Psyllid ID: psy8149


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180--
VGDIFLAAGTAFNKLADLTLQLHSTPDSPSGNKWTAEDIEMLKETVRKFGDELVIISDRIKDRTISQIKSNLKKKAFEDAGLPIQQQVAPPQQIVQQVVQQQHQQVVQAPQMVQTPTRVVQQTVATVPVPVSAQQQLLSGSHKSAEVTLNMLNAHPESEVDVEGLPEEVKLQFDTTAQQVAN
cHHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHccccccccccccccccccEEccccccccccccccccccccccccccHHHHHcccccccccccccccccccccccccccccccc
ccHHHHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccccccccEEHHHccccccccEEEcccccccEEccccccHHHcc
VGDIFLAAGTAFNKLADLTLqlhstpdspsgnkwtAEDIEMLKETVRKFGDELVIISDRIKDRTISQIKSNLKkkafedaglpiqqqvappqQIVQQVVQQQHQQVvqapqmvqtptRVVQQTvatvpvpvsaqqqllsgshKSAEVTLNMLnahpesevdveglpeevkLQFDTTAQQVAN
VGDIFLAAGTAFNKLADLTLQLhstpdspsgnkwTAEDIEMLKETVRKfgdelviisdrikdrtisQIKSNLKKKAFEDAGLPIQQQVAPPQQIVQQVVQQQHQQVVQAPQMVQTPTRVVQQTVATVPVPVSAQQQLLSGSHKSAEVTLNMLNAHPESEVDVEGLPEEVKLQFDTTAQQVAN
VGDIFLAAGTAFNKLADLTLQLHSTPDSPSGNKWTAEDIEMLKETVRKFGDELVIISDRIKDRTISQIKSNLKKKAFEDAGLpiqqqvappqqivqqvvqqqhqqvvqapqmvqtptrvvqqtvatvpvpvsaqqqLLSGSHKSAEVTLNMLNAHPESEVDVEGLPEEVKLQFDTTAQQVAN
***IFLAAGTAFNKLADLTLQL***********WTAEDIEMLKETVRKFGDELVIISDRIKDRTISQI**************************************************VVQQTVATV*******************************************************
VGDIFLAAGTAFNKLADLTLQL****************IEMLKETVRKFGDELVIISDRIK****************************************************************************************NMLNAHPESEVDVEGLPEEVK************
VGDIFLAAGTAFNKLADLTLQLHS********KWTAEDIEMLKETVRKFGDELVIISDRIKDRTISQIKSNLKKKAFEDAGLPIQQQVAP******************APQMVQTPTRVVQQTVATVPVPVSAQQQLLSGSHKSAEVTLNMLNAHPESEVDVEGLPEEVKLQFDTTAQQVAN
VGDIFLAAGTAFNKLADLTLQLHSTP***SGNKWTAEDIEMLKETVRKFGDELVIISDRIKDRTISQIKSNLKKKAFEDAGLPIQ************************************************************EVTL*MLNAHPESEVDVEGLPEEVKLQFDT*******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VGDIFLAAGTAFNKLADLTLQLHSTPDSPSGNKWTAEDIEMLKETVRKFGDELVIISDRIKDRTISQIKSNLKKKAFEDAGLPIQQQVAPPQQIVQQVVQQQHQQVVQAPQMVQTPTRVVQQTVATVPVPVSAQQQLLSGSHKSAEVTLNMLNAHPESEVDVEGLPEEVKLQFDTTAQQVAN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query182 2.2.26 [Sep-21-2011]
Q9DCT6171 Chromatin complexes subun no N/A 0.840 0.894 0.393 2e-23
Q8IXM2172 Chromatin complexes subun yes N/A 0.846 0.895 0.387 7e-23
Q32LD1172 Chromatin complexes subun yes N/A 0.846 0.895 0.387 4e-22
>sp|Q9DCT6|BAP18_MOUSE Chromatin complexes subunit BAP18 OS=Mus musculus GN=Bap18 PE=1 SV=1 Back     alignment and function desciption
 Score =  108 bits (271), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 72/183 (39%), Positives = 106/183 (57%), Gaps = 30/183 (16%)

Query: 1   VGDIFLAAGTAFNKLADLTLQLHSTPDS-PSGNKWTAEDIEMLKETVRKFGDELVIISDR 59
           VG+IF AAG AF KL +LT+QLH   DS P+G KWT  +IEML+  V++FGD+L  IS  
Sbjct: 8   VGEIFSAAGAAFTKLGELTMQLHPVSDSSPAGAKWTETEIEMLRAAVKRFGDDLNHISCV 67

Query: 60  IKDRTISQIKSNLKKKAFEDAGLPIQQQVAP---PQQIVQQVVQQQHQQVVQAPQMVQTP 116
           IK+RT++QIK+ +K+K +ED+G+P+  + +P   P+++   V+   +     +  + +  
Sbjct: 68  IKERTVAQIKTTVKRKVYEDSGIPLPAE-SPKKGPKKMTSGVLSPPNAPPPSSSSVPE-- 124

Query: 117 TRVVQQTVATVPVPVSAQQQLLSGSHKSAEVTLNMLNAHPESE--VDVEGL---PEEVKL 171
                   A VP P+  Q+         A+VTL+ LN    +   VDVEGL   P   KL
Sbjct: 125 --------AGVP-PIKKQK---------ADVTLSALNDSDANSDLVDVEGLGETPPAKKL 166

Query: 172 QFD 174
            FD
Sbjct: 167 NFD 169




Component of chromatin complexes such as the MLL1/MLL and NURF complexes.
Mus musculus (taxid: 10090)
>sp|Q8IXM2|BAP18_HUMAN Chromatin complexes subunit BAP18 OS=Homo sapiens GN=BAP18 PE=1 SV=1 Back     alignment and function description
>sp|Q32LD1|BAP18_BOVIN Chromatin complexes subunit BAP18 OS=Bos taurus GN=BAP18 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query182
350413203187 PREDICTED: chromatin complexes subunit B 0.818 0.796 0.518 1e-37
350413200160 PREDICTED: chromatin complexes subunit B 0.818 0.931 0.518 1e-37
345491284160 PREDICTED: probable methyltransferase BC 0.802 0.912 0.516 2e-36
380023396158 PREDICTED: chromatin complexes subunit B 0.824 0.949 0.516 8e-36
380023400156 PREDICTED: chromatin complexes subunit B 0.824 0.961 0.516 8e-36
328792610217 PREDICTED: chromatin complexes subunit B 0.818 0.686 0.5 2e-34
383856538225 PREDICTED: chromatin complexes subunit B 0.851 0.688 0.521 8e-34
340708646160 PREDICTED: chromatin complexes subunit B 0.835 0.95 0.516 2e-33
332373976150 unknown [Dendroctonus ponderosae] 0.785 0.953 0.497 2e-33
307186333187 Uncharacterized potential DNA-binding pr 0.840 0.818 0.519 4e-33
>gi|350413203|ref|XP_003489915.1| PREDICTED: chromatin complexes subunit BAP18-like isoform 2 [Bombus impatiens] Back     alignment and taxonomy information
 Score =  161 bits (408), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 97/187 (51%), Positives = 121/187 (64%), Gaps = 38/187 (20%)

Query: 1   VGDIFLAAGTAFNKLADLTLQLHSTPDSPSGNKWTAEDIEMLKETVRKFGDELVIISDRI 60
           VG+IF AAG AFNKL +LT+QLH T DSP+G KWT E+IEML+ +V+ F ++L  IS+ I
Sbjct: 34  VGEIFTAAGAAFNKLGELTMQLHPTTDSPAG-KWTDEEIEMLRHSVKTFSEDLNKISEHI 92

Query: 61  KDRTISQIKSNLKKKAFEDAGLPIQQQVAPPQQIVQQVVQQQHQQVVQAPQMVQTPTRVV 120
           K RT+SQI++ LKKKAFE+AG+PI+QQ+   Q   Q  VQQ                   
Sbjct: 93  KGRTVSQIRTTLKKKAFEEAGVPIRQQMLSQQSTQQSAVQQ------------------- 133

Query: 121 QQTVATVPVPVSAQQ---QLLSGSHKSAEVTLNMLNAHPESEVDVEGLPEE--VKLQFDT 175
                     VS QQ   Q L G  KS+EVTLNMLNA PESEVDVEGLPEE  VKL+F+ 
Sbjct: 134 ----------VSKQQTGNQGLMG--KSSEVTLNMLNA-PESEVDVEGLPEECQVKLEFEG 180

Query: 176 TAQQVAN 182
             ++VA+
Sbjct: 181 ATEEVAS 187




Source: Bombus impatiens

Species: Bombus impatiens

Genus: Bombus

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|350413200|ref|XP_003489914.1| PREDICTED: chromatin complexes subunit BAP18-like isoform 1 [Bombus impatiens] Back     alignment and taxonomy information
>gi|345491284|ref|XP_003426563.1| PREDICTED: probable methyltransferase BCDIN3D-like isoform 2 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|380023396|ref|XP_003695509.1| PREDICTED: chromatin complexes subunit BAP18-like isoform 1 [Apis florea] gi|380023398|ref|XP_003695510.1| PREDICTED: chromatin complexes subunit BAP18-like isoform 2 [Apis florea] Back     alignment and taxonomy information
>gi|380023400|ref|XP_003695511.1| PREDICTED: chromatin complexes subunit BAP18-like isoform 3 [Apis florea] gi|380023402|ref|XP_003695512.1| PREDICTED: chromatin complexes subunit BAP18-like isoform 4 [Apis florea] Back     alignment and taxonomy information
>gi|328792610|ref|XP_392173.3| PREDICTED: chromatin complexes subunit BAP18-like isoform 1 [Apis mellifera] Back     alignment and taxonomy information
>gi|383856538|ref|XP_003703765.1| PREDICTED: chromatin complexes subunit BAP18-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|340708646|ref|XP_003392933.1| PREDICTED: chromatin complexes subunit BAP18-like isoform 1 [Bombus terrestris] Back     alignment and taxonomy information
>gi|332373976|gb|AEE62129.1| unknown [Dendroctonus ponderosae] Back     alignment and taxonomy information
>gi|307186333|gb|EFN71983.1| Uncharacterized potential DNA-binding protein C17orf49-like protein [Camponotus floridanus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query182
FB|FBgn0052831 305 CG33695 [Drosophila melanogast 0.445 0.265 0.597 4e-26
MGI|MGI:1915609171 0610010K14Rik "RIKEN cDNA 0610 0.450 0.479 0.554 1.5e-24
RGD|1308134181 RGD1308134 "similar to RIKEN c 0.450 0.453 0.554 1.5e-24
UNIPROTKB|Q32LD1172 BAP18 "Chromatin complexes sub 0.450 0.476 0.554 1.9e-24
UNIPROTKB|E2R6W3192 C17orf49 "Uncharacterized prot 0.450 0.427 0.554 1.9e-24
UNIPROTKB|F6XZR8191 C5H17orf49 "Uncharacterized pr 0.450 0.429 0.554 1.9e-24
UNIPROTKB|C9J4G0192 C17orf49 "Protein C17orf49" [H 0.450 0.427 0.554 1.9e-24
UNIPROTKB|H0YIS7233 RNASEK-C17orf49 "Protein RNASE 0.450 0.351 0.554 1.9e-24
UNIPROTKB|Q8IXM2172 BAP18 "Chromatin complexes sub 0.450 0.476 0.554 1.9e-24
UNIPROTKB|F1RFR7192 LOC100518689 "Uncharacterized 0.450 0.427 0.554 1.9e-24
FB|FBgn0052831 CG33695 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 248 (92.4 bits), Expect = 4.0e-26, Sum P(2) = 4.0e-26
 Identities = 49/82 (59%), Positives = 64/82 (78%)

Query:     1 VGDIFLAAGTAFNKLADLTLQLHSTPDSPSGNKWTAEDIEMLKETVRKFGDELVIISDRI 60
             VG+IF AAG AF++L DLT+QLH   +SPSG KWT E+I+ML  ++ +F D+L  IS  I
Sbjct:     7 VGEIFTAAGQAFSRLGDLTMQLHPNAESPSG-KWTDEEIDMLHSSIMRFSDDLTKISLSI 65

Query:    61 KDRTISQIKSNLKKKAFEDAGL 82
             K+RT+SQI+  LKKKAFEDAG+
Sbjct:    66 KNRTVSQIRQALKKKAFEDAGI 87


GO:0003682 "chromatin binding" evidence=IEA
MGI|MGI:1915609 0610010K14Rik "RIKEN cDNA 0610010K14 gene" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1308134 RGD1308134 "similar to RIKEN cDNA 1110020A23" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q32LD1 BAP18 "Chromatin complexes subunit BAP18" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2R6W3 C17orf49 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F6XZR8 C5H17orf49 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|C9J4G0 C17orf49 "Protein C17orf49" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|H0YIS7 RNASEK-C17orf49 "Protein RNASEK-C17orf49" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q8IXM2 BAP18 "Chromatin complexes subunit BAP18" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1RFR7 LOC100518689 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8IXM2BAP18_HUMANNo assigned EC number0.38790.84610.8953yesN/A
Q32LD1BAP18_BOVINNo assigned EC number0.38790.84610.8953yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query182
smart0071749 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII 2e-04
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 0.001
cd0016745 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- 0.002
PLN02187462 PLN02187, PLN02187, rooty/superroot1 0.003
>gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
 Score = 37.6 bits (88), Expect = 2e-04
 Identities = 16/49 (32%), Positives = 25/49 (51%), Gaps = 4/49 (8%)

Query: 31 GNKWTAEDIEMLKETVRKFG-DELVIISDRIKDRTISQIKS---NLKKK 75
            +WT E+ E+L E V+K+G +    I+  +  RT  Q +    NL K 
Sbjct: 1  KGEWTEEEDELLIELVKKYGKNNWEKIAKELPGRTAEQCRERWRNLLKP 49


Length = 49

>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information
>gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>gnl|CDD|215119 PLN02187, PLN02187, rooty/superroot1 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 182
KOG4834|consensus280 99.96
KOG4834|consensus 280 99.45
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 98.92
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 98.64
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 98.62
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 98.6
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 98.52
KOG1279|consensus 506 97.56
COG5259 531 RSC8 RSC chromatin remodeling complex subunit RSC8 97.56
PLN03212249 Transcription repressor MYB5; Provisional 97.53
PLN03091 459 hypothetical protein; Provisional 97.36
KOG0048|consensus238 97.03
PLN03212249 Transcription repressor MYB5; Provisional 96.62
PLN03091 459 hypothetical protein; Provisional 96.04
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 95.49
KOG0049|consensus 939 93.94
COG5114 432 Histone acetyltransferase complex SAGA/ADA, subuni 92.24
KOG0457|consensus 438 91.44
KOG0048|consensus238 91.37
COG5118507 BDP1 Transcription initiation factor TFIIIB, Bdp1 91.31
KOG4329|consensus445 88.41
KOG0724|consensus 335 87.72
KOG4167|consensus 907 86.78
PF09420164 Nop16: Ribosome biogenesis protein Nop16; InterPro 85.24
KOG4468|consensus 782 84.94
TIGR0176573 tspaseT_teng_N transposase, putative, N-terminal d 82.85
PF07750162 GcrA: GcrA cell cycle regulator; InterPro: IPR0116 81.29
KOG2009|consensus584 81.24
>KOG4834|consensus Back     alignment and domain information
Probab=99.96  E-value=7.1e-31  Score=227.28  Aligned_cols=166  Identities=16%  Similarity=0.054  Sum_probs=131.3

Q ss_pred             ChhHhhHhhHHHHHhhhhhhccccCCC-CCCC-----CCCCHHHHHHHHHHHHHhhhhHHHHHHHhhhhhHHHHHHHHhh
Q psy8149           1 VGDIFLAAGTAFNKLADLTLQLHSTPD-SPSG-----NKWTAEDIEMLKETVRKFGDELVIISDRIKDRTISQIKSNLKK   74 (182)
Q Consensus         1 V~EIF~aAG~AF~kLgeLTmqLh~~~d-s~~~-----~KWTdeEiemLr~aV~rFg~dL~kIS~~Ik~RTv~QIKs~lKr   74 (182)
                      |+|||.++|++|.++++++|+|||+.| ++.|     .+|++-+++||++|+++||+++|.|++++++||+.||+++.+|
T Consensus        95 V~~sf~~~q~~~~~~~~~~~~LHPv~nss~~G~~~~~~~~~q~~~~~l~AAv~~~~~taNh~~~~~~~~tiqQ~tsT~a~  174 (280)
T KOG4834|consen   95 VSNSFQQYQRGGPGGSSAMSSLHPVMNSSNNGAANNMMAMDQPAPVNLAAAVAEVFLTANHAFQKLGDLTLQQHTTTDAD  174 (280)
T ss_pred             hhhhhHHhhhccccccchheeccccccCCCccchhhhhhhccccHHHHHHHHHHHHhhcccchhhhhceeeeccccccch
Confidence            799999999999999999999999999 6666     6999999999999999999999999999999999999999999


Q ss_pred             hhhhhcCCCCCCCCCCCchhHHHHHHhhhhhhhcCCccccCCc---------ccccccccccccccccchhhcccCCCcc
Q psy8149          75 KAFEDAGLPIQQQVAPPQQIVQQVVQQQHQQVVQAPQMVQTPT---------RVVQQTVATVPVPVSAQQQLLSGSHKSA  145 (182)
Q Consensus        75 K~~edag~p~~~~~~~p~~~~k~~~~~q~k~~~~~~~~~~~~~---------~~~~~~~~~~~~~~~~~~~l~~~k~k~a  145 (182)
                      ++|++.++++.+.+  +...++       +..++....+-.|+         +..| .+++.++++.+.++++.   +..
T Consensus       175 ~V~~~~~~~~~~~~--~~v~P~-------~sAs~~i~~VLSP~~~~~~~~~~~~nP-Passa~Vp~p~GpP~~~---~~~  241 (280)
T KOG4834|consen  175 EVKWSEKEAVIPTR--YTVAPS-------SSASTVILNVLSPPGGGGMPHLQSQNP-PASSAPVPLPRGPPTTV---TRV  241 (280)
T ss_pred             hhccccccccCCCC--ceeccc-------eeecccccccccCCCCCCCcccccCCC-CcccCCCCCCCCCCccc---eec
Confidence            99999999999988  444433       11111111111221         1111 13445677777777775   668


Q ss_pred             chhhhcccCCCCC--cccccCCCcc---cccccccchhhhcC
Q psy8149         146 EVTLNMLNAHPES--EVDVEGLPEE---VKLQFDTTAQQVAN  182 (182)
Q Consensus       146 dVTLn~LN~s~~n--~vDvEGL~e~---~KL~Fd~~~eev~~  182 (182)
                      ++++..||++|.+  +||||||++.   ||++|+   |+|+|
T Consensus       242 ~~~~~~LN~~~~~~d~VDvE~l~pt~~~Kk~~~~---e~v~~  280 (280)
T KOG4834|consen  242 VAPHTLLNQGPPIKDLVDAESLIPTSWRKKSPET---EFVKN  280 (280)
T ss_pred             cchhhhhccCCcccccccHhhcCCcchhhccchh---hhhcC
Confidence            9999999999875  8999999977   666665   56664



>KOG4834|consensus Back     alignment and domain information
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>KOG1279|consensus Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>KOG0048|consensus Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>KOG0049|consensus Back     alignment and domain information
>COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0457|consensus Back     alignment and domain information
>KOG0048|consensus Back     alignment and domain information
>COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] Back     alignment and domain information
>KOG4329|consensus Back     alignment and domain information
>KOG0724|consensus Back     alignment and domain information
>KOG4167|consensus Back     alignment and domain information
>PF09420 Nop16: Ribosome biogenesis protein Nop16; InterPro: IPR019002 Nucleolar protein 16 (Nop16) is a protein involved in the biogenesis of the 60S ribosomal subunit Back     alignment and domain information
>KOG4468|consensus Back     alignment and domain information
>TIGR01765 tspaseT_teng_N transposase, putative, N-terminal domain Back     alignment and domain information
>PF07750 GcrA: GcrA cell cycle regulator; InterPro: IPR011681 GcrA, together with CtrA (see IPR001789 from INTERPRO and IPR001867 from INTERPRO), form a master cell cycle regulator Back     alignment and domain information
>KOG2009|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query182
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 1e-05
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 2e-05
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 5e-05
1w0u_A55 Telomeric repeat binding factor 2; telomere, DNA-b 1e-04
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 2e-04
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 3e-04
1vf9_A64 Telomeric repeat binding factor 2; MYB, helix-turn 3e-04
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Length = 89 Back     alignment and structure
 Score = 41.1 bits (96), Expect = 1e-05
 Identities = 14/55 (25%), Positives = 27/55 (49%), Gaps = 3/55 (5%)

Query: 24 STPDSPSGNKWTAEDIEMLKETVRKFGDELVIISDRIKDRTISQIKS---NLKKK 75
          S  ++     WT E++   K+ + + G     I+  +  +T+SQ K+   N KK+
Sbjct: 9  SGRENLYFQGWTEEEMGTAKKGLLEHGRNWSAIARMVGSKTVSQCKNFYFNYKKR 63


>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 72 Back     alignment and structure
>1w0u_A Telomeric repeat binding factor 2; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle, nuclear protein; 1.8A {Homo sapiens} SCOP: a.4.1.4 Length = 55 Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Length = 53 Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Length = 69 Back     alignment and structure
>1vf9_A Telomeric repeat binding factor 2; MYB, helix-turn-helix, telomere, DNA binding protein; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1xg1_A 1vfc_A Length = 64 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query182
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 98.95
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 98.93
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 98.91
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 98.74
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 98.74
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 98.73
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 98.64
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 98.61
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 98.59
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 98.57
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 98.55
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 98.54
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 98.51
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 97.82
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 98.44
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 98.41
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 98.39
2cjj_A93 Radialis; plant development, DNA-binding protein, 98.39
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 98.38
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 98.36
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 98.35
2crg_A70 Metastasis associated protein MTA3; transcription 98.3
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 98.29
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 98.29
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 98.27
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 98.25
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 98.24
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 98.21
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 98.2
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 98.19
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 98.11
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 98.06
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 97.96
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 97.93
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 97.91
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 97.9
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 97.86
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 97.85
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 97.74
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 97.68
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 97.66
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 97.65
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 97.64
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 97.56
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 96.9
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 96.72
2xag_B 482 REST corepressor 1; amine oxidase, chromatin regul 95.91
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 94.71
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 93.78
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 92.52
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 91.34
2y9y_A374 Imitation switch protein 1 (DEL_ATPase); transcrip 82.82
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
Probab=98.95  E-value=1.3e-09  Score=75.85  Aligned_cols=56  Identities=36%  Similarity=0.497  Sum_probs=47.6

Q ss_pred             CCCCCCHHHHHHHHHHHHHhhhhHHHHHHHhhhhhHHHHHHH----HhhhhhhhcCCCCCCC
Q psy8149          30 SGNKWTAEDIEMLKETVRKFGDELVIISDRIKDRTISQIKSN----LKKKAFEDAGLPIQQQ   87 (182)
Q Consensus        30 ~~~KWTdeEiemLr~aV~rFg~dL~kIS~~Ik~RTv~QIKs~----lKrK~~edag~p~~~~   87 (182)
                      ..+.||++|.+.|..+|..||.+|.+||.+|.+||..|||.+    ++++.-.  |++....
T Consensus         8 ~~~~WT~eEd~~l~~~~~~~G~~W~~Ia~~~~~Rt~~q~k~r~~~~l~~~~~~--g~~~~~~   67 (72)
T 2cu7_A            8 YSVKWTIEEKELFEQGLAKFGRRWTKISKLIGSRTVLQVKSYARQYFKNKVKC--GLDKETP   67 (72)
T ss_dssp             CCCCCCHHHHHHHHHHHHHTCSCHHHHHHHHSSSCHHHHHHHHHHHHHHHSCS--CTTCCCS
T ss_pred             CCCCCCHHHHHHHHHHHHHHCcCHHHHHHHcCCCCHHHHHHHHHHHHHHHHhc--CCCCCcc
Confidence            468999999999999999999999999999999999999997    4554433  7765543



>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 182
d2iw5b165 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Hu 8e-07
d1xc5a168 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 3e-06
d2cu7a165 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sap 1e-04
d2crga157 a.4.1.3 (A:8-64) Metastasis associated protein MTA 2e-04
d1guua_50 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 8e-04
d1gv2a247 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mou 0.001
d1w0ta_52 a.4.1.4 (A:) DNA-binding domain of human telomeric 0.002
d1gvda_52 a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus 0.004
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Myb/SANT domain
domain: REST corepressor 1, CoREST
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 42.5 bits (100), Expect = 8e-07
 Identities = 13/46 (28%), Positives = 29/46 (63%), Gaps = 3/46 (6%)

Query: 33 KWTAEDIEMLKETVRKFGDELVIISDRIKDRTISQIKS---NLKKK 75
          +WT E+  +  + +RK+G +   ISD I ++++ Q+K+   N +++
Sbjct: 7  RWTTEEQLLAVQAIRKYGRDFQAISDVIGNKSVVQVKNFFVNYRRR 52


>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 57 Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 50 Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 47 Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 52 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query182
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 99.08
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 98.97
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 98.84
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 98.83
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 98.64
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 98.57
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 98.52
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 98.5
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 98.44
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 98.44
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 98.35
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 98.23
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 98.12
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 98.1
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 97.6
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 97.45
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 96.79
d1ofcx152 SANT domain of the nucleosome remodeling ATPase IS 96.47
d1x58a149 Hypothetical protein 4930532d21rik {Mouse (Mus mus 95.76
d1wgxa_73 Hypothetical protein C14orf106 (KIAA1903) {Human ( 89.3
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Myb/SANT domain
domain: MYSM1 (KIAA1915)
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.08  E-value=1e-10  Score=78.08  Aligned_cols=49  Identities=33%  Similarity=0.474  Sum_probs=43.8

Q ss_pred             CCCCCHHHHHHHHHHHHHhhhhHHHHHHHhhhhhHHHHHHHHhhhhhhh
Q psy8149          31 GNKWTAEDIEMLKETVRKFGDELVIISDRIKDRTISQIKSNLKKKAFED   79 (182)
Q Consensus        31 ~~KWTdeEiemLr~aV~rFg~dL~kIS~~Ik~RTv~QIKs~lKrK~~ed   79 (182)
                      ..|||++|.++|.++|..||.+|.+||.++.+||..|||++..+..-..
T Consensus         2 ~~~WT~eEd~~l~~~~~~~G~~W~~Ia~~~~~Rt~~q~k~ry~~~~~~~   50 (65)
T d2cu7a1           2 SVKWTIEEKELFEQGLAKFGRRWTKISKLIGSRTVLQVKSYARQYFKNK   50 (65)
T ss_dssp             CCCCCHHHHHHHHHHHHHTCSCHHHHHHHHSSSCHHHHHHHHHHHHHHH
T ss_pred             CCCCCHHHHHHHHHHHHHhcchHHHHHHHcCCCCHHHHHHHHHHHHHHH
Confidence            3699999999999999999999999999999999999999876554333



>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure