Receptor V 2e-10
3m18_A 251 Crystal Structure Of Variable Lymphocyte Receptor V 6e-04
2o6s_A208 Structural Diversity Of The Hagfish Variable Lympho 4e-10
1p8t_A285 Crystal Structure Of Nogo-66 Receptor Length = 285 1e-08
1ozn_A285 1.5a Crystal Structure Of The Nogo Receptor Ligand 1e-08
3kj4_A286 Structure Of Rat Nogo Receptor Bound To 1d9 Antagon 7e-07
2v9t_B220 Complex Between The Second Lrr Domain Of Slit2 And 1e-06
2v9s_A220 Second Lrr Domain Of Human Slit2 Length = 220 1e-06
2o6r_A177 Structural Diversity Of The Hagfish Variable Lympho 1e-06
3o6n_A 390 Crystal Structure Of Apl1 Leucine-Rich Repeat Domai 7e-06
3oja_B 597 Crystal Structure Of Lrim1APL1C COMPLEX Length = 59 1e-05
4arn_A279 Crystal Structure Of The N-terminal Domain Of Droso 1e-05
3g3b_A170 Structure Of A Lamprey Variable Lymphocyte Receptor 5e-05
3g39_A170 Structure Of A Lamprey Variable Lymphocyte Receptor 7e-05
3g3a_A178 Structure Of A Lamprey Variable Lymphocyte Receptor 8e-05
1m0z_A 290 Crystal Structure Of The Von Willebrand Factor Bind 1e-04
3p72_A 269 Structure Of Platelet Glycoprotein 1b Alpha With A 1e-04
1m10_B 290 Crystal Structure Of The Complex Of Glycoprotein Ib 1e-04
1u0n_D265 The Ternary Von Willebrand Factor A1-Glycoprotein I 2e-04
3e6j_A229 Crystal Structure Of Variable Lymphocyte Receptor ( 4e-04
3zyi_A 452 Netring2 In Complex With Ngl2 Length = 452 4e-04
3pmh_G 290 Mechanism Of Sulfotyrosine-Mediated Glycoprotein Ib 4e-04
1ook_G 290 Crystal Structure Of The Complex Of Platelet Recept 5e-04
3twi_D179 Variable Lymphocyte Receptor Recognition Of The Imm 5e-04
1p9a_G 290 Crystal Structure Of N-terminal Domain Of Human Pla 5e-04
1sq0_B 288 Crystal Structure Of The Complex Of The Wild-Type V 6e-04
1gwb_B 281 Structure Of Glycoprotein 1b Length = 281 6e-04
1w8a_A192 Third Lrr Domain Of Drosophila Slit Length = 192 7e-04
1p8v_A 279 Crystal Structure Of The Complex Of Platelet Recept 7e-04
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure

Iteration: 1

Score = 65.5 bits (158), Expect = 7e-12, Method: Compositional matrix adjust. Identities = 45/124 (36%), Positives = 70/124 (56%), Gaps = 3/124 (2%) Query: 2 FPKDLFAEMKYLQVIKISYHKDSLKELPSGLFANLPLLNTVILGESSIAELPSDLFWNST 61 P +F E+K L+ + ++ +K L+ LP G+F L L + L + + LP +F + T Sbjct: 76 LPAGIFKELKNLETLWVTDNK--LQALPIGVFDQLVNLAELRLDRNQLKSLPPRVFDSLT 133 Query: 62 NITNIVLTGHKKLTSLPSTLFRDCKKLVKLELQRNKLKYLPENLFESLKELYTLNLKNNQ 121 +T + L G+ +L SLP +F L +L L N+LK +PE F+ L EL TL L NNQ Sbjct: 134 KLTYLSL-GYNELQSLPKGVFDKLTSLKELRLYNNQLKRVPEGAFDKLTELKTLKLDNNQ 192 Query: 122 LENI 125 L+ + Sbjct: 193 LKRV 196
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|3RFJ|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 279 Back     alignment and structure
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure
>pdb|3M19|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R5.1 Length = 251 Back     alignment and structure
>pdb|3M19|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R5.1 Length = 251 Back     alignment and structure
>pdb|3M18|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R2.1 In Complex With Hen Egg Lysozyme Length = 251 Back     alignment and structure
>pdb|3M18|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R2.1 In Complex With Hen Egg Lysozyme Length = 251 Back     alignment and structure
>pdb|2O6S|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B59 Length = 208 Back     alignment and structure
>pdb|1P8T|A Chain A, Crystal Structure Of Nogo-66 Receptor Length = 285 Back     alignment and structure
>pdb|1OZN|A Chain A, 1.5a Crystal Structure Of The Nogo Receptor Ligand Binding Domain Reveals A Convergent Recognition Scaffold Mediating Inhibition Of Myelination Length = 285 Back     alignment and structure
>pdb|3KJ4|A Chain A, Structure Of Rat Nogo Receptor Bound To 1d9 Antagonist Antibody Length = 286 Back     alignment and structure
>pdb|2V9T|B Chain B, Complex Between The Second Lrr Domain Of Slit2 And The First Ig Domain From Robo1 Length = 220 Back     alignment and structure
>pdb|2V9S|A Chain A, Second Lrr Domain Of Human Slit2 Length = 220 Back     alignment and structure
>pdb|2O6R|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B61 Length = 177 Back     alignment and structure
>pdb|3O6N|A Chain A, Crystal Structure Of Apl1 Leucine-Rich Repeat Domain Length = 390 Back     alignment and structure
>pdb|3OJA|B Chain B, Crystal Structure Of Lrim1APL1C COMPLEX Length = 597 Back     alignment and structure
>pdb|4ARN|A Chain A, Crystal Structure Of The N-terminal Domain Of Drosophila Toll Receptor Length = 279 Back     alignment and structure
>pdb|3G3B|A Chain A, Structure Of A Lamprey Variable Lymphocyte Receptor Mutant In Complex With A Protein Antigen Length = 170 Back     alignment and structure
>pdb|3G39|A Chain A, Structure Of A Lamprey Variable Lymphocyte Receptor Length = 170 Back     alignment and structure
>pdb|3G3A|A Chain A, Structure Of A Lamprey Variable Lymphocyte Receptor In Complex With A Protein Antigen Length = 178 Back     alignment and structure
>pdb|1M0Z|A Chain A, Crystal Structure Of The Von Willebrand Factor Binding Domain Of Glycoprotein Ib Alpha Length = 290 Back     alignment and structure
>pdb|3P72|A Chain A, Structure Of Platelet Glycoprotein 1b Alpha With A Bound Peptide Inhibitor Length = 269 Back     alignment and structure
>pdb|1M10|B Chain B, Crystal Structure Of The Complex Of Glycoprotein Ib Alpha And The Von Willebrand Factor A1 Domain Length = 290 Back     alignment and structure
>pdb|1U0N|D Chain D, The Ternary Von Willebrand Factor A1-Glycoprotein Ibalpha- Botrocetin Complex Length = 265 Back     alignment and structure
>pdb|3E6J|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor (Vlr) Rbc36 In Complex With H-Trisaccharide Length = 229 Back     alignment and structure
>pdb|3ZYI|A Chain A, Netring2 In Complex With Ngl2 Length = 452 Back     alignment and structure
>pdb|3PMH|G Chain G, Mechanism Of Sulfotyrosine-Mediated Glycoprotein Ib Interaction With Two Distinct Alpha-Thrombin Sites Length = 290 Back     alignment and structure
>pdb|1OOK|G Chain G, Crystal Structure Of The Complex Of Platelet Receptor Gpib-alpha And Human Alpha-thrombin Length = 290 Back     alignment and structure
>pdb|3TWI|D Chain D, Variable Lymphocyte Receptor Recognition Of The Immunodominant Glycoprotein Of Bacillus Anthracis Spores Length = 179 Back     alignment and structure
>pdb|1P9A|G Chain G, Crystal Structure Of N-terminal Domain Of Human Platelet Receptor Glycoprotein Ib-alpha At 1.7 Angstrom Resolution Length = 290 Back     alignment and structure
>pdb|1SQ0|B Chain B, Crystal Structure Of The Complex Of The Wild-Type Von Willebrand Factor A1 Domain And Glycoprotein Ib Alpha At 2.6 Angstrom Resolution Length = 288 Back     alignment and structure
>pdb|1GWB|B Chain B, Structure Of Glycoprotein 1b Length = 281 Back     alignment and structure
>pdb|1W8A|A Chain A, Third Lrr Domain Of Drosophila Slit Length = 192 Back     alignment and structure
>pdb|1P8V|A Chain A, Crystal Structure Of The Complex Of Platelet Receptor Gpib-alpha And Alpha-thrombin At 2.6a Length = 279 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query127
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-20
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-19
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-18
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-17
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-13
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-19
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-15
2v9t_B 220 SLIT homolog 2 protein N-product; structural prote 5e-11
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-19
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-16
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 5e-11
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 1e-10
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 8e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-18
2o6q_A 270 Variable lymphocyte receptor A; leucine-rich repea 1e-17
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 8e-14
2o6q_A 270 Variable lymphocyte receptor A; leucine-rich repea 1e-06
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-18
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-16
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 6e-13
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-12
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-11
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 6e-07
3m19_A251 Variable lymphocyte receptor A diversity region; a 7e-18
3m19_A251 Variable lymphocyte receptor A diversity region; a 5e-12
3m19_A 251 Variable lymphocyte receptor A diversity region; a 1e-08
3m19_A 251 Variable lymphocyte receptor A diversity region; a 1e-05
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 8e-18
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 2e-15
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-12
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 7e-10
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 2e-17
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 1e-14
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 5e-10
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 2e-09
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 8e-09
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-08
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-17
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-16
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-16
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-16
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-16
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-15
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-15
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-14
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-07
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 3e-17
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 8e-17
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 2e-15
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 8e-14
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 1e-13
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 1e-10
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 3e-17
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 4e-17
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 1e-14
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 5e-14
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 8e-11
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-17
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 7e-16
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 6e-14
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-13
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-09
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-07
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-17
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 9e-17
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 8e-13
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-06
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 6e-17
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 5e-16
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 6e-15
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 3e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-16
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-16
2v70_A 220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 3e-09
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-16
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-13
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-09
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 5e-09
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 3e-08
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-07
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 3e-16
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 5e-11
3rfs_A 272 Internalin B, repeat modules, variable lymphocyte 2e-10
3rfs_A 272 Internalin B, repeat modules, variable lymphocyte 2e-07
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-15
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-14
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-12
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-11
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-11
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-11
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-10
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-15
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 4e-12
2o6s_A 208 Variable lymphocyte receptor B; leucine-rich repea 3e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-15
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-14
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-13
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-13
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 5e-12
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-09
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-09
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-14
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 6e-14
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-13
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-12
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-11
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 6e-11
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-10
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-10
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-10
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-09
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-08
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 6e-07
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-14
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-14
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-12
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-12
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-11
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-09
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-08
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-06
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-14
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-13
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-12
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-11
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-11
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-11
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-09
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-08
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 6e-05
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 8e-04
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-14
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 8e-10
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-09
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-09
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-08
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-08
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-07
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-07
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-07
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-06
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-06
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-04
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 8e-14
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 6e-12
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-13
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-13
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-13
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-11
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 3e-11
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-10
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-10
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-10
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-10
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-10
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-09
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-08
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-08
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-13
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-12
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-12
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-11
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-11
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-11
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-09
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-08
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-07
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-05
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-05
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-05
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-13
3e6j_A229 Variable lymphocyte receptor diversity region; var 4e-13
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-10
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-13
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 1e-12
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-12
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 6e-11
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 8e-11
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 2e-09
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-09
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-13
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-11
2xwt_C 239 Thyrotropin receptor; signaling protein-immune sys 4e-11
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-09
1w8a_A192 SLIT protein; signaling protein, secreted protein, 6e-13
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-12
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 6e-12
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 2e-09
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 5e-06
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-11
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-11
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-11
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-11
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 9e-11
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-10
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-10
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-08
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-06
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-06
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-06
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-11
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-10
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-09
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-08
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-07
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 5e-07
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 1e-10
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 4e-10
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 3e-07
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 2e-10
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 2e-10
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 5e-07
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-10
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-09
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-08
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-08
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-07
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-07
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-07
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-06
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 5e-09
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 3e-08
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-07
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-06
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-06
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-04
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 4e-04
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-09
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 9e-07
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-06
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-06
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-05
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-04
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 9e-09
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-07
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-07
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-06
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-06
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-06
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-06
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-08
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-08
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-08
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-07
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 4e-07
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-07
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-05
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-04
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-07
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-05
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-06
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 1e-05
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-04
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-04
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 4e-06
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 7e-06
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 6e-04
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 7e-04
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-04
4fmz_A 347 Internalin; leucine rich repeat, structural genomi 8e-04
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 1e-05
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 3e-05
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-04
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 6e-04
4fdw_A 401 Leucine rich hypothetical protein; putative cell s 9e-05
4fdw_A401 Leucine rich hypothetical protein; putative cell s 6e-04
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 9e-04
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 2e-04
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-04
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-04
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
 Score = 82.0 bits (203), Expect = 4e-20
 Identities = 34/123 (27%), Positives = 59/123 (47%), Gaps = 3/123 (2%)

Query: 3   PKDLFAEMKYLQVIKISYHKDSLKELPSGLFANLPLLNTVILGESSIAELPSDLFWNSTN 62
               F  +  L  + +      L+EL  GLF  L  L  + L ++++  LP D F +  N
Sbjct: 97  DPATFHGLGRLHTLHLDRCG--LQELGPGLFRGLAALQYLYLQDNALQALPDDTFRDLGN 154

Query: 63  ITNIVLTGHKKLTSLPSTLFRDCKKLVKLELQRNKLKYLPENLFESLKELYTLNLKNNQL 122
           +T++ L    +++S+P   FR    L +L L +N++ ++  + F  L  L TL L  N L
Sbjct: 155 LTHLFL-HGNRISSVPERAFRGLHSLDRLLLHQNRVAHVHPHAFRDLGRLMTLYLFANNL 213

Query: 123 ENI 125
             +
Sbjct: 214 SAL 216


>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Length = 130 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Length = 401 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Length = 401 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Length = 329 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query127
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.87
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.86
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.86
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.85
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.85
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.85
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.85
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.84
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.84
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.84
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.84
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.84
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.83
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.83
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.82
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.82
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.82
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.81
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.81
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.81
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.81
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.8
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 99.8
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 99.8
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.8
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 99.8
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.8
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.79
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.79
1p9a_G 290 Platelet glycoprotein IB alpha chain precursor; pl 99.79
2z62_A 276 TOLL-like receptor 4, variable lymphocyte recepto; 99.79
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.79
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.78
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.78
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 99.77
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.77
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 99.76
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.76
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.76
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.75
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 99.75
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 99.75
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.75
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.75
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.75
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.75
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 99.74
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.74
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.73
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 99.73
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.73
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.72
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.72
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.72
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 99.72
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 99.71
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.71
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.71
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 99.71
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.7
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 99.7
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.7
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 99.69
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.69
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.69
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.69
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.69
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.68
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.68
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.68
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.68
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.67
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 99.67
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.67
4fcg_A 328 Uncharacterized protein; structural genomics, PSI- 99.67
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.66
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 99.65
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.65
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 99.65
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.65
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.64
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.64
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.64
4ay9_X 350 Follicle-stimulating hormone receptor; hormone-rec 99.64
1h6u_A 308 Internalin H; cell adhesion, leucine rich repeat, 99.64
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.64
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.63
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.63
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.63
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.63
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.62
1h6t_A 291 Internalin B; cell adhesion, leucine rich repeat, 99.62
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.61
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.61
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.61
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.61
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.61
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.61
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.61
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 99.6
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.6
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.6
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.59
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.59
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.59
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.59
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.58
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.58
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.58
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.57
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.57
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.57
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.56
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 99.55
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.55
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 99.54
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.53
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.51
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.48
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.48
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.48
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.47
1o6v_A 466 Internalin A; bacterial infection, extracellular r 99.47
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.46
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.45
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.44
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.41
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 99.4
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.39
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.38
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.35
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.33
3goz_A 362 Leucine-rich repeat-containing protein; LEGL7, NES 99.32
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.29
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.27
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 99.26
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.24
2ast_B 336 S-phase kinase-associated protein 2; SCF-substrate 99.18
2ca6_A 386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.16
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.15
2ast_B 336 S-phase kinase-associated protein 2; SCF-substrate 99.14
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.14
1z7x_W 461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.12
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.11
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.1
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.09
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 99.03
3un9_A 372 NLR family member X1; leucine rich repeat (LRR), a 98.95
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.68
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 98.49
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 98.47
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 98.44
2p1m_B 594 Transport inhibitor response 1 protein; F-BOX, leu 98.37
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.36
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.35
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.2
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.19
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 98.17
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 98.03
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.03
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.98
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.95
2lz0_A100 Uncharacterized protein; hypothetical leucine rich 97.34
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.85
2lz0_A100 Uncharacterized protein; hypothetical leucine rich 96.73
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 95.61
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
Probab=99.87  E-value=3.7e-21  Score=120.53  Aligned_cols=122  Identities=31%  Similarity=0.527  Sum_probs=87.5

Q ss_pred             CchhhhcCCccceEEEecCCcCcccccCccccCCCCCCcEEEecCCcccccChhhhcCCCCCcEEEecCCCCCeeecchh
Q psy8031           2 FPKDLFAEMKYLQVIKISYHKDSLKELPSGLFANLPLLNTVILGESSIAELPSDLFWNSTNITNIVLTGHKKLTSLPSTL   81 (127)
Q Consensus         2 i~~~~~~~~~~l~~l~l~~~~~~~~~~~~~~~~~~~~l~~l~l~~n~~~~~~~~~~~~~~~l~~l~l~~~n~~~~~~~~~   81 (127)
                      +++..|..+++|+.|++++|.+.  .+++..|..++.|++|++++|+++.+++..|..+++|+.|+++ +|.+..+++..
T Consensus        50 ~~~~~~~~l~~L~~L~L~~n~l~--~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~-~N~l~~~~~~~  126 (251)
T 3m19_A           50 LSDATFRGLTKLTWLNLDYNQLQ--TLSAGVFDDLTELGTLGLANNQLASLPLGVFDHLTQLDKLYLG-GNQLKSLPSGV  126 (251)
T ss_dssp             CCTTTTTTCTTCCEEECTTSCCC--CCCTTTTTTCTTCCEEECTTSCCCCCCTTTTTTCTTCCEEECC-SSCCCCCCTTT
T ss_pred             cCHhHhcCcccCCEEECCCCcCC--ccCHhHhccCCcCCEEECCCCcccccChhHhcccCCCCEEEcC-CCcCCCcChhH
Confidence            44556677777777777777765  6666666777777777777777777776666777777777777 77777777666


Q ss_pred             hccCCCCcEEEecCccccccChhhhcCCccccEEeccCCcccccC
Q psy8031          82 FRDCKKLVKLELQRNKLKYLPENLFESLKELYTLNLKNNQLENIT  126 (127)
Q Consensus        82 ~~~~~~l~~l~l~~n~~~~~~~~~~~~~~~l~~l~l~~n~i~~~~  126 (127)
                      |..+++|+.+++++|.++.++...|+.+++|+.|++++|.++.++
T Consensus       127 ~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~N~l~~~~  171 (251)
T 3m19_A          127 FDRLTKLKELRLNTNQLQSIPAGAFDKLTNLQTLSLSTNQLQSVP  171 (251)
T ss_dssp             TTTCTTCCEEECCSSCCCCCCTTTTTTCTTCCEEECCSSCCSCCC
T ss_pred             hccCCcccEEECcCCcCCccCHHHcCcCcCCCEEECCCCcCCccC
Confidence            666777777777777777776655667777777777777776654



>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>2lz0_A Uncharacterized protein; hypothetical leucine rich repeat protein, structural genomic unknown function; NMR {Bacteroides capillosus} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>2lz0_A Uncharacterized protein; hypothetical leucine rich repeat protein, structural genomic unknown function; NMR {Bacteroides capillosus} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 127
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 6e-07
d1xwdc1 242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 3e-04
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-06
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 0.001
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 0.003
d1p9ag_ 266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-05
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 5e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 7e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.001
d1a9na_ 162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 0.002
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: Follicle-stimulating hormone receptor
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 44.5 bits (103), Expect = 6e-07
 Identities = 14/51 (27%), Positives = 25/51 (49%)

Query: 71  HKKLTSLPSTLFRDCKKLVKLELQRNKLKYLPENLFESLKELYTLNLKNNQ 121
           +  L  LP+ +F      V L++ R ++  LP    E+LK+L   +  N +
Sbjct: 186 NNNLEELPNDVFHGASGPVILDISRTRIHSLPSYGLENLKKLRARSTYNLK 236


>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query127
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.85
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.81
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.79
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.78
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.76
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.76
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.73
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.71
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.7
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.66
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.66
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.62
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.6
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.58
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.57
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.55
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.51
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.5
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.5
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.47
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.46
d1ogqa_ 313 Polygalacturonase inhibiting protein PGIP {Kidney 99.43
d1ogqa_ 313 Polygalacturonase inhibiting protein PGIP {Kidney 99.36
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.34
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.33
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.29
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.26
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.11
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 99.1
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.72
d1jl5a_ 353 Leucine rich effector protein YopM {Yersinia pesti 98.69
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.57
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.55
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.5
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 98.49
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 98.36
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 98.2
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 98.02
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.8
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.03
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.59
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 95.01
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: Slit
species: Fruit fly (Drosophila melanogaster) [TaxId: 7227]
Probab=99.85  E-value=3.6e-21  Score=114.94  Aligned_cols=119  Identities=22%  Similarity=0.367  Sum_probs=107.3

Q ss_pred             CCchhhhcCCccceEEEecCCcCcccccCccccCCCCCCcEEEecCCcccccChhhhcCCCCCcEEEecCCCCCeeecch
Q psy8031           1 MFPKDLFAEMKYLQVIKISYHKDSLKELPSGLFANLPLLNTVILGESSIAELPSDLFWNSTNITNIVLTGHKKLTSLPST   80 (127)
Q Consensus         1 ~i~~~~~~~~~~l~~l~l~~~~~~~~~~~~~~~~~~~~l~~l~l~~n~~~~~~~~~~~~~~~l~~l~l~~~n~~~~~~~~   80 (127)
                      +||++++   +.+++|++++|.+. ..++...|..+++|+.|++++|.+..++...|..++.|+.++++ +|.+..+++.
T Consensus        22 ~iP~~lp---~~l~~L~Ls~N~i~-~~~~~~~f~~l~~L~~L~L~~N~i~~~~~~~~~~~~~L~~L~Ls-~N~l~~l~~~   96 (192)
T d1w8aa_          22 EIPRDIP---LHTTELLLNDNELG-RISSDGLFGRLPHLVKLELKRNQLTGIEPNAFEGASHIQELQLG-ENKIKEISNK   96 (192)
T ss_dssp             SCCSCCC---TTCSEEECCSCCCC-SBCCSCSGGGCTTCCEEECCSSCCCCBCTTTTTTCTTCCEEECC-SCCCCEECSS
T ss_pred             ccCCCCC---CCCCEEEeCCCCCc-ccccccccCCCceEeeeeccccccccccccccccccccceeeec-cccccccCHH
Confidence            3676663   56899999999985 34778888999999999999999999998889999999999999 9999999999


Q ss_pred             hhccCCCCcEEEecCccccccChhhhcCCccccEEeccCCcccc
Q psy8031          81 LFRDCKKLVKLELQRNKLKYLPENLFESLKELYTLNLKNNQLEN  124 (127)
Q Consensus        81 ~~~~~~~l~~l~l~~n~~~~~~~~~~~~~~~l~~l~l~~n~i~~  124 (127)
                      +|.++++|+.+++++|.++.++...|..+++|+++++++|.+..
T Consensus        97 ~F~~l~~L~~L~L~~N~l~~i~~~~f~~l~~L~~l~L~~N~~~~  140 (192)
T d1w8aa_          97 MFLGLHQLKTLNLYDNQISCVMPGSFEHLNSLTSLNLASNPFNC  140 (192)
T ss_dssp             SSTTCTTCCEEECCSSCCCEECTTSSTTCTTCCEEECTTCCBCC
T ss_pred             HHhCCCcccccccCCccccccCHHHhcCCccccccccccccccc
Confidence            99999999999999999999999989999999999999998764



>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure