Psyllid ID: psy8149
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 182 | ||||||
| 350413203 | 187 | PREDICTED: chromatin complexes subunit B | 0.818 | 0.796 | 0.518 | 1e-37 | |
| 350413200 | 160 | PREDICTED: chromatin complexes subunit B | 0.818 | 0.931 | 0.518 | 1e-37 | |
| 345491284 | 160 | PREDICTED: probable methyltransferase BC | 0.802 | 0.912 | 0.516 | 2e-36 | |
| 380023396 | 158 | PREDICTED: chromatin complexes subunit B | 0.824 | 0.949 | 0.516 | 8e-36 | |
| 380023400 | 156 | PREDICTED: chromatin complexes subunit B | 0.824 | 0.961 | 0.516 | 8e-36 | |
| 328792610 | 217 | PREDICTED: chromatin complexes subunit B | 0.818 | 0.686 | 0.5 | 2e-34 | |
| 383856538 | 225 | PREDICTED: chromatin complexes subunit B | 0.851 | 0.688 | 0.521 | 8e-34 | |
| 340708646 | 160 | PREDICTED: chromatin complexes subunit B | 0.835 | 0.95 | 0.516 | 2e-33 | |
| 332373976 | 150 | unknown [Dendroctonus ponderosae] | 0.785 | 0.953 | 0.497 | 2e-33 | |
| 307186333 | 187 | Uncharacterized potential DNA-binding pr | 0.840 | 0.818 | 0.519 | 4e-33 |
| >gi|350413203|ref|XP_003489915.1| PREDICTED: chromatin complexes subunit BAP18-like isoform 2 [Bombus impatiens] | Back alignment and taxonomy information |
|---|
Score = 161 bits (408), Expect = 1e-37, Method: Compositional matrix adjust.
Identities = 97/187 (51%), Positives = 121/187 (64%), Gaps = 38/187 (20%)
Query: 1 VGDIFLAAGTAFNKLADLTLQLHSTPDSPSGNKWTAEDIEMLKETVRKFGDELVIISDRI 60
VG+IF AAG AFNKL +LT+QLH T DSP+G KWT E+IEML+ +V+ F ++L IS+ I
Sbjct: 34 VGEIFTAAGAAFNKLGELTMQLHPTTDSPAG-KWTDEEIEMLRHSVKTFSEDLNKISEHI 92
Query: 61 KDRTISQIKSNLKKKAFEDAGLPIQQQVAPPQQIVQQVVQQQHQQVVQAPQMVQTPTRVV 120
K RT+SQI++ LKKKAFE+AG+PI+QQ+ Q Q VQQ
Sbjct: 93 KGRTVSQIRTTLKKKAFEEAGVPIRQQMLSQQSTQQSAVQQ------------------- 133
Query: 121 QQTVATVPVPVSAQQ---QLLSGSHKSAEVTLNMLNAHPESEVDVEGLPEE--VKLQFDT 175
VS QQ Q L G KS+EVTLNMLNA PESEVDVEGLPEE VKL+F+
Sbjct: 134 ----------VSKQQTGNQGLMG--KSSEVTLNMLNA-PESEVDVEGLPEECQVKLEFEG 180
Query: 176 TAQQVAN 182
++VA+
Sbjct: 181 ATEEVAS 187
|
Source: Bombus impatiens Species: Bombus impatiens Genus: Bombus Family: Apidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|350413200|ref|XP_003489914.1| PREDICTED: chromatin complexes subunit BAP18-like isoform 1 [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|345491284|ref|XP_003426563.1| PREDICTED: probable methyltransferase BCDIN3D-like isoform 2 [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|380023396|ref|XP_003695509.1| PREDICTED: chromatin complexes subunit BAP18-like isoform 1 [Apis florea] gi|380023398|ref|XP_003695510.1| PREDICTED: chromatin complexes subunit BAP18-like isoform 2 [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|380023400|ref|XP_003695511.1| PREDICTED: chromatin complexes subunit BAP18-like isoform 3 [Apis florea] gi|380023402|ref|XP_003695512.1| PREDICTED: chromatin complexes subunit BAP18-like isoform 4 [Apis florea] | Back alignment and taxonomy information |
|---|
| >gi|328792610|ref|XP_392173.3| PREDICTED: chromatin complexes subunit BAP18-like isoform 1 [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|383856538|ref|XP_003703765.1| PREDICTED: chromatin complexes subunit BAP18-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|340708646|ref|XP_003392933.1| PREDICTED: chromatin complexes subunit BAP18-like isoform 1 [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|332373976|gb|AEE62129.1| unknown [Dendroctonus ponderosae] | Back alignment and taxonomy information |
|---|
| >gi|307186333|gb|EFN71983.1| Uncharacterized potential DNA-binding protein C17orf49-like protein [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 182 | ||||||
| FB|FBgn0052831 | 305 | CG33695 [Drosophila melanogast | 0.445 | 0.265 | 0.597 | 4e-26 | |
| MGI|MGI:1915609 | 171 | 0610010K14Rik "RIKEN cDNA 0610 | 0.450 | 0.479 | 0.554 | 1.5e-24 | |
| RGD|1308134 | 181 | RGD1308134 "similar to RIKEN c | 0.450 | 0.453 | 0.554 | 1.5e-24 | |
| UNIPROTKB|Q32LD1 | 172 | BAP18 "Chromatin complexes sub | 0.450 | 0.476 | 0.554 | 1.9e-24 | |
| UNIPROTKB|E2R6W3 | 192 | C17orf49 "Uncharacterized prot | 0.450 | 0.427 | 0.554 | 1.9e-24 | |
| UNIPROTKB|F6XZR8 | 191 | C5H17orf49 "Uncharacterized pr | 0.450 | 0.429 | 0.554 | 1.9e-24 | |
| UNIPROTKB|C9J4G0 | 192 | C17orf49 "Protein C17orf49" [H | 0.450 | 0.427 | 0.554 | 1.9e-24 | |
| UNIPROTKB|H0YIS7 | 233 | RNASEK-C17orf49 "Protein RNASE | 0.450 | 0.351 | 0.554 | 1.9e-24 | |
| UNIPROTKB|Q8IXM2 | 172 | BAP18 "Chromatin complexes sub | 0.450 | 0.476 | 0.554 | 1.9e-24 | |
| UNIPROTKB|F1RFR7 | 192 | LOC100518689 "Uncharacterized | 0.450 | 0.427 | 0.554 | 1.9e-24 |
| FB|FBgn0052831 CG33695 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 248 (92.4 bits), Expect = 4.0e-26, Sum P(2) = 4.0e-26
Identities = 49/82 (59%), Positives = 64/82 (78%)
Query: 1 VGDIFLAAGTAFNKLADLTLQLHSTPDSPSGNKWTAEDIEMLKETVRKFGDELVIISDRI 60
VG+IF AAG AF++L DLT+QLH +SPSG KWT E+I+ML ++ +F D+L IS I
Sbjct: 7 VGEIFTAAGQAFSRLGDLTMQLHPNAESPSG-KWTDEEIDMLHSSIMRFSDDLTKISLSI 65
Query: 61 KDRTISQIKSNLKKKAFEDAGL 82
K+RT+SQI+ LKKKAFEDAG+
Sbjct: 66 KNRTVSQIRQALKKKAFEDAGI 87
|
|
| MGI|MGI:1915609 0610010K14Rik "RIKEN cDNA 0610010K14 gene" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1308134 RGD1308134 "similar to RIKEN cDNA 1110020A23" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q32LD1 BAP18 "Chromatin complexes subunit BAP18" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2R6W3 C17orf49 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F6XZR8 C5H17orf49 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|C9J4G0 C17orf49 "Protein C17orf49" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|H0YIS7 RNASEK-C17orf49 "Protein RNASEK-C17orf49" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q8IXM2 BAP18 "Chromatin complexes subunit BAP18" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1RFR7 LOC100518689 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 182 | |||
| smart00717 | 49 | smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII | 2e-04 | |
| pfam00249 | 47 | pfam00249, Myb_DNA-binding, Myb-like DNA-binding d | 0.001 | |
| cd00167 | 45 | cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- | 0.002 | |
| PLN02187 | 462 | PLN02187, PLN02187, rooty/superroot1 | 0.003 |
| >gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains | Back alignment and domain information |
|---|
Score = 37.6 bits (88), Expect = 2e-04
Identities = 16/49 (32%), Positives = 25/49 (51%), Gaps = 4/49 (8%)
Query: 31 GNKWTAEDIEMLKETVRKFG-DELVIISDRIKDRTISQIKS---NLKKK 75
+WT E+ E+L E V+K+G + I+ + RT Q + NL K
Sbjct: 1 KGEWTEEEDELLIELVKKYGKNNWEKIAKELPGRTAEQCRERWRNLLKP 49
|
Length = 49 |
| >gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain | Back alignment and domain information |
|---|
| >gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains | Back alignment and domain information |
|---|
| >gnl|CDD|215119 PLN02187, PLN02187, rooty/superroot1 | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 182 | |||
| KOG4834|consensus | 280 | 99.96 | ||
| KOG4834|consensus | 280 | 99.45 | ||
| PF00249 | 48 | Myb_DNA-binding: Myb-like DNA-binding domain; Inte | 98.92 | |
| smart00717 | 49 | SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi | 98.64 | |
| TIGR01557 | 57 | myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c | 98.62 | |
| PF13921 | 60 | Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: | 98.6 | |
| cd00167 | 45 | SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do | 98.52 | |
| KOG1279|consensus | 506 | 97.56 | ||
| COG5259 | 531 | RSC8 RSC chromatin remodeling complex subunit RSC8 | 97.56 | |
| PLN03212 | 249 | Transcription repressor MYB5; Provisional | 97.53 | |
| PLN03091 | 459 | hypothetical protein; Provisional | 97.36 | |
| KOG0048|consensus | 238 | 97.03 | ||
| PLN03212 | 249 | Transcription repressor MYB5; Provisional | 96.62 | |
| PLN03091 | 459 | hypothetical protein; Provisional | 96.04 | |
| PF13837 | 90 | Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; | 95.49 | |
| KOG0049|consensus | 939 | 93.94 | ||
| COG5114 | 432 | Histone acetyltransferase complex SAGA/ADA, subuni | 92.24 | |
| KOG0457|consensus | 438 | 91.44 | ||
| KOG0048|consensus | 238 | 91.37 | ||
| COG5118 | 507 | BDP1 Transcription initiation factor TFIIIB, Bdp1 | 91.31 | |
| KOG4329|consensus | 445 | 88.41 | ||
| KOG0724|consensus | 335 | 87.72 | ||
| KOG4167|consensus | 907 | 86.78 | ||
| PF09420 | 164 | Nop16: Ribosome biogenesis protein Nop16; InterPro | 85.24 | |
| KOG4468|consensus | 782 | 84.94 | ||
| TIGR01765 | 73 | tspaseT_teng_N transposase, putative, N-terminal d | 82.85 | |
| PF07750 | 162 | GcrA: GcrA cell cycle regulator; InterPro: IPR0116 | 81.29 | |
| KOG2009|consensus | 584 | 81.24 |
| >KOG4834|consensus | Back alignment and domain information |
|---|
Probab=99.96 E-value=7.1e-31 Score=227.28 Aligned_cols=166 Identities=16% Similarity=0.054 Sum_probs=131.3
Q ss_pred ChhHhhHhhHHHHHhhhhhhccccCCC-CCCC-----CCCCHHHHHHHHHHHHHhhhhHHHHHHHhhhhhHHHHHHHHhh
Q psy8149 1 VGDIFLAAGTAFNKLADLTLQLHSTPD-SPSG-----NKWTAEDIEMLKETVRKFGDELVIISDRIKDRTISQIKSNLKK 74 (182)
Q Consensus 1 V~EIF~aAG~AF~kLgeLTmqLh~~~d-s~~~-----~KWTdeEiemLr~aV~rFg~dL~kIS~~Ik~RTv~QIKs~lKr 74 (182)
|+|||.++|++|.++++++|+|||+.| ++.| .+|++-+++||++|+++||+++|.|++++++||+.||+++.+|
T Consensus 95 V~~sf~~~q~~~~~~~~~~~~LHPv~nss~~G~~~~~~~~~q~~~~~l~AAv~~~~~taNh~~~~~~~~tiqQ~tsT~a~ 174 (280)
T KOG4834|consen 95 VSNSFQQYQRGGPGGSSAMSSLHPVMNSSNNGAANNMMAMDQPAPVNLAAAVAEVFLTANHAFQKLGDLTLQQHTTTDAD 174 (280)
T ss_pred hhhhhHHhhhccccccchheeccccccCCCccchhhhhhhccccHHHHHHHHHHHHhhcccchhhhhceeeeccccccch
Confidence 799999999999999999999999999 6666 6999999999999999999999999999999999999999999
Q ss_pred hhhhhcCCCCCCCCCCCchhHHHHHHhhhhhhhcCCccccCCc---------ccccccccccccccccchhhcccCCCcc
Q psy8149 75 KAFEDAGLPIQQQVAPPQQIVQQVVQQQHQQVVQAPQMVQTPT---------RVVQQTVATVPVPVSAQQQLLSGSHKSA 145 (182)
Q Consensus 75 K~~edag~p~~~~~~~p~~~~k~~~~~q~k~~~~~~~~~~~~~---------~~~~~~~~~~~~~~~~~~~l~~~k~k~a 145 (182)
++|++.++++.+.+ +...++ +..++....+-.|+ +..| .+++.++++.+.++++. +..
T Consensus 175 ~V~~~~~~~~~~~~--~~v~P~-------~sAs~~i~~VLSP~~~~~~~~~~~~nP-Passa~Vp~p~GpP~~~---~~~ 241 (280)
T KOG4834|consen 175 EVKWSEKEAVIPTR--YTVAPS-------SSASTVILNVLSPPGGGGMPHLQSQNP-PASSAPVPLPRGPPTTV---TRV 241 (280)
T ss_pred hhccccccccCCCC--ceeccc-------eeecccccccccCCCCCCCcccccCCC-CcccCCCCCCCCCCccc---eec
Confidence 99999999999988 444433 11111111111221 1111 13445677777777775 668
Q ss_pred chhhhcccCCCCC--cccccCCCcc---cccccccchhhhcC
Q psy8149 146 EVTLNMLNAHPES--EVDVEGLPEE---VKLQFDTTAQQVAN 182 (182)
Q Consensus 146 dVTLn~LN~s~~n--~vDvEGL~e~---~KL~Fd~~~eev~~ 182 (182)
++++..||++|.+ +||||||++. ||++|+ |+|+|
T Consensus 242 ~~~~~~LN~~~~~~d~VDvE~l~pt~~~Kk~~~~---e~v~~ 280 (280)
T KOG4834|consen 242 VAPHTLLNQGPPIKDLVDAESLIPTSWRKKSPET---EFVKN 280 (280)
T ss_pred cchhhhhccCCcccccccHhhcCCcchhhccchh---hhhcC
Confidence 9999999999875 8999999977 666665 56664
|
|
| >KOG4834|consensus | Back alignment and domain information |
|---|
| >PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins | Back alignment and domain information |
|---|
| >smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains | Back alignment and domain information |
|---|
| >TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class | Back alignment and domain information |
|---|
| >PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A | Back alignment and domain information |
|---|
| >cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains | Back alignment and domain information |
|---|
| >KOG1279|consensus | Back alignment and domain information |
|---|
| >COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] | Back alignment and domain information |
|---|
| >PLN03212 Transcription repressor MYB5; Provisional | Back alignment and domain information |
|---|
| >PLN03091 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0048|consensus | Back alignment and domain information |
|---|
| >PLN03212 Transcription repressor MYB5; Provisional | Back alignment and domain information |
|---|
| >PLN03091 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A | Back alignment and domain information |
|---|
| >KOG0049|consensus | Back alignment and domain information |
|---|
| >COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] | Back alignment and domain information |
|---|
| >KOG0457|consensus | Back alignment and domain information |
|---|
| >KOG0048|consensus | Back alignment and domain information |
|---|
| >COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] | Back alignment and domain information |
|---|
| >KOG4329|consensus | Back alignment and domain information |
|---|
| >KOG0724|consensus | Back alignment and domain information |
|---|
| >KOG4167|consensus | Back alignment and domain information |
|---|
| >PF09420 Nop16: Ribosome biogenesis protein Nop16; InterPro: IPR019002 Nucleolar protein 16 (Nop16) is a protein involved in the biogenesis of the 60S ribosomal subunit | Back alignment and domain information |
|---|
| >KOG4468|consensus | Back alignment and domain information |
|---|
| >TIGR01765 tspaseT_teng_N transposase, putative, N-terminal domain | Back alignment and domain information |
|---|
| >PF07750 GcrA: GcrA cell cycle regulator; InterPro: IPR011681 GcrA, together with CtrA (see IPR001789 from INTERPRO and IPR001867 from INTERPRO), form a master cell cycle regulator | Back alignment and domain information |
|---|
| >KOG2009|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
No homologous structure with e-value below 0.005
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 182 | |||
| 2ltp_A | 89 | Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s | 1e-05 | |
| 2yus_A | 79 | SWI/SNF-related matrix-associated actin- dependent | 2e-05 | |
| 2cu7_A | 72 | KIAA1915 protein; nuclear protein, SANT domain, DN | 5e-05 | |
| 1w0u_A | 55 | Telomeric repeat binding factor 2; telomere, DNA-b | 1e-04 | |
| 1w0t_A | 53 | Telomeric repeat binding factor 1; telomere, DNA-b | 2e-04 | |
| 1ity_A | 69 | TRF1; helix-turn-helix, telomeres, DNA binding, MY | 3e-04 | |
| 1vf9_A | 64 | Telomeric repeat binding factor 2; MYB, helix-turn | 3e-04 |
| >2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Length = 89 | Back alignment and structure |
|---|
Score = 41.1 bits (96), Expect = 1e-05
Identities = 14/55 (25%), Positives = 27/55 (49%), Gaps = 3/55 (5%)
Query: 24 STPDSPSGNKWTAEDIEMLKETVRKFGDELVIISDRIKDRTISQIKS---NLKKK 75
S ++ WT E++ K+ + + G I+ + +T+SQ K+ N KK+
Sbjct: 9 SGRENLYFQGWTEEEMGTAKKGLLEHGRNWSAIARMVGSKTVSQCKNFYFNYKKR 63
|
| >2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Length = 79 | Back alignment and structure |
|---|
| >2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 72 | Back alignment and structure |
|---|
| >1w0u_A Telomeric repeat binding factor 2; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle, nuclear protein; 1.8A {Homo sapiens} SCOP: a.4.1.4 Length = 55 | Back alignment and structure |
|---|
| >1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Length = 53 | Back alignment and structure |
|---|
| >1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Length = 69 | Back alignment and structure |
|---|
| >1vf9_A Telomeric repeat binding factor 2; MYB, helix-turn-helix, telomere, DNA binding protein; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1xg1_A 1vfc_A Length = 64 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 182 | |||
| 2cu7_A | 72 | KIAA1915 protein; nuclear protein, SANT domain, DN | 98.95 | |
| 2yus_A | 79 | SWI/SNF-related matrix-associated actin- dependent | 98.93 | |
| 2yum_A | 75 | ZZZ3 protein, zinc finger ZZ-type-containing prote | 98.91 | |
| 1x41_A | 60 | Transcriptional adaptor 2-like, isoform B; transcr | 98.74 | |
| 2elk_A | 58 | SPCC24B10.08C protein; hypothetical protein, struc | 98.74 | |
| 2iw5_B | 235 | Protein corest, REST corepressor 1; oxidoreductase | 98.73 | |
| 2eqr_A | 61 | N-COR1, N-COR, nuclear receptor corepressor 1; SAN | 98.64 | |
| 1guu_A | 52 | C-MYB, MYB proto-oncogene protein; transcription, | 98.61 | |
| 2xag_B | 482 | REST corepressor 1; amine oxidase, chromatin regul | 98.59 | |
| 2cqq_A | 72 | RSGI RUH-037, DNAJ homolog subfamily C member 1; m | 98.57 | |
| 1gvd_A | 52 | MYB proto-oncogene protein; transcription, transcr | 98.55 | |
| 2yqk_A | 63 | Arginine-glutamic acid dipeptide repeats protein; | 98.54 | |
| 2d9a_A | 60 | B-MYB, MYB-related protein B; DNA binding, structu | 98.51 | |
| 2ltp_A | 89 | Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s | 97.82 | |
| 1w0t_A | 53 | Telomeric repeat binding factor 1; telomere, DNA-b | 98.44 | |
| 2cqr_A | 73 | RSGI RUH-043, DNAJ homolog subfamily C member 1; m | 98.41 | |
| 3sjm_A | 64 | Telomeric repeat-binding factor 2; human telomeric | 98.39 | |
| 2cjj_A | 93 | Radialis; plant development, DNA-binding protein, | 98.39 | |
| 2llk_A | 73 | Cyclin-D-binding MYB-like transcription factor 1; | 98.38 | |
| 2din_A | 66 | Cell division cycle 5-like protein; MYB_DNA-bindin | 98.36 | |
| 2dim_A | 70 | Cell division cycle 5-like protein; MYB_DNA-bindin | 98.35 | |
| 2crg_A | 70 | Metastasis associated protein MTA3; transcription | 98.3 | |
| 3osg_A | 126 | MYB21; transcription-DNA complex, MYB2, R2R3 domai | 98.29 | |
| 2k9n_A | 107 | MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind | 98.29 | |
| 1ity_A | 69 | TRF1; helix-turn-helix, telomeres, DNA binding, MY | 98.27 | |
| 1wgx_A | 73 | KIAA1903 protein; MYB DNA-binding domain, human cD | 98.25 | |
| 1gv2_A | 105 | C-MYB, MYB proto-oncogene protein; transcription, | 98.24 | |
| 3osg_A | 126 | MYB21; transcription-DNA complex, MYB2, R2R3 domai | 98.21 | |
| 2k9n_A | 107 | MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind | 98.2 | |
| 1gv2_A | 105 | C-MYB, MYB proto-oncogene protein; transcription, | 98.19 | |
| 1h8a_C | 128 | AMV V-MYB, MYB transforming protein; transcription | 98.11 | |
| 1h8a_C | 128 | AMV V-MYB, MYB transforming protein; transcription | 98.06 | |
| 3zqc_A | 131 | MYB3; transcription-DNA complex, DNA-binding prote | 97.96 | |
| 3zqc_A | 131 | MYB3; transcription-DNA complex, DNA-binding prote | 97.93 | |
| 2ckx_A | 83 | NGTRF1, telomere binding protein TBP1; nuclear pro | 97.91 | |
| 1x58_A | 62 | Hypothetical protein 4930532D21RIK; MUS musculus a | 97.9 | |
| 4a69_C | 94 | Nuclear receptor corepressor 2; transcription, hyd | 97.86 | |
| 1h89_C | 159 | C-MYB, MYB proto-oncogene protein; transcription/D | 97.85 | |
| 1h89_C | 159 | C-MYB, MYB proto-oncogene protein; transcription/D | 97.74 | |
| 2aje_A | 105 | Telomere repeat-binding protein; DNA-binding, Trp, | 97.68 | |
| 1irz_A | 64 | ARR10-B; helix-turn-helix, DNA binding protein; NM | 97.66 | |
| 2juh_A | 121 | Telomere binding protein TBP1; helix, nucleus, nuc | 97.65 | |
| 2roh_A | 122 | RTBP1, telomere binding protein-1; plant, nucleus, | 97.64 | |
| 4eef_G | 74 | F-HB80.4, designed hemagglutinin binding protein; | 97.56 | |
| 1ign_A | 246 | Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, | 96.9 | |
| 3hm5_A | 93 | DNA methyltransferase 1-associated protein 1; DNA | 96.72 | |
| 2xag_B | 482 | REST corepressor 1; amine oxidase, chromatin regul | 95.91 | |
| 4b4c_A | 211 | Chromodomain-helicase-DNA-binding protein 1; chrom | 94.71 | |
| 2ebi_A | 86 | DNA binding protein GT-1; DNA-binding domain, phos | 93.78 | |
| 4iej_A | 93 | DNA methyltransferase 1-associated protein 1; DNA | 92.52 | |
| 1ofc_X | 304 | ISWI protein; nuclear protein, chromatin remodelin | 91.34 | |
| 2y9y_A | 374 | Imitation switch protein 1 (DEL_ATPase); transcrip | 82.82 |
| >2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
Probab=98.95 E-value=1.3e-09 Score=75.85 Aligned_cols=56 Identities=36% Similarity=0.497 Sum_probs=47.6
Q ss_pred CCCCCCHHHHHHHHHHHHHhhhhHHHHHHHhhhhhHHHHHHH----HhhhhhhhcCCCCCCC
Q psy8149 30 SGNKWTAEDIEMLKETVRKFGDELVIISDRIKDRTISQIKSN----LKKKAFEDAGLPIQQQ 87 (182)
Q Consensus 30 ~~~KWTdeEiemLr~aV~rFg~dL~kIS~~Ik~RTv~QIKs~----lKrK~~edag~p~~~~ 87 (182)
..+.||++|.+.|..+|..||.+|.+||.+|.+||..|||.+ ++++.-. |++....
T Consensus 8 ~~~~WT~eEd~~l~~~~~~~G~~W~~Ia~~~~~Rt~~q~k~r~~~~l~~~~~~--g~~~~~~ 67 (72)
T 2cu7_A 8 YSVKWTIEEKELFEQGLAKFGRRWTKISKLIGSRTVLQVKSYARQYFKNKVKC--GLDKETP 67 (72)
T ss_dssp CCCCCCHHHHHHHHHHHHHTCSCHHHHHHHHSSSCHHHHHHHHHHHHHHHSCS--CTTCCCS
T ss_pred CCCCCCHHHHHHHHHHHHHHCcCHHHHHHHcCCCCHHHHHHHHHHHHHHHHhc--CCCCCcc
Confidence 468999999999999999999999999999999999999997 4554433 7765543
|
| >2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* | Back alignment and structure |
|---|
| >2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A | Back alignment and structure |
|---|
| >2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* | Back alignment and structure |
|---|
| >2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A | Back alignment and structure |
|---|
| >2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} | Back alignment and structure |
|---|
| >2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A | Back alignment and structure |
|---|
| >2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A | Back alignment and structure |
|---|
| >2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A | Back alignment and structure |
|---|
| >2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A | Back alignment and structure |
|---|
| >1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A | Back alignment and structure |
|---|
| >1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A | Back alignment and structure |
|---|
| >3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A | Back alignment and structure |
|---|
| >2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A | Back alignment and structure |
|---|
| >1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A | Back alignment and structure |
|---|
| >1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 | Back alignment and structure |
|---|
| >1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 | Back alignment and structure |
|---|
| >3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} | Back alignment and structure |
|---|
| >3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} | Back alignment and structure |
|---|
| >2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A | Back alignment and structure |
|---|
| >1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 | Back alignment and structure |
|---|
| >4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A | Back alignment and structure |
|---|
| >1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C | Back alignment and structure |
|---|
| >1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C | Back alignment and structure |
|---|
| >2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 | Back alignment and structure |
|---|
| >1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 | Back alignment and structure |
|---|
| >2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} | Back alignment and structure |
|---|
| >2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} | Back alignment and structure |
|---|
| >4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} | Back alignment and structure |
|---|
| >1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A | Back alignment and structure |
|---|
| >3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* | Back alignment and structure |
|---|
| >4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} | Back alignment and structure |
|---|
| >2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* | Back alignment and structure |
|---|
| >4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* | Back alignment and structure |
|---|
| >1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A | Back alignment and structure |
|---|
| >2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 182 | ||||
| d2iw5b1 | 65 | a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu | 8e-07 | |
| d1xc5a1 | 68 | a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 | 3e-06 | |
| d2cu7a1 | 65 | a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap | 1e-04 | |
| d2crga1 | 57 | a.4.1.3 (A:8-64) Metastasis associated protein MTA | 2e-04 | |
| d1guua_ | 50 | a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus | 8e-04 | |
| d1gv2a2 | 47 | a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mou | 0.001 | |
| d1w0ta_ | 52 | a.4.1.4 (A:) DNA-binding domain of human telomeric | 0.002 | |
| d1gvda_ | 52 | a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus | 0.004 |
| >d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: DNA/RNA-binding 3-helical bundle superfamily: Homeodomain-like family: Myb/SANT domain domain: REST corepressor 1, CoREST species: Human (Homo sapiens) [TaxId: 9606]
Score = 42.5 bits (100), Expect = 8e-07
Identities = 13/46 (28%), Positives = 29/46 (63%), Gaps = 3/46 (6%)
Query: 33 KWTAEDIEMLKETVRKFGDELVIISDRIKDRTISQIKS---NLKKK 75
+WT E+ + + +RK+G + ISD I ++++ Q+K+ N +++
Sbjct: 7 RWTTEEQLLAVQAIRKYGRDFQAISDVIGNKSVVQVKNFFVNYRRR 52
|
| >d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 | Back information, alignment and structure |
|---|
| >d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 | Back information, alignment and structure |
|---|
| >d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 | Back information, alignment and structure |
|---|
| >d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 | Back information, alignment and structure |
|---|
| >d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 47 | Back information, alignment and structure |
|---|
| >d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Length = 52 | Back information, alignment and structure |
|---|
| >d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 182 | |||
| d2cu7a1 | 65 | MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 | 99.08 | |
| d2iw5b1 | 65 | REST corepressor 1, CoREST {Human (Homo sapiens) [ | 98.97 | |
| d2cjja1 | 63 | Radialis {Garden snapdragon (Antirrhinum majus) [T | 98.84 | |
| d1x41a1 | 47 | Transcriptional adaptor 2-like, TADA2L, isoform b | 98.83 | |
| d1xc5a1 | 68 | Nuclear receptor corepressor 2 {Human (Homo sapien | 98.64 | |
| d1guua_ | 50 | c-Myb, DNA-binding domain {Mouse (Mus musculus) [T | 98.57 | |
| d2crga1 | 57 | Metastasis associated protein MTA3 {Mouse (Mus mus | 98.52 | |
| d2cqra1 | 60 | DnaJ homolog subfamily C member 1 {Human (Homo sap | 98.5 | |
| d1gv2a2 | 47 | c-Myb, DNA-binding domain {Mouse (Mus musculus) [T | 98.44 | |
| d1gvda_ | 52 | c-Myb, DNA-binding domain {Mouse (Mus musculus) [T | 98.44 | |
| d1irza_ | 64 | Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId | 98.35 | |
| d2cqqa1 | 59 | DnaJ homolog subfamily C member 1 {Human (Homo sap | 98.23 | |
| d1w0ta_ | 52 | DNA-binding domain of human telomeric protein, hTR | 98.12 | |
| d1w0ua_ | 55 | Telomeric repeat binding factor 2, TRF2 {Human (Ho | 98.1 | |
| d1igna1 | 86 | DNA-binding domain of rap1 {Baker's yeast (Sacchar | 97.6 | |
| d2ckxa1 | 83 | Telomere binding protein TBP1 {Tobacco (Nicotiana | 97.45 | |
| d1ug2a_ | 95 | 2610100b20rik gene product {Mouse (Mus musculus) [ | 96.79 | |
| d1ofcx1 | 52 | SANT domain of the nucleosome remodeling ATPase IS | 96.47 | |
| d1x58a1 | 49 | Hypothetical protein 4930532d21rik {Mouse (Mus mus | 95.76 | |
| d1wgxa_ | 73 | Hypothetical protein C14orf106 (KIAA1903) {Human ( | 89.3 |
| >d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: DNA/RNA-binding 3-helical bundle superfamily: Homeodomain-like family: Myb/SANT domain domain: MYSM1 (KIAA1915) species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.08 E-value=1e-10 Score=78.08 Aligned_cols=49 Identities=33% Similarity=0.474 Sum_probs=43.8
Q ss_pred CCCCCHHHHHHHHHHHHHhhhhHHHHHHHhhhhhHHHHHHHHhhhhhhh
Q psy8149 31 GNKWTAEDIEMLKETVRKFGDELVIISDRIKDRTISQIKSNLKKKAFED 79 (182)
Q Consensus 31 ~~KWTdeEiemLr~aV~rFg~dL~kIS~~Ik~RTv~QIKs~lKrK~~ed 79 (182)
..|||++|.++|.++|..||.+|.+||.++.+||..|||++..+..-..
T Consensus 2 ~~~WT~eEd~~l~~~~~~~G~~W~~Ia~~~~~Rt~~q~k~ry~~~~~~~ 50 (65)
T d2cu7a1 2 SVKWTIEEKELFEQGLAKFGRRWTKISKLIGSRTVLQVKSYARQYFKNK 50 (65)
T ss_dssp CCCCCHHHHHHHHHHHHHTCSCHHHHHHHHSSSCHHHHHHHHHHHHHHH
T ss_pred CCCCCHHHHHHHHHHHHHhcchHHHHHHHcCCCCHHHHHHHHHHHHHHH
Confidence 3699999999999999999999999999999999999999876554333
|
| >d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} | Back information, alignment and structure |
|---|
| >d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} | Back information, alignment and structure |
|---|
| >d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|