Psyllid ID: psy8228

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------15
WRGENVATSEVEDALSKIVQLKDAAVYGVETSALNTLGVLKKIKLFQVFTSMKRQQCIRAFLTYKFIMAIWLWKNWTLVDVFKTQVAKHPNKPALKHDEQTMSFQECILKRSGFNENAFYFPEEPGILIGMIKESRAESHFNGPFIVTI
cccccccHHHHHHHHHcccccccEEEEEEEccccccccEEEEEcccccccHHHHHHHHHHHccHHHHHHEEEEEccEEEHHHHHHHHcccccccccccccccccEEEEEEccccccccccccccccEEEEEcHHHHccccccccEEEEc
ccccccccHHHHHHHHHHHccccEEEEccccHHHHHHHHHHHccccEEEcHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHccccccccccccHHcccHHHHHHHHcccccccEcccccccEEEEEEEcccccccccccEEEEc
WRGENVATSEVEDALSKIVQLKDAAVYGVETSALNTLGVLKKIKLFQVFTSMKRQQCIRAFLTYKFIMAIWLWKNWTLVDVFKTQvakhpnkpalkhdeqTMSFQECILkrsgfnenafyfpeepgiLIGMIkesraeshfngpfivti
WRGENVATSEVEDALSKIVQLKDAAVYGVEtsalntlgvlKKIKLFQVFTSMKRQQCIRAFLTYKFIMAIWLWKNWTLVDVFKTQVAKHPnkpalkhdeqTMSFQECILKRSGFNENAFYFPEEPGILIGMIKESraeshfngpfivti
WRGENVATSEVEDALSKIVQLKDAAVYGVETSALNTLGVLKKIKLFQVFTSMKRQQCIRAFLTYKFIMAIWLWKNWTLVDVFKTQVAKHPNKPALKHDEQTMSFQECILKRSGFNENAFYFPEEPGILIGMIKESRAESHFNGPFIVTI
**************LSKIVQLKDAAVYGVETSALNTLGVLKKIKLFQVFTSMKRQQCIRAFLTYKFIMAIWLWKNWTLVDVFKTQVAK*************MSFQECILKRSGFNENAFYFPEEPGILIGMIKE***************
WRGENVATSEVEDALSKIVQLKDAAVYGVETSALNTLGVLKKIKLFQVFTSMKRQQCIRAFLTYKFIMAIWLWKNWTLVDVFKTQV***************MSFQECILKRSGFNENAFYFPEEPGILIGMIKESRAESHFNGPFIVTI
************DALSKIVQLKDAAVYGVETSALNTLGVLKKIKLFQVFTSMKRQQCIRAFLTYKFIMAIWLWKNWTLVDVFKTQVAKHPNKPALKHDEQTMSFQECILKRSGFNENAFYFPEEPGILIGMIKESRAESHFNGPFIVTI
*****VATSEVEDALSKIVQLKDAAVYGVETSALNTLGVLKKIKLFQVFTSMKRQQCIRAFLTYKFIMAIWLWKNWTLVDVFKTQVAKHPNKPALKHD*QTMSFQECILKRSGFNENAFYFPEEPGILIGMIKESRAESHFNGPFIVTI
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
WRGENVATSEVEDALSKIVQLKDAAVYGVETSALNTLGVLKKIKLFQVFTSMKRQQCIRAFLTYKFIMAIWLWKNWTLVDVFKTQVAKHPNKPALKHDEQTMSFQECILKRSGFNENAFYFPEEPGILIGMIKESRAESHFNGPFIVTI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query149 2.2.26 [Sep-21-2011]
Q91VE0643 Long-chain fatty acid tra yes N/A 0.221 0.051 0.545 9e-05
Q5RDY4643 Long-chain fatty acid tra yes N/A 0.221 0.051 0.545 0.0001
Q6P1M0643 Long-chain fatty acid tra yes N/A 0.221 0.051 0.545 0.0001
Q4R3Y4643 Long-chain fatty acid tra N/A N/A 0.221 0.051 0.545 0.0001
Q6PCB7646 Long-chain fatty acid tra no N/A 0.194 0.044 0.620 0.0006
Q3ZKN0646 Long-chain fatty acid tra no N/A 0.194 0.044 0.620 0.0006
P97849646 Long-chain fatty acid tra no N/A 0.194 0.044 0.620 0.0006
Q60714646 Long-chain fatty acid tra no N/A 0.194 0.044 0.620 0.0006
>sp|Q91VE0|S27A4_MOUSE Long-chain fatty acid transport protein 4 OS=Mus musculus GN=Slc27a4 PE=1 SV=1 Back     alignment and function desciption
 Score = 45.8 bits (107), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 18/33 (54%), Positives = 25/33 (75%)

Query: 1   WRGENVATSEVEDALSKIVQLKDAAVYGVETSA 33
           W+GENV+T+EVE  LS+++ + D AVYGVE   
Sbjct: 511 WKGENVSTTEVEGTLSRLLHMADVAVYGVEVPG 543
Involved in translocation of long-chain fatty acids (LFCA) across the plasma membrane. Appears to be the principal fatty acid transporter in small intestinal enterocytes. Plays a role in the formation of the epidermal barrier. Required for fat absorption in early embryogenesis. Has acyl-CoA ligase activity for long-chain and very-long-chain fatty acids.
Mus musculus (taxid: 10090)
EC: 6EC: .EC: 2EC: .EC: 1EC: .EC: -
>sp|Q5RDY4|S27A4_PONAB Long-chain fatty acid transport protein 4 OS=Pongo abelii GN=SLC27A4 PE=2 SV=1 Back     alignment and function description
>sp|Q6P1M0|S27A4_HUMAN Long-chain fatty acid transport protein 4 OS=Homo sapiens GN=SLC27A4 PE=1 SV=1 Back     alignment and function description
>sp|Q4R3Y4|S27A4_MACFA Long-chain fatty acid transport protein 4 OS=Macaca fascicularis GN=SLC27A4 PE=2 SV=1 Back     alignment and function description
>sp|Q6PCB7|S27A1_HUMAN Long-chain fatty acid transport protein 1 OS=Homo sapiens GN=SLC27A1 PE=2 SV=1 Back     alignment and function description
>sp|Q3ZKN0|S27A1_BOVIN Long-chain fatty acid transport protein 1 OS=Bos taurus GN=SLC27A1 PE=2 SV=1 Back     alignment and function description
>sp|P97849|S27A1_RAT Long-chain fatty acid transport protein 1 OS=Rattus norvegicus GN=Slc27a1 PE=2 SV=1 Back     alignment and function description
>sp|Q60714|S27A1_MOUSE Long-chain fatty acid transport protein 1 OS=Mus musculus GN=Slc27a1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query149
307207482 283 Long-chain fatty acid transport protein 0.221 0.116 0.696 0.0001
307207483 606 Long-chain fatty acid transport protein 0.221 0.054 0.696 0.0002
391325347 772 PREDICTED: long-chain fatty acid transpo 0.395 0.076 0.433 0.0002
157118013 668 AMP dependent ligase [Aedes aegypti] gi| 0.201 0.044 0.733 0.0003
170064898 627 AMP dependent ligase [Culex quinquefasci 0.201 0.047 0.733 0.0003
312373261 656 hypothetical protein AND_17667 [Anophele 0.201 0.045 0.733 0.0004
58377735 587 AGAP010870-PA [Anopheles gambiae str. PE 0.201 0.051 0.733 0.0004
193580113 662 PREDICTED: long-chain fatty acid transpo 0.147 0.033 0.733 0.0005
345488877 734 PREDICTED: long-chain fatty acid transpo 0.201 0.040 0.7 0.0006
332021219 588 Long-chain fatty acid transport protein 0.221 0.056 0.636 0.0006
>gi|307207482|gb|EFN85193.1| Long-chain fatty acid transport protein 1 [Harpegnathos saltator] Back     alignment and taxonomy information
 Score = 51.2 bits (121), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 23/33 (69%), Positives = 26/33 (78%)

Query: 1   WRGENVATSEVEDALSKIVQLKDAAVYGVETSA 33
           WRGENVATSEVE  +S ++ LKDAAVYGVE   
Sbjct: 172 WRGENVATSEVEAIVSNVIGLKDAAVYGVEVPG 204

Source: Harpegnathos saltator

Species: Harpegnathos saltator

Genus: Harpegnathos

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|307207483|gb|EFN85194.1| Long-chain fatty acid transport protein 1 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|391325347|ref|XP_003737200.1| PREDICTED: long-chain fatty acid transport protein 4-like [Metaseiulus occidentalis] Back     alignment and taxonomy information
>gi|157118013|ref|XP_001658965.1| AMP dependent ligase [Aedes aegypti] gi|108875869|gb|EAT40094.1| AAEL008144-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|170064898|ref|XP_001867718.1| AMP dependent ligase [Culex quinquefasciatus] gi|167882121|gb|EDS45504.1| AMP dependent ligase [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|312373261|gb|EFR21036.1| hypothetical protein AND_17667 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|58377735|ref|XP_309835.2| AGAP010870-PA [Anopheles gambiae str. PEST] gi|55244443|gb|EAA05521.2| AGAP010870-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|193580113|ref|XP_001944545.1| PREDICTED: long-chain fatty acid transport protein 4-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|345488877|ref|XP_001603294.2| PREDICTED: long-chain fatty acid transport protein 4-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|332021219|gb|EGI61604.1| Long-chain fatty acid transport protein 4 [Acromyrmex echinatior] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query149
RGD|1307383168 Slc27a4 "solute carrier family 0.201 0.178 0.633 6.8e-10
UNIPROTKB|G3V7V3643 Slc27a4 "Solute carrier family 0.201 0.046 0.633 1.3e-07
UNIPROTKB|Q96G53237 SLC27A4 "Long-chain fatty acid 0.201 0.126 0.6 2.5e-06
ZFIN|ZDB-GENE-050417-248643 slc27a4 "solute carrier family 0.201 0.046 0.6 7.5e-06
MGI|MGI:1347347643 Slc27a4 "solute carrier family 0.201 0.046 0.6 2.4e-05
UNIPROTKB|Q6P1M0643 SLC27A4 "Long-chain fatty acid 0.201 0.046 0.6 6.1e-05
UNIPROTKB|F1RR85526 SLC27A4 "Uncharacterized prote 0.201 0.057 0.6 0.00015
UNIPROTKB|J9P1R3701 SLC27A4 "Uncharacterized prote 0.201 0.042 0.6 0.00015
UNIPROTKB|Q0VCQ2643 SLC27A4 "Solute carrier family 0.201 0.046 0.6 0.00025
UNIPROTKB|F1PAM6642 SLC27A4 "Uncharacterized prote 0.201 0.046 0.6 0.00085
RGD|1307383 Slc27a4 "solute carrier family 27 (fatty acid transporter), member 4" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
 Score = 109 (43.4 bits), Expect = 6.8e-10, Sum P(2) = 6.8e-10
 Identities = 19/30 (63%), Positives = 26/30 (86%)

Query:     1 WRGENVATSEVEDALSKIVQLKDAAVYGVE 30
             W+GENV+T+EVE  LS+++Q+ D AVYGVE
Sbjct:    36 WKGENVSTTEVEGTLSRLLQMADVAVYGVE 65
GO:0000038 "very long-chain fatty acid metabolic process" evidence=ISO
GO:0001579 "medium-chain fatty acid transport" evidence=ISO
GO:0001676 "long-chain fatty acid metabolic process" evidence=ISO
GO:0003674 "molecular_function" evidence=ND
GO:0004467 "long-chain fatty acid-CoA ligase activity" evidence=ISO
GO:0005575 "cellular_component" evidence=ND
GO:0005783 "endoplasmic reticulum" evidence=ISO
GO:0005789 "endoplasmic reticulum membrane" evidence=ISO
GO:0005886 "plasma membrane" evidence=ISO
GO:0005902 "microvillus" evidence=ISO
GO:0006631 "fatty acid metabolic process" evidence=ISO
GO:0007584 "response to nutrient" evidence=IEP
GO:0015909 "long-chain fatty acid transport" evidence=ISO
GO:0031526 "brush border membrane" evidence=ISO
GO:0031957 "very long-chain fatty acid-CoA ligase activity" evidence=ISO
GO:0042760 "very long-chain fatty acid catabolic process" evidence=ISO
GO:0043588 "skin development" evidence=ISO
GO:0044539 "long-chain fatty acid import" evidence=ISO
UNIPROTKB|G3V7V3 Slc27a4 "Solute carrier family 27 (Fatty acid transporter), member 4" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q96G53 SLC27A4 "Long-chain fatty acid transport protein 4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050417-248 slc27a4 "solute carrier family 27 (fatty acid transporter), member 4" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
MGI|MGI:1347347 Slc27a4 "solute carrier family 27 (fatty acid transporter), member 4" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q6P1M0 SLC27A4 "Long-chain fatty acid transport protein 4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1RR85 SLC27A4 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|J9P1R3 SLC27A4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q0VCQ2 SLC27A4 "Solute carrier family 27 (Fatty acid transporter), member 4" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PAM6 SLC27A4 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query149
PRK08279600 PRK08279, PRK08279, long-chain-acyl-CoA synthetase 3e-10
cd05939474 cd05939, hsFATP4_like, Fatty acid transport protei 2e-09
cd05940444 cd05940, FATP_FACS, Fatty acid transport proteins 3e-08
cd05938535 cd05938, hsFATP2a_ACSVL_like, Fatty acid transport 5e-06
cd05937468 cd05937, FATP_chFAT1_like, Uncharacterized subfami 3e-05
COG0318534 COG0318, CaiC, Acyl-CoA synthetases (AMP-forming)/ 0.004
cd05934421 cd05934, FACL_DitJ_like, Uncharacterized subfamily 0.004
pfam00501412 pfam00501, AMP-binding, AMP-binding enzyme 0.004
cd05917347 cd05917, FACL_like_2, Uncharacterized subfamily of 0.004
>gnl|CDD|236217 PRK08279, PRK08279, long-chain-acyl-CoA synthetase; Validated Back     alignment and domain information 
 Score = 56.4 bits (137), Expect = 3e-10
 Identities = 19/30 (63%), Positives = 25/30 (83%)

Query: 1   WRGENVATSEVEDALSKIVQLKDAAVYGVE 30
           W+GENVAT+EVE+ALS    +++A VYGVE
Sbjct: 467 WKGENVATTEVENALSGFPGVEEAVVYGVE 496

Length = 600
>gnl|CDD|213305 cd05939, hsFATP4_like, Fatty acid transport proteins (FATP), including FATP4 and FATP1, and similar proteins Back     alignment and domain information
>gnl|CDD|213306 cd05940, FATP_FACS, Fatty acid transport proteins (FATP) play dual roles as fatty acid transporters and its activation enzymes Back     alignment and domain information
>gnl|CDD|213304 cd05938, hsFATP2a_ACSVL_like, Fatty acid transport proteins (FATP) including hsFATP2, hsFATP5, and hsFATP6, and similar proteins Back     alignment and domain information
>gnl|CDD|213303 cd05937, FATP_chFAT1_like, Uncharacterized subfamily of bifunctional fatty acid transporter/very-long-chain acyl-CoA synthetase in fungi Back     alignment and domain information
>gnl|CDD|223395 COG0318, CaiC, Acyl-CoA synthetases (AMP-forming)/AMP-acid ligases II [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|213300 cd05934, FACL_DitJ_like, Uncharacterized subfamily of fatty acid CoA ligase (FACL) Back     alignment and domain information
>gnl|CDD|215954 pfam00501, AMP-binding, AMP-binding enzyme Back     alignment and domain information
>gnl|CDD|213284 cd05917, FACL_like_2, Uncharacterized subfamily of fatty acid CoA ligase (FACL) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 149
KOG1179|consensus649 99.89
PRK07868994 acyl-CoA synthetase; Validated 99.84
PRK08279600 long-chain-acyl-CoA synthetase; Validated 99.84
KOG1176|consensus537 99.83
KOG1177|consensus596 99.77
COG0318534 CaiC Acyl-CoA synthetases (AMP-forming)/AMP-acid l 99.77
PRK13388540 acyl-CoA synthetase; Provisional 99.75
PRK09188365 serine/threonine protein kinase; Provisional 99.73
PRK07867529 acyl-CoA synthetase; Validated 99.71
PLN03051499 acyl-activating enzyme; Provisional 99.7
PRK07445452 O-succinylbenzoic acid--CoA ligase; Reviewed 99.68
TIGR01217652 ac_ac_CoA_syn acetoacetyl-CoA synthase. This enzym 99.68
COG0365528 Acs Acyl-coenzyme A synthetases/AMP-(fatty) acid l 99.66
PRK07824358 O-succinylbenzoic acid--CoA ligase; Provisional 99.65
PTZ00237647 acetyl-CoA synthetase; Provisional 99.65
PF1319373 AMP-binding_C: AMP-binding enzyme C-terminal domai 99.64
PRK03584655 acetoacetyl-CoA synthetase; Provisional 99.64
PLN02654666 acetate-CoA ligase 99.64
COG1021542 EntE Peptide arylation enzymes [Secondary metaboli 99.63
PRK07788549 acyl-CoA synthetase; Validated 99.63
TIGR02316628 propion_prpE propionate--CoA ligase. This family c 99.62
PRK08043718 bifunctional acyl-[acyl carrier protein] synthetas 99.61
PLN02574560 4-coumarate--CoA ligase-like 99.6
PRK06155542 crotonobetaine/carnitine-CoA ligase; Provisional 99.6
TIGR02188625 Ac_CoA_lig_AcsA acetate--CoA ligase. This model de 99.59
PRK00174637 acetyl-CoA synthetase; Provisional 99.59
PRK05677562 long-chain-fatty-acid--CoA ligase; Validated 99.59
PRK09029458 O-succinylbenzoic acid--CoA ligase; Provisional 99.58
PRK07529632 AMP-binding domain protein; Validated 99.58
PRK08314546 long-chain-fatty-acid--CoA ligase; Validated 99.58
TIGR03098515 ligase_PEP_1 acyl-CoA ligase (AMP-forming), exosor 99.58
PRK05851525 long-chain-fatty-acid--[acyl-carrier-protein] liga 99.58
PLN03102579 acyl-activating enzyme; Provisional 99.57
PRK07638487 acyl-CoA synthetase; Validated 99.57
PRK04319570 acetyl-CoA synthetase; Provisional 99.57
PRK06839496 acyl-CoA synthetase; Validated 99.57
PRK13382537 acyl-CoA synthetase; Provisional 99.57
PRK13390501 acyl-CoA synthetase; Provisional 99.56
PRK08308414 acyl-CoA synthetase; Validated 99.56
KOG1175|consensus626 99.56
PRK10524629 prpE propionyl-CoA synthetase; Provisional 99.56
PRK05852534 acyl-CoA synthetase; Validated 99.55
PLN02860563 o-succinylbenzoate-CoA ligase 99.55
PRK05620576 long-chain-fatty-acid--CoA ligase; Validated 99.55
PRK07787471 acyl-CoA synthetase; Validated 99.55
PLN02246537 4-coumarate--CoA ligase 99.54
PLN03052728 acetate--CoA ligase; Provisional 99.54
PRK07798533 acyl-CoA synthetase; Validated 99.54
PRK08751560 putative long-chain fatty acyl CoA ligase; Provisi 99.53
PRK06060 705 acyl-CoA synthetase; Validated 99.53
PRK07008539 long-chain-fatty-acid--CoA ligase; Validated 99.53
TIGR02275527 DHB_AMP_lig 2,3-dihydroxybenzoate-AMP ligase. Prot 99.53
PRK06710563 long-chain-fatty-acid--CoA ligase; Validated 99.52
PRK06145497 acyl-CoA synthetase; Validated 99.52
PRK06018542 putative acyl-CoA synthetase; Provisional 99.52
PRK09088488 acyl-CoA synthetase; Validated 99.52
PRK07470528 acyl-CoA synthetase; Validated 99.52
PRK12583558 acyl-CoA synthetase; Provisional 99.52
PRK08008517 caiC putative crotonobetaine/carnitine-CoA ligase; 99.51
PRK06334539 long chain fatty acid--[acyl-carrier-protein] liga 99.51
PRK068141140 acylglycerophosphoethanolamine acyltransferase; Pr 99.51
PLN02330546 4-coumarate--CoA ligase-like 1 99.5
PRK13295547 cyclohexanecarboxylate-CoA ligase; Reviewed 99.49
PRK05857540 acyl-CoA synthetase; Validated 99.49
PRK08315559 AMP-binding domain protein; Validated 99.49
PRK07769631 long-chain-fatty-acid--CoA ligase; Validated 99.49
PRK05605573 long-chain-fatty-acid--CoA ligase; Validated 99.49
PRK10946536 entE enterobactin synthase subunit E; Provisional 99.49
TIGR03208538 cyc_hxne_CoA_lg cyclohexanecarboxylate-CoA ligase. 99.49
PRK06188524 acyl-CoA synthetase; Validated 99.48
PRK13391511 acyl-CoA synthetase; Provisional 99.48
PRK12406509 long-chain-fatty-acid--CoA ligase; Provisional 99.48
PRK07656513 long-chain-fatty-acid--CoA ligase; Validated 99.48
PRK12492562 long-chain-fatty-acid--CoA ligase; Provisional 99.48
PRK07059557 Long-chain-fatty-acid--CoA ligase; Validated 99.47
TIGR03205541 pimA dicarboxylate--CoA ligase PimA. PimA, a membe 99.47
PRK07514504 malonyl-CoA synthase; Validated 99.47
PRK03640483 O-succinylbenzoic acid--CoA ligase; Provisional 99.47
TIGR01734502 D-ala-DACP-lig D-alanine--poly(phosphoribitol) lig 99.47
PRK086331146 2-acyl-glycerophospho-ethanolamine acyltransferase 99.45
PRK08316523 acyl-CoA synthetase; Validated 99.45
PRK06178567 acyl-CoA synthetase; Validated 99.43
PRK04813503 D-alanine--poly(phosphoribitol) ligase subunit 1; 99.43
PRK07786542 long-chain-fatty-acid--CoA ligase; Validated 99.43
PRK08974560 long-chain-fatty-acid--CoA ligase; Validated 99.43
TIGR01923436 menE O-succinylbenzoate-CoA ligase. This model rep 99.42
PRK06087547 short chain acyl-CoA synthetase; Reviewed 99.42
PRK13383516 acyl-CoA synthetase; Provisional 99.42
PRK08276502 long-chain-fatty-acid--CoA ligase; Validated 99.41
PRK08162545 acyl-CoA synthetase; Validated 99.41
PRK09274552 peptide synthase; Provisional 99.41
PRK06187521 long-chain-fatty-acid--CoA ligase; Validated 99.4
PRK06164540 acyl-CoA synthetase; Validated 99.39
PLN02479567 acetate-CoA ligase 99.38
PRK12476612 putative fatty-acid--CoA ligase; Provisional 99.37
TIGR03443 1389 alpha_am_amid L-aminoadipate-semialdehyde dehydrog 99.37
TIGR02262508 benz_CoA_lig benzoate-CoA ligase family. Character 99.35
TIGR02372386 4_coum_CoA_lig 4-coumarate--CoA ligase, photoactiv 99.32
PRK10252 1296 entF enterobactin synthase subunit F; Provisional 99.27
PRK12316 5163 peptide synthase; Provisional 99.25
PRK09192579 acyl-CoA synthetase; Validated 99.25
PRK12316 5163 peptide synthase; Provisional 99.24
PLN02736651 long-chain acyl-CoA synthetase 99.24
PRK12467 3956 peptide synthase; Provisional 99.23
PRK12467 3956 peptide synthase; Provisional 99.14
PRK05691 4334 peptide synthase; Validated 99.13
PRK08180614 feruloyl-CoA synthase; Reviewed 99.12
PRK05691 4334 peptide synthase; Validated 99.11
PRK07768545 long-chain-fatty-acid--CoA ligase; Validated 99.1
PRK05850578 acyl-CoA synthetase; Validated 98.97
PRK12582624 acyl-CoA synthetase; Provisional 98.88
PLN02387696 long-chain-fatty-acid-CoA ligase family protein 98.8
PLN02861660 long-chain-fatty-acid-CoA ligase 98.79
PLN02614666 long-chain acyl-CoA synthetase 98.73
PLN02430660 long-chain-fatty-acid-CoA ligase 98.54
KOG1178|consensus 1032 98.48
PTZ00342746 acyl-CoA synthetase; Provisional 98.24
TIGR02155422 PA_CoA_ligase phenylacetate-CoA ligase. Phenylacet 98.15
PTZ00216700 acyl-CoA synthetase; Provisional 98.07
PF1453596 AMP-binding_C_2: AMP-binding enzyme C-terminal dom 96.79
PTZ00297 1452 pantothenate kinase; Provisional 96.72
COG1022613 FAA1 Long-chain acyl-CoA synthetases (AMP-forming) 93.83
KOG1256|consensus691 88.84
TIGR03335445 F390_ftsA coenzyme F390 synthetase. This enzyme, c 87.01
>KOG1179|consensus Back     alignment and domain information 
Probab=99.89  E-value=4.4e-24  Score=191.18  Aligned_cols=117  Identities=26%  Similarity=0.444  Sum_probs=110.0

Q ss_pred             CCeEEechHHHHHHHhcCCCcccEEEEEEEcCCCCee-EEE-------ecCCHHHHHHHHhccccccCCCCCCceeEEEE
Q psy8228           1 WRGENVATSEVEDALSKIVQLKDAAVYGVETSALNTL-GVL-------KKIKLFQVFTSMKRQQCIRAFLTYKFIMAIWL   72 (149)
Q Consensus         1 wgGenVsp~EVE~vL~~hP~V~eaaVvGVpd~~~~~~-~~A-------~~~~~~~L~~~l~~~~~~~~L~~ykvP~~v~~   72 (149)
                      |+|||||++|||++|....+++||.||||..|..+|+ +||       .+.|.+.+..++++     .||+|++|+++++
T Consensus       516 WKGENVsTtEVe~~l~~~~~~~dv~VYGV~VP~~EGRaGMAaI~~~p~~~~d~~~l~~~l~~-----~LP~YA~P~FlRl  590 (649)
T KOG1179|consen  516 WKGENVSTTEVEDVLSALDFLQDVNVYGVTVPGYEGRAGMAAIVLDPTTEKDLEKLYQHLRE-----NLPSYARPRFLRL  590 (649)
T ss_pred             ecCCcccHHHHHHHHhhhccccceeEEEEecCCccCccceEEEEecCcccchHHHHHHHHHh-----hCccccchHHHHH
Confidence            9999999999999999999999999999999999999 888       46788999999999     9999999999999


Q ss_pred             ecccCCCCCCccccCCCCCCCCccccccchhhhhHHHHhcCCCCC----ceEeec-CCCceeeCCHHHHHhhhhc
Q psy8228          73 WKNWTLVDVFKTQVAKHPNKPALKHDEQTMSFQECILKRSGFNEN----AFYFPE-EPGILIGMIKESRAESHFN  142 (149)
Q Consensus        73 vd~lP~T~tGKi~~~~~~~~~~~~~~~~~~~~~k~~l~~~~~~~~----~~y~~~-~~~~y~~~~~~~~~~~~~~  142 (149)
                      ++++++|+|.|.+                    |..|+++||++.    ++|+++ ..+.|+|||.|.|+.+..+
T Consensus       591 ~~~i~~TgTFKl~--------------------K~~L~~egf~p~~~~dply~~~~~~~~y~Plt~~~y~~i~~g  645 (649)
T KOG1179|consen  591 QDEIEKTGTFKLQ--------------------KTELQKEGFNPAIISDPLYYLDNAGKSYVPLTQEMYSAISAG  645 (649)
T ss_pred             HhhhhcccchhhH--------------------HHHHHHccCCccccCCceEEEeccCCccccCCHHHHHHHhcC
Confidence            9999999999999                    999999999997    899999 5556999999999998754

>PRK07868 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK08279 long-chain-acyl-CoA synthetase; Validated Back     alignment and domain information
>KOG1176|consensus Back     alignment and domain information
>KOG1177|consensus Back     alignment and domain information
>COG0318 CaiC Acyl-CoA synthetases (AMP-forming)/AMP-acid ligases II [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK13388 acyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK09188 serine/threonine protein kinase; Provisional Back     alignment and domain information
>PRK07867 acyl-CoA synthetase; Validated Back     alignment and domain information
>PLN03051 acyl-activating enzyme; Provisional Back     alignment and domain information
>PRK07445 O-succinylbenzoic acid--CoA ligase; Reviewed Back     alignment and domain information
>TIGR01217 ac_ac_CoA_syn acetoacetyl-CoA synthase Back     alignment and domain information
>COG0365 Acs Acyl-coenzyme A synthetases/AMP-(fatty) acid ligases [Lipid metabolism] Back     alignment and domain information
>PRK07824 O-succinylbenzoic acid--CoA ligase; Provisional Back     alignment and domain information
>PTZ00237 acetyl-CoA synthetase; Provisional Back     alignment and domain information
>PF13193 AMP-binding_C: AMP-binding enzyme C-terminal domain; PDB: 3L8C_B 2VSQ_A 3R44_A 3RG2_B 3A9U_A 3A9V_A 3NI2_A 1V26_B 1ULT_B 1V25_B Back     alignment and domain information
>PRK03584 acetoacetyl-CoA synthetase; Provisional Back     alignment and domain information
>PLN02654 acetate-CoA ligase Back     alignment and domain information
>COG1021 EntE Peptide arylation enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK07788 acyl-CoA synthetase; Validated Back     alignment and domain information
>TIGR02316 propion_prpE propionate--CoA ligase Back     alignment and domain information
>PRK08043 bifunctional acyl-[acyl carrier protein] synthetase/2-acylglycerophosphoethanolamine acyltransferase; Validated Back     alignment and domain information
>PLN02574 4-coumarate--CoA ligase-like Back     alignment and domain information
>PRK06155 crotonobetaine/carnitine-CoA ligase; Provisional Back     alignment and domain information
>TIGR02188 Ac_CoA_lig_AcsA acetate--CoA ligase Back     alignment and domain information
>PRK00174 acetyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK05677 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK09029 O-succinylbenzoic acid--CoA ligase; Provisional Back     alignment and domain information
>PRK07529 AMP-binding domain protein; Validated Back     alignment and domain information
>PRK08314 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>TIGR03098 ligase_PEP_1 acyl-CoA ligase (AMP-forming), exosortase system type 1 associated Back     alignment and domain information
>PRK05851 long-chain-fatty-acid--[acyl-carrier-protein] ligase; Validated Back     alignment and domain information
>PLN03102 acyl-activating enzyme; Provisional Back     alignment and domain information
>PRK07638 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK04319 acetyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK06839 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK13382 acyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK13390 acyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK08308 acyl-CoA synthetase; Validated Back     alignment and domain information
>KOG1175|consensus Back     alignment and domain information
>PRK10524 prpE propionyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK05852 acyl-CoA synthetase; Validated Back     alignment and domain information
>PLN02860 o-succinylbenzoate-CoA ligase Back     alignment and domain information
>PRK05620 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK07787 acyl-CoA synthetase; Validated Back     alignment and domain information
>PLN02246 4-coumarate--CoA ligase Back     alignment and domain information
>PLN03052 acetate--CoA ligase; Provisional Back     alignment and domain information
>PRK07798 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK08751 putative long-chain fatty acyl CoA ligase; Provisional Back     alignment and domain information
>PRK06060 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK07008 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>TIGR02275 DHB_AMP_lig 2,3-dihydroxybenzoate-AMP ligase Back     alignment and domain information
>PRK06710 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK06145 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK06018 putative acyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK09088 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK07470 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK12583 acyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK08008 caiC putative crotonobetaine/carnitine-CoA ligase; Validated Back     alignment and domain information
>PRK06334 long chain fatty acid--[acyl-carrier-protein] ligase; Validated Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>PLN02330 4-coumarate--CoA ligase-like 1 Back     alignment and domain information
>PRK13295 cyclohexanecarboxylate-CoA ligase; Reviewed Back     alignment and domain information
>PRK05857 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK08315 AMP-binding domain protein; Validated Back     alignment and domain information
>PRK07769 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK05605 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK10946 entE enterobactin synthase subunit E; Provisional Back     alignment and domain information
>TIGR03208 cyc_hxne_CoA_lg cyclohexanecarboxylate-CoA ligase Back     alignment and domain information
>PRK06188 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK13391 acyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK12406 long-chain-fatty-acid--CoA ligase; Provisional Back     alignment and domain information
>PRK07656 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK12492 long-chain-fatty-acid--CoA ligase; Provisional Back     alignment and domain information
>PRK07059 Long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>TIGR03205 pimA dicarboxylate--CoA ligase PimA Back     alignment and domain information
>PRK07514 malonyl-CoA synthase; Validated Back     alignment and domain information
>PRK03640 O-succinylbenzoic acid--CoA ligase; Provisional Back     alignment and domain information
>TIGR01734 D-ala-DACP-lig D-alanine--poly(phosphoribitol) ligase, subunit 1 Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>PRK08316 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK06178 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK04813 D-alanine--poly(phosphoribitol) ligase subunit 1; Provisional Back     alignment and domain information
>PRK07786 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK08974 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>TIGR01923 menE O-succinylbenzoate-CoA ligase Back     alignment and domain information
>PRK06087 short chain acyl-CoA synthetase; Reviewed Back     alignment and domain information
>PRK13383 acyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK08276 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK08162 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK09274 peptide synthase; Provisional Back     alignment and domain information
>PRK06187 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK06164 acyl-CoA synthetase; Validated Back     alignment and domain information
>PLN02479 acetate-CoA ligase Back     alignment and domain information
>PRK12476 putative fatty-acid--CoA ligase; Provisional Back     alignment and domain information
>TIGR03443 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase Back     alignment and domain information
>TIGR02262 benz_CoA_lig benzoate-CoA ligase family Back     alignment and domain information
>TIGR02372 4_coum_CoA_lig 4-coumarate--CoA ligase, photoactive yellow protein activation family Back     alignment and domain information
>PRK10252 entF enterobactin synthase subunit F; Provisional Back     alignment and domain information
>PRK12316 peptide synthase; Provisional Back     alignment and domain information
>PRK09192 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK12316 peptide synthase; Provisional Back     alignment and domain information
>PLN02736 long-chain acyl-CoA synthetase Back     alignment and domain information
>PRK12467 peptide synthase; Provisional Back     alignment and domain information
>PRK12467 peptide synthase; Provisional Back     alignment and domain information
>PRK05691 peptide synthase; Validated Back     alignment and domain information
>PRK08180 feruloyl-CoA synthase; Reviewed Back     alignment and domain information
>PRK05691 peptide synthase; Validated Back     alignment and domain information
>PRK07768 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK05850 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK12582 acyl-CoA synthetase; Provisional Back     alignment and domain information
>PLN02387 long-chain-fatty-acid-CoA ligase family protein Back     alignment and domain information
>PLN02861 long-chain-fatty-acid-CoA ligase Back     alignment and domain information
>PLN02614 long-chain acyl-CoA synthetase Back     alignment and domain information
>PLN02430 long-chain-fatty-acid-CoA ligase Back     alignment and domain information
>KOG1178|consensus Back     alignment and domain information
>PTZ00342 acyl-CoA synthetase; Provisional Back     alignment and domain information
>TIGR02155 PA_CoA_ligase phenylacetate-CoA ligase Back     alignment and domain information
>PTZ00216 acyl-CoA synthetase; Provisional Back     alignment and domain information
>PF14535 AMP-binding_C_2: AMP-binding enzyme C-terminal domain; PDB: 2Y27_A 2Y4N_A 3QOV_B 3S89_D 3LAX_A 2Y4O_B Back     alignment and domain information
>PTZ00297 pantothenate kinase; Provisional Back     alignment and domain information
>COG1022 FAA1 Long-chain acyl-CoA synthetases (AMP-forming) [Lipid metabolism] Back     alignment and domain information
>KOG1256|consensus Back     alignment and domain information
>TIGR03335 F390_ftsA coenzyme F390 synthetase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query149
3o83_A 544 Peptide arylation enzyme; ligase, adenylation of 2 2e-04
1mdb_A 539 2,3-dihydroxybenzoate-AMP ligase; adenylation doma 2e-04
2vsq_A 1304 Surfactin synthetase subunit 3; ligase, peptidyl c 3e-04
3e7w_A 511 D-alanine--poly(phosphoribitol) ligase subunit 1; 8e-04
>3o83_A Peptide arylation enzyme; ligase, adenylation of 2,3-dihydroxybenzoate and transfer to pantetheine cofactor of BASF; HET: IXN; 1.90A {Acinetobacter baumannii} PDB: 3o82_A* 3o84_A* Length = 544 Back     alignment and structure
 Score = 39.4 bits (93), Expect = 2e-04
 Identities = 9/35 (25%), Positives = 16/35 (45%)

Query: 72  LWKNWTLVDVFKTQVAKHPNKPALKHDEQTMSFQE 106
            W +  L  +    V  HP+  A+   E+ +S+ E
Sbjct: 26  YWIDQPLTRILTVGVQSHPHSLAIICGERQLSYIE 60
>1mdb_A 2,3-dihydroxybenzoate-AMP ligase; adenylation domain, peptide synthetase, antibiotic biosynthesis, siderophore formation; HET: AMP DBH; 2.15A {Bacillus subtilis} SCOP: e.23.1.1 PDB: 1md9_A* 1mdf_A Length = 539 Back     alignment and structure
>2vsq_A Surfactin synthetase subunit 3; ligase, peptidyl carrier protein, ligase phosphoprotein, TER module, phosphopantetheine; 2.60A {Bacillus subtilis} Length = 1304 Back     alignment and structure
>3e7w_A D-alanine--poly(phosphoribitol) ligase subunit 1; DLTA, non-ribosomal peptide synthetase, NRPS, adenylation domain, D-alanylation; HET: AMP; 2.28A {Bacillus subtilis} PDB: 3e7x_A* Length = 511 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query149
3ipl_A501 2-succinylbenzoate--COA ligase; structural genomic 99.75
4fuq_A503 Malonyl COA synthetase; ANL superfamily, methylma 99.74
3r44_A517 Fatty acyl COA synthetase FADD13 (fatty-acyl-COA s 99.74
3ni2_A536 4-coumarate:COA ligase; 4CL, phenylpropanoid biosy 99.73
3nyq_A505 Malonyl-COA ligase; A/B topology ababa sandwich be 99.73
1t5h_X504 4-chlorobenzoyl COA ligase; adenylate-forming coen 99.73
1mdb_A539 2,3-dihydroxybenzoate-AMP ligase; adenylation doma 99.73
4gs5_A358 Acyl-COA synthetase (AMP-forming)/AMP-acid ligase 99.71
1amu_A563 GRSA, gramicidin synthetase 1; peptide synthetase, 99.7
3g7s_A549 Long-chain-fatty-acid--COA ligase (FADD-1); protei 99.7
3etc_A580 AMP-binding protein; adenylate-forming acyl-COA sy 99.7
2d1s_A548 Luciferase, luciferin 4-monooxygenase; alpha/beta, 99.69
3e7w_A511 D-alanine--poly(phosphoribitol) ligase subunit 1; 99.68
4gr5_A570 Non-ribosomal peptide synthetase; MBTH-like domain 99.67
3fce_A512 D-alanine--poly(phosphoribitol) ligase subunit 1; 99.67
1pg4_A652 Acetyl-COA synthetase; AMP-forming, adenylate-form 99.67
3l8c_A521 D-alanine--poly(phosphoribitol) ligase subunit 1; 99.67
3ivr_A509 Putative long-chain-fatty-acid COA ligase; structu 99.66
3c5e_A570 Acyl-coenzyme A synthetase ACSM2A, mitochondrial; 99.66
2v7b_A529 Benzoate-coenzyme A ligase; benzoate oxidation, be 99.63
1v25_A541 Long-chain-fatty-acid-COA synthetase; ligase, stru 99.63
3o83_A544 Peptide arylation enzyme; ligase, adenylation of 2 99.62
1ry2_A663 Acetyl-coenzyme A synthetase 1, acyl-activating en 99.62
3rg2_A617 Enterobactin synthase component E (ENTE), 2,3-DIH 99.61
3rix_A550 Luciferase, luciferin 4-monooxygenase; oxidoreduct 99.58
3tsy_A 979 Fusion protein 4-coumarate--COA ligase 1, resvera 99.56
3lax_A109 Phenylacetate-coenzyme A ligase; structural genomi 99.55
4dg8_A620 PA1221; ANL superfamily, adenylation domain, pepti 99.54
3ite_A562 SIDN siderophore synthetase; ligase, non-ribosomal 99.51
2vsq_A 1304 Surfactin synthetase subunit 3; ligase, peptidyl c 99.51
3gxs_A109 Phenylacetate-coenzyme A ligase; APC62324.1, struc 99.46
3gqw_A576 Fatty acid AMP ligase; FAAL, E. coli, ATP-dependen 99.44
2y4o_A443 Phenylacetate-coenzyme A ligase; phenylacetic acid 99.39
3kxw_A590 Saframycin MX1 synthetase B; fatty acid AMP ligase 99.38
2y27_A437 Phenylacetate-coenzyme A ligase; phenylacetic acid 99.38
3qov_A436 Phenylacetate-coenzyme A ligase; acetyl-COA synthe 99.3
>3ipl_A 2-succinylbenzoate--COA ligase; structural genomics, acyl-protein synthetase, PSI-2, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
Probab=99.75  E-value=1.5e-18  Score=148.32  Aligned_cols=91  Identities=19%  Similarity=0.194  Sum_probs=65.0

Q ss_pred             CCeEEechHHHHHHHhcCCCcccEEEEEEEcCCCCeeEEE-----ecCCHHHHHHHHhccccccCCCCCCceeEEEEecc
Q psy8228           1 WRGENVATSEVEDALSKIVQLKDAAVYGVETSALNTLGVL-----KKIKLFQVFTSMKRQQCIRAFLTYKFIMAIWLWKN   75 (149)
Q Consensus         1 wgGenVsp~EVE~vL~~hP~V~eaaVvGVpd~~~~~~~~A-----~~~~~~~L~~~l~~~~~~~~L~~ykvP~~v~~vd~   75 (149)
                      .+|+||+|.|||++|.+||+|.+|+|+|++++..++..++     ...+.++|+++|++     +||.|++|+.+.++++
T Consensus       403 ~~G~~v~p~eiE~~l~~~p~V~~~~vv~~~~~~~g~~~~a~v~~~~~~~~~~l~~~l~~-----~L~~~~~P~~i~~v~~  477 (501)
T 3ipl_A          403 SGGENIYPYQIETVAKQFPGISDAVCVGHPDDTWGQVPKLYFVSESDISKAQLIAYLSK-----HLAKYKVPKHFEKVDT  477 (501)
T ss_dssp             CSSCEECHHHHHHHHTTSTTEEEEEEEEEEETTTEEEEEEEEEESSCCCHHHHHHHHHH-----HSCGGGSCSEEEECSS
T ss_pred             ECCEEECHHHHHHHHHhCCCccEEEEEEEecccCCceEEEEEEeCCCCCHHHHHHHHHh-----hCccccCCCEEEEecc
Confidence            4799999999999999999999999999999776554433     56789999999999     9999999999999999


Q ss_pred             cCCCCCCccccCCCCCCCCccccccchhhhhHHHHhcCCCC
Q psy8228          76 WTLVDVFKTQVAKHPNKPALKHDEQTMSFQECILKRSGFNE  116 (149)
Q Consensus        76 lP~T~tGKi~~~~~~~~~~~~~~~~~~~~~k~~l~~~~~~~  116 (149)
                      ||+|++||++                    |+.|++.....
T Consensus       478 lP~t~~GKi~--------------------R~~l~~~~~~~  498 (501)
T 3ipl_A          478 LPYTSTGKLQ--------------------RNKLYREGHHH  498 (501)
T ss_dssp             CC---------------------------------------
T ss_pred             cCCCCCCCEe--------------------HHHHhhccccc
Confidence            9999999999                    99998886543
>4fuq_A Malonyl COA synthetase; ANL superfamily, methylma malonate, ligase; HET: MSE; 1.70A {Rhodopseudomonas palustris} PDB: 4fut_A* 4gxr_A* 4gxq_A* Back     alignment and structure
>3r44_A Fatty acyl COA synthetase FADD13 (fatty-acyl-COA synthetase); ligase; HET: HIS; 1.80A {Mycobacterium tuberculosis} PDB: 3t5c_A 3t5b_A Back     alignment and structure
>3ni2_A 4-coumarate:COA ligase; 4CL, phenylpropanoid biosynthesis; HET: AYL EPE; 1.90A {Populus tomentosa} PDB: 3a9v_A* 3a9u_A* Back     alignment and structure
>3nyq_A Malonyl-COA ligase; A/B topology ababa sandwich beta-barrel adenylate-forming EN fold; HET: MCA AMP; 1.43A {Streptomyces coelicolor} PDB: 3nyr_A* Back     alignment and structure
>1t5h_X 4-chlorobenzoyl COA ligase; adenylate-forming coenzyme A ligase domain alternation confo change; 2.00A {Alcaligenes SP} SCOP: e.23.1.1 PDB: 1t5d_X 3cw9_A* 3cw8_X* 2qvz_X* 2qw0_X* 3dlp_X* 2qvx_X* 2qvy_X* Back     alignment and structure
>1mdb_A 2,3-dihydroxybenzoate-AMP ligase; adenylation domain, peptide synthetase, antibiotic biosynthesis, siderophore formation; HET: AMP DBH; 2.15A {Bacillus subtilis} SCOP: e.23.1.1 PDB: 1md9_A* 1mdf_A Back     alignment and structure
>4gs5_A Acyl-COA synthetase (AMP-forming)/AMP-acid ligase protein; structural genomics, PSI-biology; 2.02A {Dyadobacter fermentans} Back     alignment and structure
>1amu_A GRSA, gramicidin synthetase 1; peptide synthetase, adenylate forming; HET: PHE AMP; 1.90A {Brevibacillus brevis} SCOP: e.23.1.1 Back     alignment and structure
>3g7s_A Long-chain-fatty-acid--COA ligase (FADD-1); protein structure initiative, PSI-II, NYSGXRC, 11193J, structural genomics; 2.15A {Archaeoglobus fulgidus dsm 4304} Back     alignment and structure
>3etc_A AMP-binding protein; adenylate-forming acyl-COA synthetase ligase, ligase; HET: PGE 1PE EPE; 2.10A {Methanosarcina acetivorans} Back     alignment and structure
>2d1s_A Luciferase, luciferin 4-monooxygenase; alpha/beta, beta barrel, alpha+beta, riken structural genomics/proteomics initiative, RSGI; HET: SLU; 1.30A {Luciola cruciata} PDB: 2d1q_A* 2d1r_A* 2d1t_A* Back     alignment and structure
>3e7w_A D-alanine--poly(phosphoribitol) ligase subunit 1; DLTA, non-ribosomal peptide synthetase, NRPS, adenylation domain, D-alanylation; HET: AMP; 2.28A {Bacillus subtilis} PDB: 3e7x_A* Back     alignment and structure
>4gr5_A Non-ribosomal peptide synthetase; MBTH-like domain, adenylation domain, ligase, rossmann fold, binding; HET: APC TLA; 1.92A {Streptomyces lydicus} PDB: 4gr4_A Back     alignment and structure
>3fce_A D-alanine--poly(phosphoribitol) ligase subunit 1; DLTA, AMP-forming domain, adenylation, D-alanine protein ligase, ATP complex; HET: ATP; 1.90A {Bacillus cereus} PDB: 3fcc_A* 3dhv_A* Back     alignment and structure
>1pg4_A Acetyl-COA synthetase; AMP-forming, adenylate-forming, thioester-forming, ligase; HET: COA PRX; 1.75A {Salmonella enterica} SCOP: e.23.1.1 PDB: 1pg3_A* 2p2f_A* 2p2b_A* 2p2q_A* 2p2j_A* 2p20_A* 2p2m_A* Back     alignment and structure
>3l8c_A D-alanine--poly(phosphoribitol) ligase subunit 1; structural genomics, DLTA, ATP-binding, cytoplasm, nucleotide-binding; 2.41A {Streptococcus pyogenes serotype M6} PDB: 3lgx_A* Back     alignment and structure
>3ivr_A Putative long-chain-fatty-acid COA ligase; structural genomics, PSI-2, protein S initiative, fatty acid synthesis; HET: GOL; 2.00A {Rhodopseudomonas palustris} SCOP: e.23.1.0 Back     alignment and structure
>3c5e_A Acyl-coenzyme A synthetase ACSM2A, mitochondrial; middle-chain acyl-COA synthetase, xenobiotic/medium-chain FA COA ligase; HET: ATP; 1.60A {Homo sapiens} PDB: 2vze_A 3b7w_A* 3day_A* 3eq6_A* 3eyn_A* 3gpc_A* 2wd9_A* Back     alignment and structure
>2v7b_A Benzoate-coenzyme A ligase; benzoate oxidation, benzoate COA ligase; 1.84A {Burkholderia xenovorans} Back     alignment and structure
>1v25_A Long-chain-fatty-acid-COA synthetase; ligase, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.30A {Thermus thermophilus} SCOP: e.23.1.1 PDB: 1ult_A* 1v26_A* Back     alignment and structure
>3o83_A Peptide arylation enzyme; ligase, adenylation of 2,3-dihydroxybenzoate and transfer to pantetheine cofactor of BASF; HET: IXN; 1.90A {Acinetobacter baumannii} SCOP: e.23.1.0 PDB: 3o82_A* 3o84_A* 3u16_A* 3u17_A* Back     alignment and structure
>1ry2_A Acetyl-coenzyme A synthetase 1, acyl-activating enzyme 1; AMP forming, related to firefly luciferase, ligase; HET: AMP; 2.30A {Saccharomyces cerevisiae} SCOP: e.23.1.1 Back     alignment and structure
>3rg2_A Enterobactin synthase component E (ENTE), 2,3-DIH dihydroxybenzoate synthetase, isochroismatase...; adenylate-forming enzymes, ANL superfamily; HET: SVS PNS; 3.10A {Escherichia coli} Back     alignment and structure
>3rix_A Luciferase, luciferin 4-monooxygenase; oxidoreductase, photoprotein, luminescence, aspulvinone, natural product extracts; HET: 923; 1.70A {Photinus pyralis} SCOP: e.23.1.1 PDB: 1ba3_A 1lci_A* 4e5d_A* 3ies_A* 3iep_A* 3ier_A* 4g36_A* 4g37_A* 3qya_A Back     alignment and structure
>3tsy_A Fusion protein 4-coumarate--COA ligase 1, resvera synthase; transferase; 3.10A {Arabidospis thaliana} Back     alignment and structure
>3lax_A Phenylacetate-coenzyme A ligase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 1.43A {Bacteroides vulgatus} Back     alignment and structure
>4dg8_A PA1221; ANL superfamily, adenylation domain, peptidyl carrier protei ribosomal peptide synthetase, NRPS, valine adenylation, LIG; HET: AMP; 2.15A {Pseudomonas aeruginosa} PDB: 4dg9_A* Back     alignment and structure
>3ite_A SIDN siderophore synthetase; ligase, non-ribosomal peptide synthesis, NRPS, sidna3, fungal, endophyte; HET: MSE; 2.00A {Neotyphodium lolii} Back     alignment and structure
>2vsq_A Surfactin synthetase subunit 3; ligase, peptidyl carrier protein, ligase phosphoprotein, TER module, phosphopantetheine; 2.60A {Bacillus subtilis} Back     alignment and structure
>2y4o_A Phenylacetate-coenzyme A ligase; phenylacetic acid degradation pathway; HET: DLL; 1.90A {Burkholderia cenocepacia} Back     alignment and structure
>3kxw_A Saframycin MX1 synthetase B; fatty acid AMP ligase, SGX, acyl adenylate, structural genom 2, protein structure initiative; HET: 1ZZ; 1.85A {Legionella pneumophila subsp} PDB: 3lnv_A* Back     alignment and structure
>2y27_A Phenylacetate-coenzyme A ligase; phenylacetic acid degradation pathway; HET: MSE PG4 ATP; 1.60A {Burkholderia cenocepacia} PDB: 2y4n_A* Back     alignment and structure
>3qov_A Phenylacetate-coenzyme A ligase; acetyl-COA synthetase-like, structural genomics, joint cente structural genomics, JCSG; HET: MSE ADP COA; 2.20A {Bacteroides thetaiotaomicron} PDB: 3s89_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 149
d1mdba_ 536 e.23.1.1 (A:) Dihydroxybenzoate-AMP ligase DhbE {B 1e-06
d1mdba_536 e.23.1.1 (A:) Dihydroxybenzoate-AMP ligase DhbE {B 6e-04
d1amua_ 514 e.23.1.1 (A:) Phenylalanine activating domain of g 3e-06
d1amua_514 e.23.1.1 (A:) Phenylalanine activating domain of g 6e-04
d1lcia_541 e.23.1.1 (A:) Luciferase {Firefly (Photinus pyrali 1e-04
d3cw9a1503 e.23.1.1 (A:1-503) 4-chlorobenzoyl CoA ligase {Alc 2e-04
d1pg4a_643 e.23.1.1 (A:) Acetyl-CoA synthetase {Salmonella en 4e-04
d1v25a_534 e.23.1.1 (A:) Long chain fatty acid-CoA ligase TT0 5e-04
d1ry2a_640 e.23.1.1 (A:) Acetyl-CoA synthetase {Baker's yeast 0.003
>d1mdba_ e.23.1.1 (A:) Dihydroxybenzoate-AMP ligase DhbE {Bacillus subtilis [TaxId: 1423]} Length = 536 Back     information, alignment and structure

class: Multi-domain proteins (alpha and beta)
fold: Acetyl-CoA synthetase-like
superfamily: Acetyl-CoA synthetase-like
family: Acetyl-CoA synthetase-like
domain: Dihydroxybenzoate-AMP ligase DhbE
species: Bacillus subtilis [TaxId: 1423]

 Score = 44.6 bits (104), Expect = 1e-06
 Identities = 8/35 (22%), Positives = 17/35 (48%)

Query: 72  LWKNWTLVDVFKTQVAKHPNKPALKHDEQTMSFQE 106
            W   T  D+ + + AK+ ++ A+       S++E
Sbjct: 21  CWAGETFGDLLRDRAAKYGDRIAITCGNTHWSYRE 55
>d1mdba_ e.23.1.1 (A:) Dihydroxybenzoate-AMP ligase DhbE {Bacillus subtilis [TaxId: 1423]} Length = 536 Back     information, alignment and structure
>d1amua_ e.23.1.1 (A:) Phenylalanine activating domain of gramicidin synthetase 1 {Bacillus brevis [TaxId: 1393]} Length = 514 Back     information, alignment and structure
>d1amua_ e.23.1.1 (A:) Phenylalanine activating domain of gramicidin synthetase 1 {Bacillus brevis [TaxId: 1393]} Length = 514 Back     information, alignment and structure
>d1lcia_ e.23.1.1 (A:) Luciferase {Firefly (Photinus pyralis) [TaxId: 7054]} Length = 541 Back     information, alignment and structure
>d3cw9a1 e.23.1.1 (A:1-503) 4-chlorobenzoyl CoA ligase {Alcaligenes sp. [TaxId: 512]} Length = 503 Back     information, alignment and structure
>d1pg4a_ e.23.1.1 (A:) Acetyl-CoA synthetase {Salmonella enterica [TaxId: 28901]} Length = 643 Back     information, alignment and structure
>d1v25a_ e.23.1.1 (A:) Long chain fatty acid-CoA ligase TT0168 {Thermus thermophilus [TaxId: 274]} Length = 534 Back     information, alignment and structure
>d1ry2a_ e.23.1.1 (A:) Acetyl-CoA synthetase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 640 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query149
d1amua_514 Phenylalanine activating domain of gramicidin synt 99.77
d3cw9a1503 4-chlorobenzoyl CoA ligase {Alcaligenes sp. [TaxId 99.76
d1pg4a_643 Acetyl-CoA synthetase {Salmonella enterica [TaxId: 99.73
d1mdba_536 Dihydroxybenzoate-AMP ligase DhbE {Bacillus subtil 99.73
d1ry2a_640 Acetyl-CoA synthetase {Baker's yeast (Saccharomyce 99.73
d1lcia_541 Luciferase {Firefly (Photinus pyralis) [TaxId: 705 99.71
d1v25a_534 Long chain fatty acid-CoA ligase TT0168 {Thermus t 99.64
>d1amua_ e.23.1.1 (A:) Phenylalanine activating domain of gramicidin synthetase 1 {Bacillus brevis [TaxId: 1393]} Back     information, alignment and structure
class: Multi-domain proteins (alpha and beta)
fold: Acetyl-CoA synthetase-like
superfamily: Acetyl-CoA synthetase-like
family: Acetyl-CoA synthetase-like
domain: Phenylalanine activating domain of gramicidin synthetase 1
species: Bacillus brevis [TaxId: 1393]

Probab=99.77  E-value=2.9e-19  Score=148.47  Aligned_cols=79  Identities=23%  Similarity=0.135  Sum_probs=73.0

Q ss_pred             CeEEechHHHHHHHhcCCCcccEEEEEEEcCCCCeeEEE-----ecCCHHHHHHHHhccccccCCCCCCceeEEEEeccc
Q psy8228           2 RGENVATSEVEDALSKIVQLKDAAVYGVETSALNTLGVL-----KKIKLFQVFTSMKRQQCIRAFLTYKFIMAIWLWKNW   76 (149)
Q Consensus         2 gGenVsp~EVE~vL~~hP~V~eaaVvGVpd~~~~~~~~A-----~~~~~~~L~~~l~~~~~~~~L~~ykvP~~v~~vd~l   76 (149)
                      +|+||+|.|||++|.+||+|.||+|+|++|+..+...+|     ...+.++|+++|++     +|++|++|+.|.++++|
T Consensus       420 ~G~~i~p~~IE~~l~~~~~V~~~~V~~~~~~~~g~~~~a~v~~~~~~~~~~l~~~~~~-----~l~~~~~p~~i~~v~~l  494 (514)
T d1amua_         420 RGHRVELEEVESILLKHMYISETAVSVHKDHQEQPYLCAYFVSEKHIPLEQLRQFSSE-----ELPTYMIPSYFIQLDKM  494 (514)
T ss_dssp             TTEEEEHHHHHHHHTTSTTEEEEEEEEEECTTSCEEEEEEEEESSCCCHHHHHHHHHH-----HSCGGGSCSEEEECSSC
T ss_pred             CCEEECHHHHHHHHHhCCCccEEEEEEEECCCCCEEEEEEEEcCCCCCHHHHHHHHHh-----hCCcccCceEEEEeCCC
Confidence            699999999999999999999999999998776655544     46789999999999     99999999999999999


Q ss_pred             CCCCCCccc
Q psy8228          77 TLVDVFKTQ   85 (149)
Q Consensus        77 P~T~tGKi~   85 (149)
                      |+|++|||+
T Consensus       495 P~t~~GKi~  503 (514)
T d1amua_         495 PLTSNGKID  503 (514)
T ss_dssp             CBCTTSSBC
T ss_pred             CCCCCcChh
Confidence            999999999
>d3cw9a1 e.23.1.1 (A:1-503) 4-chlorobenzoyl CoA ligase {Alcaligenes sp. [TaxId: 512]} Back     information, alignment and structure
>d1pg4a_ e.23.1.1 (A:) Acetyl-CoA synthetase {Salmonella enterica [TaxId: 28901]} Back     information, alignment and structure
>d1mdba_ e.23.1.1 (A:) Dihydroxybenzoate-AMP ligase DhbE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ry2a_ e.23.1.1 (A:) Acetyl-CoA synthetase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lcia_ e.23.1.1 (A:) Luciferase {Firefly (Photinus pyralis) [TaxId: 7054]} Back     information, alignment and structure
>d1v25a_ e.23.1.1 (A:) Long chain fatty acid-CoA ligase TT0168 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure