Psyllid ID: psy8456
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 353 | ||||||
| 342183833 | 637 | unnamed protein product, partial [Trypan | 0.804 | 0.445 | 0.377 | 8e-60 | |
| 342183835 | 849 | unnamed protein product [Trypanosoma con | 0.804 | 0.334 | 0.377 | 1e-57 | |
| 324504589 | 405 | Thymidine kinase [Ascaris suum] | 0.815 | 0.711 | 0.370 | 3e-57 | |
| 261332022 | 455 | thymidine kinase, putative [Trypanosoma | 0.813 | 0.630 | 0.334 | 5e-51 | |
| 22324517 | 455 | thymidine kinase [Trypanosoma brucei] | 0.813 | 0.630 | 0.334 | 1e-50 | |
| 71746582 | 455 | thymidine kinase [Trypanosoma brucei bru | 0.813 | 0.630 | 0.331 | 3e-50 | |
| 324503582 | 375 | Thymidine kinase [Ascaris suum] | 0.691 | 0.650 | 0.360 | 6e-48 | |
| 212373999 | 220 | thymidine kinase [Suberites domuncula] | 0.436 | 0.7 | 0.5 | 3e-47 | |
| 340368544 | 226 | PREDICTED: thymidine kinase, cytosolic-l | 0.470 | 0.734 | 0.481 | 1e-46 | |
| 391334485 | 202 | PREDICTED: thymidine kinase, cytosolic-l | 0.436 | 0.762 | 0.49 | 5e-46 |
| >gi|342183833|emb|CCC93313.1| unnamed protein product, partial [Trypanosoma congolense IL3000] | Back alignment and taxonomy information |
|---|
Score = 236 bits (603), Expect = 8e-60, Method: Compositional matrix adjust.
Identities = 142/376 (37%), Positives = 193/376 (51%), Gaps = 92/376 (24%)
Query: 20 RIRRYQYANYRCMIVRYAKDDRYDTEKVATHDQQKLTA-VSAVELNKLIPHTKDIDVIGI 78
R+ R A+ C +++Y+KD RY E ++THDQ+ LTA VS +L+++ + DVI +
Sbjct: 221 RVNRNYLASQSCYVIKYSKDVRYSKEIISTHDQRTLTATVSVSKLSEIGNAWCEHDVIAV 280
Query: 79 DEGQFFPDVVSFAESMANAGKIVVVAALDGTFQRTGFNDILSLIPLAECVEKLTAVCMSC 138
D GQFFPD++ F ANAGK V+V+ALDG ++ F DI LIP AE V KL+AVCMSC
Sbjct: 281 DGGQFFPDILQFCSMAANAGKKVIVSALDGDYRNEPFEDIAKLIPAAESVTKLSAVCMSC 340
Query: 139 FR---DAAFTKRIGQEK-----------------------------------------EV 154
DA +T R Q + EV
Sbjct: 341 NLQSCDACYTHRTVQSEQRELIGGADMYIATCRACYNRLNNQGGSLVENPQSPQSGRIEV 400
Query: 155 ILGPMFSGKTTELIRRIRRYQYANYRCMIVRYAKDDRYDTEKVSTHDQQKLTA-VSAVEL 213
++GPMF+GKTTEL+ R+ RY A Y C +++Y++D RY E +STHD++ L A VS +L
Sbjct: 401 VIGPMFAGKTTELMSRVNRYSLARYSCYVIKYSEDKRYSKENISTHDRRTLPATVSVTKL 460
Query: 214 NKLIPHTKDIDVIGIDEGQFVEVIGGSDKYMAVCRECYKQKAPIKRSPFKTLANENAALN 273
+++ D DVI +DEGQF
Sbjct: 461 SEVGEKWCDYDVIAVDEGQF---------------------------------------- 480
Query: 274 VPPPPEFPDVVSFAESMANAGKIVVVAALDGTFQRTGFNDILSLIPLAECVEKLTAVCMS 333
FPD++ F ANAGK V+VAALDG ++ F DI LIP AE V KL+AVCM
Sbjct: 481 ------FPDILEFCSMAANAGKKVIVAALDGDYRNEPFEDIAKLIPAAESVTKLSAVCML 534
Query: 334 CFRDAAFTKRIGQEKE 349
C DA +T R Q ++
Sbjct: 535 CGCDAYYTHRTVQSEQ 550
|
Source: Trypanosoma congolense IL3000 Species: Trypanosoma congolense Genus: Trypanosoma Family: Trypanosomatidae Order: Kinetoplastida Class: Phylum: Superkingdom: Eukaryota |
| >gi|342183835|emb|CCC93315.1| unnamed protein product [Trypanosoma congolense IL3000] | Back alignment and taxonomy information |
|---|
| >gi|324504589|gb|ADY41981.1| Thymidine kinase [Ascaris suum] | Back alignment and taxonomy information |
|---|
| >gi|261332022|emb|CBH15015.1| thymidine kinase, putative [Trypanosoma brucei gambiense DAL972] | Back alignment and taxonomy information |
|---|
| >gi|22324517|gb|AAM95606.1|AF395663_1 thymidine kinase [Trypanosoma brucei] | Back alignment and taxonomy information |
|---|
| >gi|71746582|ref|XP_822346.1| thymidine kinase [Trypanosoma brucei brucei strain 927/4 GUTat10.1] gi|70832014|gb|EAN77518.1| thymidine kinase, putative [Trypanosoma brucei brucei strain 927/4 GUTat10.1] | Back alignment and taxonomy information |
|---|
| >gi|324503582|gb|ADY41554.1| Thymidine kinase [Ascaris suum] | Back alignment and taxonomy information |
|---|
| >gi|212373999|emb|CAP19646.1| thymidine kinase [Suberites domuncula] | Back alignment and taxonomy information |
|---|
| >gi|340368544|ref|XP_003382811.1| PREDICTED: thymidine kinase, cytosolic-like [Amphimedon queenslandica] | Back alignment and taxonomy information |
|---|
| >gi|391334485|ref|XP_003741634.1| PREDICTED: thymidine kinase, cytosolic-like [Metaseiulus occidentalis] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 353 | ||||||
| UNIPROTKB|K7ERV3 | 267 | TK1 "Thymidine kinase" [Homo s | 0.382 | 0.505 | 0.595 | 1.6e-47 | |
| UNIPROTKB|E2QXP4 | 242 | TK1 "Thymidine kinase" [Canis | 0.390 | 0.570 | 0.585 | 5.9e-41 | |
| UNIPROTKB|A5D7R8 | 238 | TK1 "Thymidine kinase, cytosol | 0.390 | 0.579 | 0.585 | 9.6e-41 | |
| MGI|MGI:98763 | 233 | Tk1 "thymidine kinase 1" [Mus | 0.390 | 0.592 | 0.578 | 3.3e-40 | |
| UNIPROTKB|P04183 | 234 | TK1 "Thymidine kinase, cytosol | 0.390 | 0.589 | 0.585 | 2.6e-40 | |
| UNIPROTKB|P04047 | 224 | TK1 "Thymidine kinase, cytosol | 0.393 | 0.620 | 0.578 | 1.1e-39 | |
| UNIPROTKB|K7ES52 | 180 | TK1 "Thymidine kinase" [Homo s | 0.388 | 0.761 | 0.594 | 2.6e-40 | |
| UNIPROTKB|P09768 | 234 | TK1 "Thymidine kinase, cytosol | 0.390 | 0.589 | 0.578 | 4.8e-39 | |
| UNIPROTKB|K7ERJ1 | 187 | TK1 "Thymidine kinase" [Homo s | 0.390 | 0.737 | 0.554 | 4.3e-38 | |
| ZFIN|ZDB-GENE-030131-5801 | 236 | tk1 "thymidine kinase 1, solub | 0.393 | 0.588 | 0.561 | 1.6e-38 |
| UNIPROTKB|K7ERV3 TK1 "Thymidine kinase" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Score = 427 (155.4 bits), Expect = 1.6e-47, Sum P(2) = 1.6e-47
Identities = 81/136 (59%), Positives = 102/136 (75%)
Query: 19 RRIRRYQYANYRCMIVRYAKDDRYDTEKVATHDQQKLTAVSAVELNKLIPHTKDIDVIGI 78
RR+RR+Q A Y+C++++YAKD RY + THD+ + A+ A L + + VIGI
Sbjct: 38 RRVRRFQIAQYKCLVIKYAKDTRYSSS-FCTHDRNTMEALPACLLRDVAQEALGVAVIGI 96
Query: 79 DEGQFFPDVVSFAESMANAGKIVVVAALDGTFQRTGFNDILSLIPLAECVEKLTAVCMSC 138
DEGQFFPD+V F E+MANAGK V+VAALDGTFQR F IL+L+PLAE V KLTAVCM C
Sbjct: 97 DEGQFFPDIVEFCEAMANAGKTVIVAALDGTFQRKPFGAILNLVPLAESVVKLTAVCMEC 156
Query: 139 FRDAAFTKRIGQEKEV 154
FR+AA+TKR+G EKEV
Sbjct: 157 FREAAYTKRLGTEKEV 172
|
|
| UNIPROTKB|E2QXP4 TK1 "Thymidine kinase" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|A5D7R8 TK1 "Thymidine kinase, cytosolic" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:98763 Tk1 "thymidine kinase 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P04183 TK1 "Thymidine kinase, cytosolic" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P04047 TK1 "Thymidine kinase, cytosolic" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|K7ES52 TK1 "Thymidine kinase" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P09768 TK1 "Thymidine kinase, cytosolic" [Cricetulus griseus (taxid:10029)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|K7ERJ1 TK1 "Thymidine kinase" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-5801 tk1 "thymidine kinase 1, soluble" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 353 | |||
| PTZ00293 | 211 | PTZ00293, PTZ00293, thymidine kinase; Provisional | 4e-65 | |
| PTZ00293 | 211 | PTZ00293, PTZ00293, thymidine kinase; Provisional | 2e-60 | |
| pfam00265 | 175 | pfam00265, TK, Thymidine kinase | 1e-58 | |
| pfam00265 | 175 | pfam00265, TK, Thymidine kinase | 4e-55 | |
| PRK04296 | 190 | PRK04296, PRK04296, thymidine kinase; Provisional | 8e-27 | |
| COG1435 | 201 | COG1435, Tdk, Thymidine kinase [Nucleotide transpo | 2e-25 | |
| PRK04296 | 190 | PRK04296, PRK04296, thymidine kinase; Provisional | 3e-22 | |
| COG1435 | 201 | COG1435, Tdk, Thymidine kinase [Nucleotide transpo | 3e-20 | |
| PTZ00293 | 211 | PTZ00293, PTZ00293, thymidine kinase; Provisional | 2e-04 |
| >gnl|CDD|185542 PTZ00293, PTZ00293, thymidine kinase; Provisional | Back alignment and domain information |
|---|
Score = 204 bits (522), Expect = 4e-65
Identities = 86/199 (43%), Positives = 120/199 (60%), Gaps = 47/199 (23%)
Query: 153 EVILGPMFSGKTTELIRRIRRYQYANYRCMIVRYAKDDRY-DTEKVSTHDQQKLTAVSAV 211
VI+GPMFSGKTTEL+R ++R+ Y+ +C++++Y+KD RY D + +S+HD+Q L A+
Sbjct: 7 SVIIGPMFSGKTTELMRLVKRFTYSEKKCVVIKYSKDTRYSDEQNISSHDKQMLKAIKVS 66
Query: 212 ELNKLIPHTKDIDVIGIDEGQFVEVIGGSDKYMAVCRECYKQKAPIKRSPFKTLANENAA 271
+L +++ K+ DVI IDEGQF
Sbjct: 67 KLKEVLETAKNYDVIAIDEGQF-------------------------------------- 88
Query: 272 LNVPPPPEFPDVVSFAESMANAGKIVVVAALDGTFQRTGFNDILSLIPLAECVEKLTAVC 331
FPD+V F+E+ AN GKIV+VAALDGTFQR F IL+LIPLAE V KLTAVC
Sbjct: 89 --------FPDLVEFSEAAANLGKIVIVAALDGTFQRKPFGQILNLIPLAERVTKLTAVC 140
Query: 332 MSCFRDAAFTKRIGQEKEV 350
M C ++A+F+KRI Q +++
Sbjct: 141 MFCGKEASFSKRIVQSEQI 159
|
Length = 211 |
| >gnl|CDD|185542 PTZ00293, PTZ00293, thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215828 pfam00265, TK, Thymidine kinase | Back alignment and domain information |
|---|
| >gnl|CDD|215828 pfam00265, TK, Thymidine kinase | Back alignment and domain information |
|---|
| >gnl|CDD|235272 PRK04296, PRK04296, thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224352 COG1435, Tdk, Thymidine kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|235272 PRK04296, PRK04296, thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|224352 COG1435, Tdk, Thymidine kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|185542 PTZ00293, PTZ00293, thymidine kinase; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 353 | |||
| PTZ00293 | 211 | thymidine kinase; Provisional | 100.0 | |
| PF00265 | 176 | TK: Thymidine kinase; InterPro: IPR001267 Thymidin | 100.0 | |
| PTZ00293 | 211 | thymidine kinase; Provisional | 100.0 | |
| COG1435 | 201 | Tdk Thymidine kinase [Nucleotide transport and met | 100.0 | |
| PF00265 | 176 | TK: Thymidine kinase; InterPro: IPR001267 Thymidin | 100.0 | |
| COG1435 | 201 | Tdk Thymidine kinase [Nucleotide transport and met | 100.0 | |
| KOG3125|consensus | 234 | 100.0 | ||
| KOG3125|consensus | 234 | 100.0 | ||
| PRK04296 | 190 | thymidine kinase; Provisional | 100.0 | |
| PRK04296 | 190 | thymidine kinase; Provisional | 100.0 | |
| PF13604 | 196 | AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL | 97.82 | |
| PF13173 | 128 | AAA_14: AAA domain | 97.49 | |
| PRK07413 | 382 | hypothetical protein; Validated | 97.35 | |
| COG1618 | 179 | Predicted nucleotide kinase [Nucleotide transport | 97.29 | |
| cd01121 | 372 | Sms Sms (bacterial radA) DNA repair protein. This | 97.27 | |
| PF13604 | 196 | AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL | 97.14 | |
| cd01120 | 165 | RecA-like_NTPases RecA-like NTPases. This family i | 97.05 | |
| PF05707 | 193 | Zot: Zonular occludens toxin (Zot); InterPro: IPR0 | 96.98 | |
| PRK08084 | 235 | DNA replication initiation factor; Provisional | 96.98 | |
| PF01443 | 234 | Viral_helicase1: Viral (Superfamily 1) RNA helicas | 96.95 | |
| PF00308 | 219 | Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 | 96.92 | |
| PF09848 | 352 | DUF2075: Uncharacterized conserved protein (DUF207 | 96.88 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 96.87 | |
| PF07652 | 148 | Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR | 96.87 | |
| PF07652 | 148 | Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR | 96.87 | |
| PRK11823 | 446 | DNA repair protein RadA; Provisional | 96.86 | |
| cd01124 | 187 | KaiC KaiC is a circadian clock protein primarily f | 96.83 | |
| TIGR00416 | 454 | sms DNA repair protein RadA. The gene protuct code | 96.81 | |
| PF13401 | 131 | AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S | 96.79 | |
| PRK08727 | 233 | hypothetical protein; Validated | 96.71 | |
| PRK14087 | 450 | dnaA chromosomal replication initiation protein; P | 96.71 | |
| PF02399 | 824 | Herpes_ori_bp: Origin of replication binding prote | 96.59 | |
| PRK05642 | 234 | DNA replication initiation factor; Validated | 96.57 | |
| PRK06893 | 229 | DNA replication initiation factor; Validated | 96.57 | |
| smart00487 | 201 | DEXDc DEAD-like helicases superfamily. | 96.55 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 96.45 | |
| cd00561 | 159 | CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B | 96.36 | |
| PRK12422 | 445 | chromosomal replication initiation protein; Provis | 96.35 | |
| PRK14086 | 617 | dnaA chromosomal replication initiation protein; P | 96.35 | |
| PF03266 | 168 | NTPase_1: NTPase; InterPro: IPR004948 This entry r | 96.32 | |
| TIGR00708 | 173 | cobA cob(I)alamin adenosyltransferase. Alternate n | 96.25 | |
| COG1373 | 398 | Predicted ATPase (AAA+ superfamily) [General funct | 96.24 | |
| TIGR00708 | 173 | cobA cob(I)alamin adenosyltransferase. Alternate n | 96.19 | |
| PRK05703 | 424 | flhF flagellar biosynthesis regulator FlhF; Valida | 96.08 | |
| PF13245 | 76 | AAA_19: Part of AAA domain | 96.07 | |
| PRK00149 | 450 | dnaA chromosomal replication initiation protein; R | 95.99 | |
| TIGR03420 | 226 | DnaA_homol_Hda DnaA regulatory inactivator Hda. Me | 95.87 | |
| cd01131 | 198 | PilT Pilus retraction ATPase PilT. PilT is a nucle | 95.87 | |
| PRK12723 | 388 | flagellar biosynthesis regulator FlhF; Provisional | 95.86 | |
| COG1066 | 456 | Sms Predicted ATP-dependent serine protease [Postt | 95.84 | |
| TIGR00176 | 155 | mobB molybdopterin-guanine dinucleotide biosynthes | 95.83 | |
| TIGR00362 | 405 | DnaA chromosomal replication initiator protein Dna | 95.82 | |
| PRK06526 | 254 | transposase; Provisional | 95.74 | |
| PRK08903 | 227 | DnaA regulatory inactivator Hda; Validated | 95.73 | |
| cd01120 | 165 | RecA-like_NTPases RecA-like NTPases. This family i | 95.69 | |
| PF00437 | 270 | T2SE: Type II/IV secretion system protein; InterPr | 95.68 | |
| TIGR02768 | 744 | TraA_Ti Ti-type conjugative transfer relaxase TraA | 95.68 | |
| PRK05973 | 237 | replicative DNA helicase; Provisional | 95.61 | |
| cd01129 | 264 | PulE-GspE PulE/GspE The type II secretory pathway | 95.56 | |
| TIGR01618 | 220 | phage_P_loop phage nucleotide-binding protein. Thi | 95.52 | |
| TIGR02525 | 372 | plasmid_TraJ plasmid transfer ATPase TraJ. Members | 95.51 | |
| TIGR03499 | 282 | FlhF flagellar biosynthetic protein FlhF. | 95.44 | |
| cd01121 | 372 | Sms Sms (bacterial radA) DNA repair protein. This | 95.43 | |
| PF13173 | 128 | AAA_14: AAA domain | 95.42 | |
| PF02702 | 211 | KdpD: Osmosensitive K+ channel His kinase sensor d | 95.39 | |
| TIGR00595 | 505 | priA primosomal protein N'. All proteins in this f | 95.38 | |
| PRK08116 | 268 | hypothetical protein; Validated | 95.38 | |
| PHA00350 | 399 | putative assembly protein | 95.35 | |
| cd00561 | 159 | CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B | 95.27 | |
| PRK06921 | 266 | hypothetical protein; Provisional | 95.26 | |
| COG0593 | 408 | DnaA ATPase involved in DNA replication initiation | 95.25 | |
| PRK14974 | 336 | cell division protein FtsY; Provisional | 95.23 | |
| PRK06620 | 214 | hypothetical protein; Validated | 95.21 | |
| PF02562 | 205 | PhoH: PhoH-like protein; InterPro: IPR003714 PhoH | 95.17 | |
| TIGR01420 | 343 | pilT_fam pilus retraction protein PilT. This model | 95.11 | |
| COG0552 | 340 | FtsY Signal recognition particle GTPase [Intracell | 95.08 | |
| PRK11889 | 436 | flhF flagellar biosynthesis regulator FlhF; Provis | 95.04 | |
| cd03283 | 199 | ABC_MutS-like MutS-like homolog in eukaryotes. The | 95.03 | |
| PRK05986 | 191 | cob(I)alamin adenolsyltransferase/cobinamide ATP-d | 94.97 | |
| PRK06067 | 234 | flagellar accessory protein FlaH; Validated | 94.97 | |
| PRK14722 | 374 | flhF flagellar biosynthesis regulator FlhF; Provis | 94.91 | |
| PRK12727 | 559 | flagellar biosynthesis regulator FlhF; Provisional | 94.87 | |
| PRK10436 | 462 | hypothetical protein; Provisional | 94.84 | |
| PRK13889 | 988 | conjugal transfer relaxase TraA; Provisional | 94.84 | |
| TIGR00635 | 305 | ruvB Holliday junction DNA helicase, RuvB subunit. | 94.83 | |
| PF02572 | 172 | CobA_CobO_BtuR: ATP:corrinoid adenosyltransferase | 94.78 | |
| PRK14088 | 440 | dnaA chromosomal replication initiation protein; P | 94.77 | |
| PF09848 | 352 | DUF2075: Uncharacterized conserved protein (DUF207 | 94.73 | |
| COG3854 | 308 | SpoIIIAA ncharacterized protein conserved in bacte | 94.67 | |
| PRK12726 | 407 | flagellar biosynthesis regulator FlhF; Provisional | 94.66 | |
| COG1763 | 161 | MobB Molybdopterin-guanine dinucleotide biosynthes | 94.65 | |
| PRK00411 | 394 | cdc6 cell division control protein 6; Reviewed | 94.59 | |
| PRK10416 | 318 | signal recognition particle-docking protein FtsY; | 94.56 | |
| PF13479 | 213 | AAA_24: AAA domain | 94.53 | |
| PF01443 | 234 | Viral_helicase1: Viral (Superfamily 1) RNA helicas | 94.49 | |
| PRK13695 | 174 | putative NTPase; Provisional | 94.43 | |
| cd03282 | 204 | ABC_MSH4_euk MutS4 homolog in eukaryotes. The MutS | 94.4 | |
| PRK10536 | 262 | hypothetical protein; Provisional | 94.38 | |
| PRK05986 | 191 | cob(I)alamin adenolsyltransferase/cobinamide ATP-d | 94.36 | |
| PRK00771 | 437 | signal recognition particle protein Srp54; Provisi | 94.31 | |
| TIGR03015 | 269 | pepcterm_ATPase putative secretion ATPase, PEP-CTE | 94.3 | |
| cd01672 | 200 | TMPK Thymidine monophosphate kinase (TMPK), also k | 94.28 | |
| PRK13826 | 1102 | Dtr system oriT relaxase; Provisional | 94.26 | |
| PHA00012 | 361 | I assembly protein | 94.21 | |
| PRK00080 | 328 | ruvB Holliday junction DNA helicase RuvB; Reviewed | 94.21 | |
| PF00448 | 196 | SRP54: SRP54-type protein, GTPase domain; InterPro | 94.15 | |
| PRK07414 | 178 | cob(I)yrinic acid a,c-diamide adenosyltransferase; | 94.14 | |
| PRK08084 | 235 | DNA replication initiation factor; Provisional | 94.06 | |
| cd00046 | 144 | DEXDc DEAD-like helicases superfamily. A diverse f | 94.02 | |
| TIGR00064 | 272 | ftsY signal recognition particle-docking protein F | 94.0 | |
| cd01124 | 187 | KaiC KaiC is a circadian clock protein primarily f | 93.99 | |
| PRK12724 | 432 | flagellar biosynthesis regulator FlhF; Provisional | 93.95 | |
| TIGR02538 | 564 | type_IV_pilB type IV-A pilus assembly ATPase PilB. | 93.88 | |
| PRK08181 | 269 | transposase; Validated | 93.81 | |
| PF05496 | 233 | RuvB_N: Holliday junction DNA helicase ruvB N-term | 93.79 | |
| PRK14494 | 229 | putative molybdopterin-guanine dinucleotide biosyn | 93.74 | |
| TIGR01448 | 720 | recD_rel helicase, putative, RecD/TraA family. Thi | 93.66 | |
| TIGR02524 | 358 | dot_icm_DotB Dot/Icm secretion system ATPase DotB. | 93.52 | |
| PRK12377 | 248 | putative replication protein; Provisional | 93.51 | |
| PRK07952 | 244 | DNA replication protein DnaC; Validated | 93.49 | |
| TIGR00041 | 195 | DTMP_kinase thymidylate kinase. Function: phosphor | 93.46 | |
| TIGR00595 | 505 | priA primosomal protein N'. All proteins in this f | 93.44 | |
| TIGR02533 | 486 | type_II_gspE general secretory pathway protein E. | 93.27 | |
| TIGR02655 | 484 | circ_KaiC circadian clock protein KaiC. Members of | 93.22 | |
| PRK08727 | 233 | hypothetical protein; Validated | 93.2 | |
| PRK09183 | 259 | transposase/IS protein; Provisional | 93.18 | |
| COG1618 | 179 | Predicted nucleotide kinase [Nucleotide transport | 93.16 | |
| PHA00547 | 337 | hypothetical protein | 93.12 | |
| COG1419 | 407 | FlhF Flagellar GTP-binding protein [Cell motility | 93.09 | |
| cd01983 | 99 | Fer4_NifH The Fer4_NifH superfamily contains a var | 93.06 | |
| PRK05580 | 679 | primosome assembly protein PriA; Validated | 93.05 | |
| PF02399 | 824 | Herpes_ori_bp: Origin of replication binding prote | 92.97 | |
| KOG0922|consensus | 674 | 92.94 | ||
| COG2804 | 500 | PulE Type II secretory pathway, ATPase PulE/Tfp pi | 92.91 | |
| PF02572 | 172 | CobA_CobO_BtuR: ATP:corrinoid adenosyltransferase | 92.87 | |
| PF03205 | 140 | MobB: Molybdopterin guanine dinucleotide synthesis | 92.86 | |
| PF13401 | 131 | AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S | 92.84 | |
| PRK13900 | 332 | type IV secretion system ATPase VirB11; Provisiona | 92.79 | |
| PRK06835 | 329 | DNA replication protein DnaC; Validated | 92.76 | |
| TIGR02788 | 308 | VirB11 P-type DNA transfer ATPase VirB11. The VirB | 92.6 | |
| PRK14087 | 450 | dnaA chromosomal replication initiation protein; P | 92.57 | |
| cd03112 | 158 | CobW_like The function of this protein family is u | 92.4 | |
| cd00046 | 144 | DEXDc DEAD-like helicases superfamily. A diverse f | 92.37 | |
| PF13086 | 236 | AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV | 92.36 | |
| PRK11823 | 446 | DNA repair protein RadA; Provisional | 92.35 | |
| PF12846 | 304 | AAA_10: AAA-like domain | 92.32 | |
| TIGR01447 | 586 | recD exodeoxyribonuclease V, alpha subunit. This f | 92.28 | |
| COG0467 | 260 | RAD55 RecA-superfamily ATPases implicated in signa | 92.25 | |
| cd01130 | 186 | VirB11-like_ATPase Type IV secretory pathway compo | 92.22 | |
| PF00488 | 235 | MutS_V: MutS domain V C-terminus.; InterPro: IPR00 | 92.15 | |
| TIGR01425 | 429 | SRP54_euk signal recognition particle protein SRP5 | 92.13 | |
| PF00308 | 219 | Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 | 92.07 | |
| PRK14723 | 767 | flhF flagellar biosynthesis regulator FlhF; Provis | 92.07 | |
| cd03114 | 148 | ArgK-like The function of this protein family is u | 92.06 | |
| cd03115 | 173 | SRP The signal recognition particle (SRP) mediates | 92.06 | |
| PF02492 | 178 | cobW: CobW/HypB/UreG, nucleotide-binding domain; I | 91.98 | |
| TIGR02782 | 299 | TrbB_P P-type conjugative transfer ATPase TrbB. Th | 91.89 | |
| COG2256 | 436 | MGS1 ATPase related to the helicase subunit of the | 91.76 | |
| COG0378 | 202 | HypB Ni2+-binding GTPase involved in regulation of | 91.73 | |
| TIGR01970 | 819 | DEAH_box_HrpB ATP-dependent helicase HrpB. This mo | 91.72 | |
| TIGR00416 | 454 | sms DNA repair protein RadA. The gene protuct code | 91.7 | |
| PRK10751 | 173 | molybdopterin-guanine dinucleotide biosynthesis pr | 91.61 | |
| TIGR02881 | 261 | spore_V_K stage V sporulation protein K. Members o | 91.6 | |
| TIGR00073 | 207 | hypB hydrogenase accessory protein HypB. HypB is i | 91.6 | |
| PRK04195 | 482 | replication factor C large subunit; Provisional | 91.56 | |
| PRK00889 | 175 | adenylylsulfate kinase; Provisional | 91.4 | |
| TIGR02768 | 744 | TraA_Ti Ti-type conjugative transfer relaxase TraA | 91.3 | |
| PRK05541 | 176 | adenylylsulfate kinase; Provisional | 91.28 | |
| PRK12422 | 445 | chromosomal replication initiation protein; Provis | 91.22 | |
| smart00487 | 201 | DEXDc DEAD-like helicases superfamily. | 91.13 | |
| PRK00698 | 205 | tmk thymidylate kinase; Validated | 91.09 | |
| PRK14738 | 206 | gmk guanylate kinase; Provisional | 90.88 | |
| PF00004 | 132 | AAA: ATPase family associated with various cellula | 90.86 | |
| cd01394 | 218 | radB RadB. The archaeal protein radB shares simila | 90.67 | |
| PRK09087 | 226 | hypothetical protein; Validated | 90.66 | |
| KOG0953|consensus | 700 | 90.6 | ||
| TIGR02237 | 209 | recomb_radB DNA repair and recombination protein R | 90.54 | |
| TIGR02760 | 1960 | TraI_TIGR conjugative transfer relaxase protein Tr | 90.5 | |
| PRK06893 | 229 | DNA replication initiation factor; Validated | 90.41 | |
| cd03243 | 202 | ABC_MutS_homologs The MutS protein initiates DNA m | 90.4 | |
| PF06745 | 226 | KaiC: KaiC; InterPro: IPR014774 This entry represe | 90.35 | |
| PHA02558 | 501 | uvsW UvsW helicase; Provisional | 90.33 | |
| PRK10490 | 895 | sensor protein KdpD; Provisional | 90.28 | |
| COG1484 | 254 | DnaC DNA replication protein [DNA replication, rec | 90.22 | |
| PF01695 | 178 | IstB_IS21: IstB-like ATP binding protein; InterPro | 90.2 | |
| PRK07414 | 178 | cob(I)yrinic acid a,c-diamide adenosyltransferase; | 90.17 | |
| PRK08939 | 306 | primosomal protein DnaI; Reviewed | 90.14 | |
| PRK05642 | 234 | DNA replication initiation factor; Validated | 90.13 | |
| TIGR03574 | 249 | selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal. Mem | 90.07 | |
| COG1373 | 398 | Predicted ATPase (AAA+ superfamily) [General funct | 90.01 | |
| PRK09361 | 225 | radB DNA repair and recombination protein RadB; Pr | 90.0 | |
| KOG0923|consensus | 902 | 89.91 | ||
| PF13207 | 121 | AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6 | 89.9 | |
| cd00544 | 169 | CobU Adenosylcobinamide kinase / adenosylcobinamid | 89.87 | |
| TIGR02880 | 284 | cbbX_cfxQ probable Rubsico expression protein CbbX | 89.87 | |
| PRK00091 | 307 | miaA tRNA delta(2)-isopentenylpyrophosphate transf | 89.81 | |
| cd03284 | 216 | ABC_MutS1 MutS1 homolog in eukaryotes. The MutS pr | 89.78 | |
| cd03281 | 213 | ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS | 89.77 | |
| KOG1533|consensus | 290 | 89.76 | ||
| COG1198 | 730 | PriA Primosomal protein N' (replication factor Y) | 89.64 | |
| PRK14491 | 597 | putative bifunctional molybdopterin-guanine dinucl | 89.64 | |
| cd02019 | 69 | NK Nucleoside/nucleotide kinase (NK) is a protein | 89.54 | |
| PRK13833 | 323 | conjugal transfer protein TrbB; Provisional | 89.49 | |
| cd00268 | 203 | DEADc DEAD-box helicases. A diverse family of prot | 89.47 | |
| PRK13764 | 602 | ATPase; Provisional | 89.41 | |
| PRK13342 | 413 | recombination factor protein RarA; Reviewed | 89.35 | |
| cd00984 | 242 | DnaB_C DnaB helicase C terminal domain. The hexame | 89.2 | |
| TIGR02928 | 365 | orc1/cdc6 family replication initiation protein. M | 89.11 | |
| PRK01184 | 184 | hypothetical protein; Provisional | 89.09 | |
| TIGR01070 | 840 | mutS1 DNA mismatch repair protein MutS. | 89.08 | |
| PRK09435 | 332 | membrane ATPase/protein kinase; Provisional | 88.95 | |
| cd00009 | 151 | AAA The AAA+ (ATPases Associated with a wide varie | 88.84 | |
| PRK10078 | 186 | ribose 1,5-bisphosphokinase; Provisional | 88.79 | |
| PRK05399 | 854 | DNA mismatch repair protein MutS; Provisional | 88.77 | |
| PF05970 | 364 | PIF1: PIF1-like helicase; InterPro: IPR010285 This | 88.7 | |
| smart00534 | 185 | MUTSac ATPase domain of DNA mismatch repair MUTS f | 88.62 | |
| PRK13826 | 1102 | Dtr system oriT relaxase; Provisional | 88.59 | |
| PF13555 | 62 | AAA_29: P-loop containing region of AAA domain | 88.56 | |
| TIGR03877 | 237 | thermo_KaiC_1 KaiC domain protein, Ph0284 family. | 88.56 | |
| COG4098 | 441 | comFA Superfamily II DNA/RNA helicase required for | 88.54 | |
| cd03287 | 222 | ABC_MSH3_euk MutS3 homolog in eukaryotes. The MutS | 88.45 | |
| PF00580 | 315 | UvrD-helicase: UvrD/REP helicase N-terminal domain | 88.43 | |
| cd03109 | 134 | DTBS Dethiobiotin synthetase (DTBS) is the penulti | 88.07 | |
| PRK13894 | 319 | conjugal transfer ATPase TrbB; Provisional | 87.98 | |
| PRK13889 | 988 | conjugal transfer relaxase TraA; Provisional | 87.96 | |
| TIGR02012 | 321 | tigrfam_recA protein RecA. This model describes or | 87.87 | |
| TIGR03881 | 229 | KaiC_arch_4 KaiC domain protein, PAE1156 family. M | 87.76 | |
| TIGR03420 | 226 | DnaA_homol_Hda DnaA regulatory inactivator Hda. Me | 87.7 | |
| PRK12402 | 337 | replication factor C small subunit 2; Reviewed | 87.64 | |
| PRK09519 | 790 | recA DNA recombination protein RecA; Reviewed | 87.61 | |
| smart00072 | 184 | GuKc Guanylate kinase homologues. Active enzymes c | 87.58 | |
| COG0194 | 191 | Gmk Guanylate kinase [Nucleotide transport and met | 87.57 | |
| TIGR02322 | 179 | phosphon_PhnN phosphonate metabolism protein/1,5-b | 87.52 | |
| cd00071 | 137 | GMPK Guanosine monophosphate kinase (GMPK, EC 2.7. | 87.41 | |
| PRK03839 | 180 | putative kinase; Provisional | 87.23 | |
| PRK13851 | 344 | type IV secretion system protein VirB11; Provision | 87.18 | |
| cd03227 | 162 | ABC_Class2 ABC-type Class 2 contains systems invol | 86.99 | |
| COG0703 | 172 | AroK Shikimate kinase [Amino acid transport and me | 86.98 | |
| TIGR02760 | 1960 | TraI_TIGR conjugative transfer relaxase protein Tr | 86.93 | |
| cd03286 | 218 | ABC_MSH6_euk MutS6 homolog in eukaryotes. The MutS | 86.85 | |
| cd00983 | 325 | recA RecA is a bacterial enzyme which has roles in | 86.84 | |
| CHL00181 | 287 | cbbX CbbX; Provisional | 86.81 | |
| PTZ00424 | 401 | helicase 45; Provisional | 86.73 | |
| cd01122 | 271 | GP4d_helicase GP4d_helicase is a homohexameric 5'- | 86.7 | |
| COG1763 | 161 | MobB Molybdopterin-guanine dinucleotide biosynthes | 86.68 | |
| PRK13768 | 253 | GTPase; Provisional | 86.63 | |
| smart00382 | 148 | AAA ATPases associated with a variety of cellular | 86.63 | |
| PRK10917 | 681 | ATP-dependent DNA helicase RecG; Provisional | 86.58 | |
| PF13481 | 193 | AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C. | 86.52 | |
| PRK14532 | 188 | adenylate kinase; Provisional | 86.52 | |
| TIGR03878 | 259 | thermo_KaiC_2 KaiC domain protein, AF_0795 family. | 86.51 | |
| PRK05580 | 679 | primosome assembly protein PriA; Validated | 86.5 | |
| COG1643 | 845 | HrpA HrpA-like helicases [DNA replication, recombi | 86.16 | |
| PRK00149 | 450 | dnaA chromosomal replication initiation protein; R | 86.07 | |
| PRK08903 | 227 | DnaA regulatory inactivator Hda; Validated | 85.99 | |
| PRK14962 | 472 | DNA polymerase III subunits gamma and tau; Provisi | 85.99 | |
| PRK08533 | 230 | flagellar accessory protein FlaH; Reviewed | 85.98 | |
| cd03116 | 159 | MobB Molybdenum is an essential trace element in t | 85.97 | |
| PRK09354 | 349 | recA recombinase A; Provisional | 85.96 | |
| PRK07933 | 213 | thymidylate kinase; Validated | 85.91 | |
| PF03029 | 238 | ATP_bind_1: Conserved hypothetical ATP binding pro | 85.81 | |
| PRK11664 | 812 | ATP-dependent RNA helicase HrpB; Provisional | 85.69 | |
| TIGR00362 | 405 | DnaA chromosomal replication initiator protein Dna | 85.59 | |
| PF00625 | 183 | Guanylate_kin: Guanylate kinase; InterPro: IPR0081 | 85.56 | |
| cd03280 | 200 | ABC_MutS2 MutS2 homologs in bacteria and eukaryote | 85.54 | |
| TIGR00376 | 637 | DNA helicase, putative. The gene product may repre | 85.43 | |
| COG2109 | 198 | BtuR ATP:corrinoid adenosyltransferase [Coenzyme m | 85.38 | |
| PRK14495 | 452 | putative molybdopterin-guanine dinucleotide biosyn | 85.32 | |
| COG0249 | 843 | MutS Mismatch repair ATPase (MutS family) [DNA rep | 85.18 | |
| PRK10867 | 433 | signal recognition particle protein; Provisional | 85.13 | |
| TIGR01448 | 720 | recD_rel helicase, putative, RecD/TraA family. Thi | 85.13 | |
| PF10412 | 386 | TrwB_AAD_bind: Type IV secretion-system coupling p | 85.06 | |
| PLN02840 | 421 | tRNA dimethylallyltransferase | 84.98 | |
| cd02021 | 150 | GntK Gluconate kinase (GntK) catalyzes the phospho | 84.97 | |
| PRK13938 | 196 | phosphoheptose isomerase; Provisional | 84.91 | |
| COG0630 | 312 | VirB11 Type IV secretory pathway, VirB11 component | 84.85 | |
| PF03266 | 168 | NTPase_1: NTPase; InterPro: IPR004948 This entry r | 84.84 | |
| PRK00440 | 319 | rfc replication factor C small subunit; Reviewed | 84.83 | |
| KOG0924|consensus | 1042 | 84.81 | ||
| PRK04328 | 249 | hypothetical protein; Provisional | 84.79 | |
| PF00154 | 322 | RecA: recA bacterial DNA recombination protein; In | 84.74 | |
| PRK13695 | 174 | putative NTPase; Provisional | 84.74 | |
| PHA00729 | 226 | NTP-binding motif containing protein | 84.72 | |
| PF00270 | 169 | DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 | 84.5 | |
| TIGR03880 | 224 | KaiC_arch_3 KaiC domain protein, AF_0351 family. T | 84.46 | |
| PRK14489 | 366 | putative bifunctional molybdopterin-guanine dinucl | 84.34 | |
| PLN03025 | 319 | replication factor C subunit; Provisional | 84.26 | |
| PRK14493 | 274 | putative bifunctional molybdopterin-guanine dinucl | 84.16 | |
| TIGR00174 | 287 | miaA tRNA isopentenyltransferase (miaA). Catalyzes | 84.12 | |
| PF05707 | 193 | Zot: Zonular occludens toxin (Zot); InterPro: IPR0 | 84.0 | |
| PRK14964 | 491 | DNA polymerase III subunits gamma and tau; Provisi | 83.8 | |
| PRK06921 | 266 | hypothetical protein; Provisional | 83.79 | |
| PRK05800 | 170 | cobU adenosylcobinamide kinase/adenosylcobinamide- | 83.77 | |
| PRK14949 | 944 | DNA polymerase III subunits gamma and tau; Provisi | 83.74 | |
| TIGR01359 | 183 | UMP_CMP_kin_fam UMP-CMP kinase family. This subfam | 83.72 | |
| PRK13709 | 1747 | conjugal transfer nickase/helicase TraI; Provision | 83.66 | |
| TIGR00767 | 415 | rho transcription termination factor Rho. Members | 83.55 | |
| PRK10875 | 615 | recD exonuclease V subunit alpha; Provisional | 83.45 | |
| PHA00350 | 399 | putative assembly protein | 83.43 | |
| COG3972 | 660 | Superfamily I DNA and RNA helicases [General funct | 83.3 | |
| PRK07413 | 382 | hypothetical protein; Validated | 83.16 | |
| PRK11131 | 1294 | ATP-dependent RNA helicase HrpA; Provisional | 83.04 | |
| PF02702 | 211 | KdpD: Osmosensitive K+ channel His kinase sensor d | 82.91 | |
| COG1126 | 240 | GlnQ ABC-type polar amino acid transport system, A | 82.9 | |
| COG2255 | 332 | RuvB Holliday junction resolvasome, helicase subun | 82.86 | |
| PRK14712 | 1623 | conjugal transfer nickase/helicase TraI; Provision | 82.82 | |
| cd01393 | 226 | recA_like RecA is a bacterial enzyme which has rol | 82.67 | |
| TIGR02858 | 270 | spore_III_AA stage III sporulation protein AA. Mem | 82.67 | |
| PRK14961 | 363 | DNA polymerase III subunits gamma and tau; Provisi | 82.65 | |
| PRK13973 | 213 | thymidylate kinase; Provisional | 82.57 | |
| TIGR00750 | 300 | lao LAO/AO transport system ATPase. Mutations have | 82.57 | |
| TIGR03575 | 340 | selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryoti | 82.56 | |
| PF13671 | 143 | AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1 | 82.33 | |
| PF13238 | 129 | AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB | 82.19 | |
| PF00005 | 137 | ABC_tran: ABC transporter This structure is on hol | 82.18 | |
| cd03279 | 213 | ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex | 82.17 | |
| PRK14530 | 215 | adenylate kinase; Provisional | 82.09 | |
| PF04851 | 184 | ResIII: Type III restriction enzyme, res subunit; | 82.05 | |
| cd00227 | 175 | CPT Chloramphenicol (Cm) phosphotransferase (CPT). | 82.0 | |
| PRK14956 | 484 | DNA polymerase III subunits gamma and tau; Provisi | 81.98 | |
| PF05729 | 166 | NACHT: NACHT domain | 81.93 | |
| PRK06217 | 183 | hypothetical protein; Validated | 81.92 | |
| TIGR01360 | 188 | aden_kin_iso1 adenylate kinase, isozyme 1 subfamil | 81.76 | |
| PRK14088 | 440 | dnaA chromosomal replication initiation protein; P | 81.62 | |
| cd01127 | 410 | TrwB Bacterial conjugation protein TrwB, ATP bindi | 81.61 | |
| TIGR00176 | 155 | mobB molybdopterin-guanine dinucleotide biosynthes | 81.45 | |
| PRK10744 | 260 | pstB phosphate transporter ATP-binding protein; Pr | 81.4 | |
| PRK14737 | 186 | gmk guanylate kinase; Provisional | 81.36 | |
| COG1120 | 258 | FepC ABC-type cobalamin/Fe3+-siderophores transpor | 81.13 | |
| PRK00625 | 173 | shikimate kinase; Provisional | 81.08 | |
| cd03238 | 176 | ABC_UvrA The excision repair protein UvrA; Nucleot | 81.05 | |
| PRK14721 | 420 | flhF flagellar biosynthesis regulator FlhF; Provis | 81.04 | |
| COG4098 | 441 | comFA Superfamily II DNA/RNA helicase required for | 81.03 | |
| PTZ00088 | 229 | adenylate kinase 1; Provisional | 80.96 | |
| PF02223 | 186 | Thymidylate_kin: Thymidylate kinase; InterPro: IPR | 80.93 | |
| TIGR00347 | 166 | bioD dethiobiotin synthase. Dethiobiotin synthase | 80.9 | |
| PRK14086 | 617 | dnaA chromosomal replication initiation protein; P | 80.85 | |
| PHA02653 | 675 | RNA helicase NPH-II; Provisional | 80.8 | |
| PRK14273 | 254 | phosphate ABC transporter ATP-binding protein; Pro | 80.7 | |
| PRK08116 | 268 | hypothetical protein; Validated | 80.63 | |
| PF03796 | 259 | DnaB_C: DnaB-like helicase C terminal domain; Inte | 80.55 | |
| PRK14494 | 229 | putative molybdopterin-guanine dinucleotide biosyn | 80.55 | |
| KOG0926|consensus | 1172 | 80.48 | ||
| PF02562 | 205 | PhoH: PhoH-like protein; InterPro: IPR003714 PhoH | 80.44 | |
| TIGR03263 | 180 | guanyl_kin guanylate kinase. Members of this famil | 80.35 | |
| PF04665 | 241 | Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 | 80.32 | |
| TIGR01967 | 1283 | DEAH_box_HrpA ATP-dependent helicase HrpA. This mo | 80.32 | |
| PF00580 | 315 | UvrD-helicase: UvrD/REP helicase N-terminal domain | 80.19 | |
| COG1136 | 226 | SalX ABC-type antimicrobial peptide transport syst | 80.17 | |
| PHA02544 | 316 | 44 clamp loader, small subunit; Provisional | 80.16 | |
| TIGR03819 | 340 | heli_sec_ATPase helicase/secretion neighborhood AT | 80.15 | |
| TIGR00959 | 428 | ffh signal recognition particle protein. This mode | 80.1 |
| >PTZ00293 thymidine kinase; Provisional | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.5e-50 Score=372.35 Aligned_cols=141 Identities=51% Similarity=0.898 Sum_probs=135.0
Q ss_pred CCchHHHHHHHHHHHHHcCceEEEEeeccCCCC-CCCceeeccCCceeeeecCChhhhcccCCCccEEEEccccChHHHH
Q psy8456 10 INPYIVHFCRRIRRYQYANYRCMIVRYAKDDRY-DTEKVATHDQQKLTAVSAVELNKLIPHTKDIDVIGIDEGQFFPDVV 88 (353)
Q Consensus 10 ~~GKSteLLrr~~ry~~agkkvlv~Kp~iDtRy-~~~~I~Sr~G~~~~Ai~i~~l~ei~~~~~~~dvV~IDEaQFF~dIv 88 (353)
-||||||||++++||.++|+++++|||++|||| +.+.|+||+|+.++|+.++++.++.....++|||+|||||||++|+
T Consensus 14 fSGKTteLLr~i~~y~~ag~kv~~~kp~~DtR~~~~~~I~Sh~g~~~~a~~v~~~~e~~~~~~~~dvI~IDEaQFf~~i~ 93 (211)
T PTZ00293 14 FSGKTTELMRLVKRFTYSEKKCVVIKYSKDTRYSDEQNISSHDKQMLKAIKVSKLKEVLETAKNYDVIAIDEGQFFPDLV 93 (211)
T ss_pred CChHHHHHHHHHHHHHHcCCceEEEEecccccCCCCCcEEecCCCcceeEEcCCHHHHHHhccCCCEEEEEchHhhHhHH
Confidence 489999999999999999999999999999999 7788999999999999999998887656789999999999999999
Q ss_pred HHHHHHHhCCCEEEEEecccccccCCchhHhhhhccccceEeccceeccccccccccccccc
Q psy8456 89 SFAESMANAGKIVVVAALDGTFQRTGFNDILSLIPLAECVEKLTAVCMSCFRDAAFTKRIGQ 150 (353)
Q Consensus 89 ~l~~~l~~~G~~VivaGLd~DFr~~pF~~~~~Ll~lAD~I~kL~AvC~~CG~~A~f~~Ri~g 150 (353)
++++.+++.|++|||||||+||+++||+++++||++||+|+||+|+|++||++|+||+|+++
T Consensus 94 ~~~~~l~~~g~~VivaGLd~Df~~~~F~~~~~Ll~~AD~V~kl~aiC~~CG~~A~~t~R~~~ 155 (211)
T PTZ00293 94 EFSEAAANLGKIVIVAALDGTFQRKPFGQILNLIPLAERVTKLTAVCMFCGKEASFSKRIVQ 155 (211)
T ss_pred HHHHHHHHCCCeEEEEecCcccccCcCccHHHHHHhhCEEEEcceEchhhCCcceeEEEEcC
Confidence 99999999999999999999999999999999999999999999999999999999999754
|
|
| >PF00265 TK: Thymidine kinase; InterPro: IPR001267 Thymidine kinase (TK) (2 | Back alignment and domain information |
|---|
| >PTZ00293 thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >COG1435 Tdk Thymidine kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PF00265 TK: Thymidine kinase; InterPro: IPR001267 Thymidine kinase (TK) (2 | Back alignment and domain information |
|---|
| >COG1435 Tdk Thymidine kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >KOG3125|consensus | Back alignment and domain information |
|---|
| >KOG3125|consensus | Back alignment and domain information |
|---|
| >PRK04296 thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >PRK04296 thymidine kinase; Provisional | Back alignment and domain information |
|---|
| >PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A | Back alignment and domain information |
|---|
| >PF13173 AAA_14: AAA domain | Back alignment and domain information |
|---|
| >PRK07413 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >cd01121 Sms Sms (bacterial radA) DNA repair protein | Back alignment and domain information |
|---|
| >PF13604 AAA_30: AAA domain; PDB: 1W36_G 3K70_G 3UPU_B 3GPL_A 3E1S_A 3GP8_A | Back alignment and domain information |
|---|
| >cd01120 RecA-like_NTPases RecA-like NTPases | Back alignment and domain information |
|---|
| >PF05707 Zot: Zonular occludens toxin (Zot); InterPro: IPR008900 This entry consists of bacterial and viral proteins which are very similar to the Zonular occludens toxin (Zot) | Back alignment and domain information |
|---|
| >PRK08084 DNA replication initiation factor; Provisional | Back alignment and domain information |
|---|
| >PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases | Back alignment and domain information |
|---|
| >PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication | Back alignment and domain information |
|---|
| >PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain | Back alignment and domain information |
|---|
| >PF07652 Flavi_DEAD: Flavivirus DEAD domain ; InterPro: IPR011492 This is the Flavivirus DEAD domain | Back alignment and domain information |
|---|
| >PRK11823 DNA repair protein RadA; Provisional | Back alignment and domain information |
|---|
| >cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs | Back alignment and domain information |
|---|
| >TIGR00416 sms DNA repair protein RadA | Back alignment and domain information |
|---|
| >PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B | Back alignment and domain information |
|---|
| >PRK08727 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK14087 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein | Back alignment and domain information |
|---|
| >PRK05642 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >PRK06893 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >smart00487 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP | Back alignment and domain information |
|---|
| >PRK12422 chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PRK14086 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] | Back alignment and domain information |
|---|
| >TIGR00708 cobA cob(I)alamin adenosyltransferase | Back alignment and domain information |
|---|
| >COG1373 Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >TIGR00708 cobA cob(I)alamin adenosyltransferase | Back alignment and domain information |
|---|
| >PRK05703 flhF flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >PF13245 AAA_19: Part of AAA domain | Back alignment and domain information |
|---|
| >PRK00149 dnaA chromosomal replication initiation protein; Reviewed | Back alignment and domain information |
|---|
| >TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda | Back alignment and domain information |
|---|
| >cd01131 PilT Pilus retraction ATPase PilT | Back alignment and domain information |
|---|
| >PRK12723 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >COG1066 Sms Predicted ATP-dependent serine protease [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB | Back alignment and domain information |
|---|
| >TIGR00362 DnaA chromosomal replication initiator protein DnaA | Back alignment and domain information |
|---|
| >PRK06526 transposase; Provisional | Back alignment and domain information |
|---|
| >PRK08903 DnaA regulatory inactivator Hda; Validated | Back alignment and domain information |
|---|
| >cd01120 RecA-like_NTPases RecA-like NTPases | Back alignment and domain information |
|---|
| >PF00437 T2SE: Type II/IV secretion system protein; InterPro: IPR001482 A number of bacterial proteins, some of which are involved in a general secretion pathway (GSP) for the export of proteins (also called the type II pathway) belong to this group [, ] | Back alignment and domain information |
|---|
| >TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA | Back alignment and domain information |
|---|
| >PRK05973 replicative DNA helicase; Provisional | Back alignment and domain information |
|---|
| >cd01129 PulE-GspE PulE/GspE The type II secretory pathway is the main terminal branch of the general secretory pathway (GSP) | Back alignment and domain information |
|---|
| >TIGR01618 phage_P_loop phage nucleotide-binding protein | Back alignment and domain information |
|---|
| >TIGR02525 plasmid_TraJ plasmid transfer ATPase TraJ | Back alignment and domain information |
|---|
| >TIGR03499 FlhF flagellar biosynthetic protein FlhF | Back alignment and domain information |
|---|
| >cd01121 Sms Sms (bacterial radA) DNA repair protein | Back alignment and domain information |
|---|
| >PF13173 AAA_14: AAA domain | Back alignment and domain information |
|---|
| >PF02702 KdpD: Osmosensitive K+ channel His kinase sensor domain; InterPro: IPR003852 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions [] | Back alignment and domain information |
|---|
| >TIGR00595 priA primosomal protein N' | Back alignment and domain information |
|---|
| >PRK08116 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PHA00350 putative assembly protein | Back alignment and domain information |
|---|
| >cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP | Back alignment and domain information |
|---|
| >PRK06921 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG0593 DnaA ATPase involved in DNA replication initiation [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK14974 cell division protein FtsY; Provisional | Back alignment and domain information |
|---|
| >PRK06620 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] | Back alignment and domain information |
|---|
| >TIGR01420 pilT_fam pilus retraction protein PilT | Back alignment and domain information |
|---|
| >COG0552 FtsY Signal recognition particle GTPase [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PRK11889 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >cd03283 ABC_MutS-like MutS-like homolog in eukaryotes | Back alignment and domain information |
|---|
| >PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK06067 flagellar accessory protein FlaH; Validated | Back alignment and domain information |
|---|
| >PRK14722 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK12727 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >PRK10436 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK13889 conjugal transfer relaxase TraA; Provisional | Back alignment and domain information |
|---|
| >TIGR00635 ruvB Holliday junction DNA helicase, RuvB subunit | Back alignment and domain information |
|---|
| >PF02572 CobA_CobO_BtuR: ATP:corrinoid adenosyltransferase BtuR/CobO/CobP; InterPro: IPR003724 ATP:cob(I)alamin (or ATP:corrinoid) adenosyltransferases (2 | Back alignment and domain information |
|---|
| >PRK14088 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PF09848 DUF2075: Uncharacterized conserved protein (DUF2075); InterPro: IPR018647 This domain, found in putative ATP/GTP binding proteins, has no known function | Back alignment and domain information |
|---|
| >COG3854 SpoIIIAA ncharacterized protein conserved in bacteria [Function unknown] | Back alignment and domain information |
|---|
| >PRK12726 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >COG1763 MobB Molybdopterin-guanine dinucleotide biosynthesis protein [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK00411 cdc6 cell division control protein 6; Reviewed | Back alignment and domain information |
|---|
| >PRK10416 signal recognition particle-docking protein FtsY; Provisional | Back alignment and domain information |
|---|
| >PF13479 AAA_24: AAA domain | Back alignment and domain information |
|---|
| >PF01443 Viral_helicase1: Viral (Superfamily 1) RNA helicase; InterPro: IPR000606 This entry includes RNA and DNA helicases | Back alignment and domain information |
|---|
| >PRK13695 putative NTPase; Provisional | Back alignment and domain information |
|---|
| >cd03282 ABC_MSH4_euk MutS4 homolog in eukaryotes | Back alignment and domain information |
|---|
| >PRK10536 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK05986 cob(I)alamin adenolsyltransferase/cobinamide ATP-dependent adenolsyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK00771 signal recognition particle protein Srp54; Provisional | Back alignment and domain information |
|---|
| >TIGR03015 pepcterm_ATPase putative secretion ATPase, PEP-CTERM locus subfamily | Back alignment and domain information |
|---|
| >cd01672 TMPK Thymidine monophosphate kinase (TMPK), also known as thymidylate kinase, catalyzes the phosphorylation of thymidine monophosphate (TMP) to thymidine diphosphate (TDP) utilizing ATP as its preferred phophoryl donor | Back alignment and domain information |
|---|
| >PRK13826 Dtr system oriT relaxase; Provisional | Back alignment and domain information |
|---|
| >PHA00012 I assembly protein | Back alignment and domain information |
|---|
| >PRK00080 ruvB Holliday junction DNA helicase RuvB; Reviewed | Back alignment and domain information |
|---|
| >PF00448 SRP54: SRP54-type protein, GTPase domain; InterPro: IPR000897 The signal recognition particle (SRP) is a multimeric protein, which along with its conjugate receptor (SR), is involved in targeting secretory proteins to the rough endoplasmic reticulum (RER) membrane in eukaryotes, or to the plasma membrane in prokaryotes [, ] | Back alignment and domain information |
|---|
| >PRK07414 cob(I)yrinic acid a,c-diamide adenosyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK08084 DNA replication initiation factor; Provisional | Back alignment and domain information |
|---|
| >cd00046 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >TIGR00064 ftsY signal recognition particle-docking protein FtsY | Back alignment and domain information |
|---|
| >cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs | Back alignment and domain information |
|---|
| >PRK12724 flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >TIGR02538 type_IV_pilB type IV-A pilus assembly ATPase PilB | Back alignment and domain information |
|---|
| >PRK08181 transposase; Validated | Back alignment and domain information |
|---|
| >PF05496 RuvB_N: Holliday junction DNA helicase ruvB N-terminus; InterPro: IPR008824 The RuvB protein makes up part of the RuvABC revolvasome which catalyses the resolution of Holliday junctions that arise during genetic recombination and DNA repair | Back alignment and domain information |
|---|
| >PRK14494 putative molybdopterin-guanine dinucleotide biosynthesis protein MobB/FeS domain-containing protein protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01448 recD_rel helicase, putative, RecD/TraA family | Back alignment and domain information |
|---|
| >TIGR02524 dot_icm_DotB Dot/Icm secretion system ATPase DotB | Back alignment and domain information |
|---|
| >PRK12377 putative replication protein; Provisional | Back alignment and domain information |
|---|
| >PRK07952 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >TIGR00041 DTMP_kinase thymidylate kinase | Back alignment and domain information |
|---|
| >TIGR00595 priA primosomal protein N' | Back alignment and domain information |
|---|
| >TIGR02533 type_II_gspE general secretory pathway protein E | Back alignment and domain information |
|---|
| >TIGR02655 circ_KaiC circadian clock protein KaiC | Back alignment and domain information |
|---|
| >PRK08727 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK09183 transposase/IS protein; Provisional | Back alignment and domain information |
|---|
| >COG1618 Predicted nucleotide kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PHA00547 hypothetical protein | Back alignment and domain information |
|---|
| >COG1419 FlhF Flagellar GTP-binding protein [Cell motility and secretion] | Back alignment and domain information |
|---|
| >cd01983 Fer4_NifH The Fer4_NifH superfamily contains a variety of proteins which share a common ATP-binding domain | Back alignment and domain information |
|---|
| >PRK05580 primosome assembly protein PriA; Validated | Back alignment and domain information |
|---|
| >PF02399 Herpes_ori_bp: Origin of replication binding protein; InterPro: IPR003450 This entry represents replication origin binding protein | Back alignment and domain information |
|---|
| >KOG0922|consensus | Back alignment and domain information |
|---|
| >COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PF02572 CobA_CobO_BtuR: ATP:corrinoid adenosyltransferase BtuR/CobO/CobP; InterPro: IPR003724 ATP:cob(I)alamin (or ATP:corrinoid) adenosyltransferases (2 | Back alignment and domain information |
|---|
| >PF03205 MobB: Molybdopterin guanine dinucleotide synthesis protein B; PDB: 2F1R_B 1P9N_A 1NP6_B 2NPI_A 1XJC_A | Back alignment and domain information |
|---|
| >PF13401 AAA_22: AAA domain; PDB: 2QBY_B 1FNN_B 1W5T_A 1W5S_B | Back alignment and domain information |
|---|
| >PRK13900 type IV secretion system ATPase VirB11; Provisional | Back alignment and domain information |
|---|
| >PRK06835 DNA replication protein DnaC; Validated | Back alignment and domain information |
|---|
| >TIGR02788 VirB11 P-type DNA transfer ATPase VirB11 | Back alignment and domain information |
|---|
| >PRK14087 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >cd03112 CobW_like The function of this protein family is unkown | Back alignment and domain information |
|---|
| >cd00046 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >PF13086 AAA_11: AAA domain; PDB: 2XZL_A 2XZO_A 2WJY_A 2WJV_A 2XZP_A 2GK6_A 2GK7_A 2GJK_A | Back alignment and domain information |
|---|
| >PRK11823 DNA repair protein RadA; Provisional | Back alignment and domain information |
|---|
| >PF12846 AAA_10: AAA-like domain | Back alignment and domain information |
|---|
| >TIGR01447 recD exodeoxyribonuclease V, alpha subunit | Back alignment and domain information |
|---|
| >COG0467 RAD55 RecA-superfamily ATPases implicated in signal transduction [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd01130 VirB11-like_ATPase Type IV secretory pathway component VirB11, and related ATPases | Back alignment and domain information |
|---|
| >PF00488 MutS_V: MutS domain V C-terminus | Back alignment and domain information |
|---|
| >TIGR01425 SRP54_euk signal recognition particle protein SRP54 | Back alignment and domain information |
|---|
| >PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication | Back alignment and domain information |
|---|
| >PRK14723 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >cd03114 ArgK-like The function of this protein family is unkown | Back alignment and domain information |
|---|
| >cd03115 SRP The signal recognition particle (SRP) mediates the transport to or across the plasma membrane in bacteria and the endoplasmic reticulum in eukaryotes | Back alignment and domain information |
|---|
| >PF02492 cobW: CobW/HypB/UreG, nucleotide-binding domain; InterPro: IPR003495 Cobalamin (vitamin B12) is a structurally complex cofactor, consisting of a modified tetrapyrrole with a centrally chelated cobalt | Back alignment and domain information |
|---|
| >TIGR02782 TrbB_P P-type conjugative transfer ATPase TrbB | Back alignment and domain information |
|---|
| >COG2256 MGS1 ATPase related to the helicase subunit of the Holliday junction resolvase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >COG0378 HypB Ni2+-binding GTPase involved in regulation of expression and maturation of urease and hydrogenase [Posttranslational modification, protein turnover, chaperones / Transcription] | Back alignment and domain information |
|---|
| >TIGR01970 DEAH_box_HrpB ATP-dependent helicase HrpB | Back alignment and domain information |
|---|
| >TIGR00416 sms DNA repair protein RadA | Back alignment and domain information |
|---|
| >PRK10751 molybdopterin-guanine dinucleotide biosynthesis protein B; Provisional | Back alignment and domain information |
|---|
| >TIGR02881 spore_V_K stage V sporulation protein K | Back alignment and domain information |
|---|
| >TIGR00073 hypB hydrogenase accessory protein HypB | Back alignment and domain information |
|---|
| >PRK04195 replication factor C large subunit; Provisional | Back alignment and domain information |
|---|
| >PRK00889 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR02768 TraA_Ti Ti-type conjugative transfer relaxase TraA | Back alignment and domain information |
|---|
| >PRK05541 adenylylsulfate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK12422 chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >smart00487 DEXDc DEAD-like helicases superfamily | Back alignment and domain information |
|---|
| >PRK00698 tmk thymidylate kinase; Validated | Back alignment and domain information |
|---|
| >PRK14738 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >PF00004 AAA: ATPase family associated with various cellular activities (AAA); InterPro: IPR003959 AAA ATPases (ATPases Associated with diverse cellular Activities) form a large protein family and play a number of roles in the cell including cell-cycle regulation, protein proteolysis and disaggregation, organelle biogenesis and intracellular transport | Back alignment and domain information |
|---|
| >cd01394 radB RadB | Back alignment and domain information |
|---|
| >PRK09087 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >KOG0953|consensus | Back alignment and domain information |
|---|
| >TIGR02237 recomb_radB DNA repair and recombination protein RadB | Back alignment and domain information |
|---|
| >TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI | Back alignment and domain information |
|---|
| >PRK06893 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch | Back alignment and domain information |
|---|
| >PF06745 KaiC: KaiC; InterPro: IPR014774 This entry represents a domain within bacterial and archaeal proteins, most of which are hypothetical | Back alignment and domain information |
|---|
| >PHA02558 uvsW UvsW helicase; Provisional | Back alignment and domain information |
|---|
| >PRK10490 sensor protein KdpD; Provisional | Back alignment and domain information |
|---|
| >COG1484 DnaC DNA replication protein [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PF01695 IstB_IS21: IstB-like ATP binding protein; InterPro: IPR002611 Proteins in this entry contain an ATP/GTP binding P-loop motif | Back alignment and domain information |
|---|
| >PRK07414 cob(I)yrinic acid a,c-diamide adenosyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK08939 primosomal protein DnaI; Reviewed | Back alignment and domain information |
|---|
| >PRK05642 DNA replication initiation factor; Validated | Back alignment and domain information |
|---|
| >TIGR03574 selen_PSTK L-seryl-tRNA(Sec) kinase, archaeal | Back alignment and domain information |
|---|
| >COG1373 Predicted ATPase (AAA+ superfamily) [General function prediction only] | Back alignment and domain information |
|---|
| >PRK09361 radB DNA repair and recombination protein RadB; Provisional | Back alignment and domain information |
|---|
| >KOG0923|consensus | Back alignment and domain information |
|---|
| >PF13207 AAA_17: AAA domain; PDB: 3AKC_A 3AKE_A 3AKD_A 2QL6_G 2QT1_A 2QSZ_A 2QSY_A 2QT0_A 2QG6_A 2P0E_A | Back alignment and domain information |
|---|
| >cd00544 CobU Adenosylcobinamide kinase / adenosylcobinamide phosphate guanyltransferase (CobU) | Back alignment and domain information |
|---|
| >TIGR02880 cbbX_cfxQ probable Rubsico expression protein CbbX | Back alignment and domain information |
|---|
| >PRK00091 miaA tRNA delta(2)-isopentenylpyrophosphate transferase; Reviewed | Back alignment and domain information |
|---|
| >cd03284 ABC_MutS1 MutS1 homolog in eukaryotes | Back alignment and domain information |
|---|
| >cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes | Back alignment and domain information |
|---|
| >KOG1533|consensus | Back alignment and domain information |
|---|
| >COG1198 PriA Primosomal protein N' (replication factor Y) - superfamily II helicase [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK14491 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MoeA; Provisional | Back alignment and domain information |
|---|
| >cd02019 NK Nucleoside/nucleotide kinase (NK) is a protein superfamily consisting of multiple families of enzymes that share structural similarity and are functionally related to the catalysis of the reversible phosphate group transfer from nucleoside triphosphates to nucleosides/nucleotides, nucleoside monophosphates, or sugars | Back alignment and domain information |
|---|
| >PRK13833 conjugal transfer protein TrbB; Provisional | Back alignment and domain information |
|---|
| >cd00268 DEADc DEAD-box helicases | Back alignment and domain information |
|---|
| >PRK13764 ATPase; Provisional | Back alignment and domain information |
|---|
| >PRK13342 recombination factor protein RarA; Reviewed | Back alignment and domain information |
|---|
| >cd00984 DnaB_C DnaB helicase C terminal domain | Back alignment and domain information |
|---|
| >TIGR02928 orc1/cdc6 family replication initiation protein | Back alignment and domain information |
|---|
| >PRK01184 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01070 mutS1 DNA mismatch repair protein MutS | Back alignment and domain information |
|---|
| >PRK09435 membrane ATPase/protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold | Back alignment and domain information |
|---|
| >PRK10078 ribose 1,5-bisphosphokinase; Provisional | Back alignment and domain information |
|---|
| >PRK05399 DNA mismatch repair protein MutS; Provisional | Back alignment and domain information |
|---|
| >PF05970 PIF1: PIF1-like helicase; InterPro: IPR010285 This entry represents PIF1 helicase and related proteins | Back alignment and domain information |
|---|
| >smart00534 MUTSac ATPase domain of DNA mismatch repair MUTS family | Back alignment and domain information |
|---|
| >PRK13826 Dtr system oriT relaxase; Provisional | Back alignment and domain information |
|---|
| >PF13555 AAA_29: P-loop containing region of AAA domain | Back alignment and domain information |
|---|
| >TIGR03877 thermo_KaiC_1 KaiC domain protein, Ph0284 family | Back alignment and domain information |
|---|
| >COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >cd03287 ABC_MSH3_euk MutS3 homolog in eukaryotes | Back alignment and domain information |
|---|
| >PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA | Back alignment and domain information |
|---|
| >cd03109 DTBS Dethiobiotin synthetase (DTBS) is the penultimate enzyme in the biotin biosynthesis pathway in Escherichia coli and other microorganisms | Back alignment and domain information |
|---|
| >PRK13894 conjugal transfer ATPase TrbB; Provisional | Back alignment and domain information |
|---|
| >PRK13889 conjugal transfer relaxase TraA; Provisional | Back alignment and domain information |
|---|
| >TIGR02012 tigrfam_recA protein RecA | Back alignment and domain information |
|---|
| >TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family | Back alignment and domain information |
|---|
| >TIGR03420 DnaA_homol_Hda DnaA regulatory inactivator Hda | Back alignment and domain information |
|---|
| >PRK12402 replication factor C small subunit 2; Reviewed | Back alignment and domain information |
|---|
| >PRK09519 recA DNA recombination protein RecA; Reviewed | Back alignment and domain information |
|---|
| >smart00072 GuKc Guanylate kinase homologues | Back alignment and domain information |
|---|
| >COG0194 Gmk Guanylate kinase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02322 phosphon_PhnN phosphonate metabolism protein/1,5-bisphosphokinase (PRPP-forming) PhnN | Back alignment and domain information |
|---|
| >cd00071 GMPK Guanosine monophosphate kinase (GMPK, EC 2 | Back alignment and domain information |
|---|
| >PRK03839 putative kinase; Provisional | Back alignment and domain information |
|---|
| >PRK13851 type IV secretion system protein VirB11; Provisional | Back alignment and domain information |
|---|
| >cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport | Back alignment and domain information |
|---|
| >COG0703 AroK Shikimate kinase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR02760 TraI_TIGR conjugative transfer relaxase protein TraI | Back alignment and domain information |
|---|
| >cd03286 ABC_MSH6_euk MutS6 homolog in eukaryotes | Back alignment and domain information |
|---|
| >cd00983 recA RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >CHL00181 cbbX CbbX; Provisional | Back alignment and domain information |
|---|
| >PTZ00424 helicase 45; Provisional | Back alignment and domain information |
|---|
| >cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases | Back alignment and domain information |
|---|
| >COG1763 MobB Molybdopterin-guanine dinucleotide biosynthesis protein [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK13768 GTPase; Provisional | Back alignment and domain information |
|---|
| >smart00382 AAA ATPases associated with a variety of cellular activities | Back alignment and domain information |
|---|
| >PRK10917 ATP-dependent DNA helicase RecG; Provisional | Back alignment and domain information |
|---|
| >PF13481 AAA_25: AAA domain; PDB: 1G8Y_J 1OLO_A 1NLF_C | Back alignment and domain information |
|---|
| >PRK14532 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR03878 thermo_KaiC_2 KaiC domain protein, AF_0795 family | Back alignment and domain information |
|---|
| >PRK05580 primosome assembly protein PriA; Validated | Back alignment and domain information |
|---|
| >COG1643 HrpA HrpA-like helicases [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK00149 dnaA chromosomal replication initiation protein; Reviewed | Back alignment and domain information |
|---|
| >PRK08903 DnaA regulatory inactivator Hda; Validated | Back alignment and domain information |
|---|
| >PRK14962 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK08533 flagellar accessory protein FlaH; Reviewed | Back alignment and domain information |
|---|
| >cd03116 MobB Molybdenum is an essential trace element in the form of molybdenum cofactor (Moco) which is associated with the metabolism of nitrogen, carbon and sulfur by redox active enzymes | Back alignment and domain information |
|---|
| >PRK09354 recA recombinase A; Provisional | Back alignment and domain information |
|---|
| >PRK07933 thymidylate kinase; Validated | Back alignment and domain information |
|---|
| >PF03029 ATP_bind_1: Conserved hypothetical ATP binding protein; InterPro: IPR004130 Members of this family are found in a range of archaea and eukaryotes and have hypothesised ATP binding activity | Back alignment and domain information |
|---|
| >PRK11664 ATP-dependent RNA helicase HrpB; Provisional | Back alignment and domain information |
|---|
| >TIGR00362 DnaA chromosomal replication initiator protein DnaA | Back alignment and domain information |
|---|
| >PF00625 Guanylate_kin: Guanylate kinase; InterPro: IPR008144 Guanylate kinase (2 | Back alignment and domain information |
|---|
| >cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes | Back alignment and domain information |
|---|
| >TIGR00376 DNA helicase, putative | Back alignment and domain information |
|---|
| >COG2109 BtuR ATP:corrinoid adenosyltransferase [Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK14495 putative molybdopterin-guanine dinucleotide biosynthesis protein MobB/unknown domain fusion protein; Provisional | Back alignment and domain information |
|---|
| >COG0249 MutS Mismatch repair ATPase (MutS family) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK10867 signal recognition particle protein; Provisional | Back alignment and domain information |
|---|
| >TIGR01448 recD_rel helicase, putative, RecD/TraA family | Back alignment and domain information |
|---|
| >PF10412 TrwB_AAD_bind: Type IV secretion-system coupling protein DNA-binding domain; InterPro: IPR019476 The plasmid conjugative coupling protein TraD (also known as TrwB) is a basic integral inner-membrane nucleoside-triphosphate-binding protein | Back alignment and domain information |
|---|
| >PLN02840 tRNA dimethylallyltransferase | Back alignment and domain information |
|---|
| >cd02021 GntK Gluconate kinase (GntK) catalyzes the phosphoryl transfer from ATP to gluconate | Back alignment and domain information |
|---|
| >PRK13938 phosphoheptose isomerase; Provisional | Back alignment and domain information |
|---|
| >COG0630 VirB11 Type IV secretory pathway, VirB11 components, and related ATPases involved in archaeal flagella biosynthesis [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PF03266 NTPase_1: NTPase; InterPro: IPR004948 This entry represents a family of nucleoside-triphosphatases which have activity towards ATP, GTP, CTP, TTP and UTP and may hydrolyse nucleoside diphosphates with lower efficiency [] | Back alignment and domain information |
|---|
| >PRK00440 rfc replication factor C small subunit; Reviewed | Back alignment and domain information |
|---|
| >KOG0924|consensus | Back alignment and domain information |
|---|
| >PRK04328 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF00154 RecA: recA bacterial DNA recombination protein; InterPro: IPR013765 The recA gene product is a multifunctional enzyme that plays a role in homologous recombination, DNA repair and induction of the SOS response [] | Back alignment and domain information |
|---|
| >PRK13695 putative NTPase; Provisional | Back alignment and domain information |
|---|
| >PHA00729 NTP-binding motif containing protein | Back alignment and domain information |
|---|
| >PF00270 DEAD: DEAD/DEAH box helicase; InterPro: IPR011545 Members of this family include the DEAD and DEAH box helicases | Back alignment and domain information |
|---|
| >TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family | Back alignment and domain information |
|---|
| >PRK14489 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobA/MobB; Provisional | Back alignment and domain information |
|---|
| >PLN03025 replication factor C subunit; Provisional | Back alignment and domain information |
|---|
| >PRK14493 putative bifunctional molybdopterin-guanine dinucleotide biosynthesis protein MobB/MoaE; Provisional | Back alignment and domain information |
|---|
| >TIGR00174 miaA tRNA isopentenyltransferase (miaA) | Back alignment and domain information |
|---|
| >PF05707 Zot: Zonular occludens toxin (Zot); InterPro: IPR008900 This entry consists of bacterial and viral proteins which are very similar to the Zonular occludens toxin (Zot) | Back alignment and domain information |
|---|
| >PRK14964 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK06921 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PRK05800 cobU adenosylcobinamide kinase/adenosylcobinamide-phosphate guanylyltransferase; Validated | Back alignment and domain information |
|---|
| >PRK14949 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >TIGR01359 UMP_CMP_kin_fam UMP-CMP kinase family | Back alignment and domain information |
|---|
| >PRK13709 conjugal transfer nickase/helicase TraI; Provisional | Back alignment and domain information |
|---|
| >TIGR00767 rho transcription termination factor Rho | Back alignment and domain information |
|---|
| >PRK10875 recD exonuclease V subunit alpha; Provisional | Back alignment and domain information |
|---|
| >PHA00350 putative assembly protein | Back alignment and domain information |
|---|
| >COG3972 Superfamily I DNA and RNA helicases [General function prediction only] | Back alignment and domain information |
|---|
| >PRK07413 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PRK11131 ATP-dependent RNA helicase HrpA; Provisional | Back alignment and domain information |
|---|
| >PF02702 KdpD: Osmosensitive K+ channel His kinase sensor domain; InterPro: IPR003852 Two-component signal transduction systems enable bacteria to sense, respond, and adapt to a wide range of environments, stressors, and growth conditions [] | Back alignment and domain information |
|---|
| >COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG2255 RuvB Holliday junction resolvasome, helicase subunit [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PRK14712 conjugal transfer nickase/helicase TraI; Provisional | Back alignment and domain information |
|---|
| >cd01393 recA_like RecA is a bacterial enzyme which has roles in homologous recombination, DNA repair, and the induction of the SOS response | Back alignment and domain information |
|---|
| >TIGR02858 spore_III_AA stage III sporulation protein AA | Back alignment and domain information |
|---|
| >PRK14961 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PRK13973 thymidylate kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00750 lao LAO/AO transport system ATPase | Back alignment and domain information |
|---|
| >TIGR03575 selen_PSTK_euk L-seryl-tRNA(Sec) kinase, eukaryotic | Back alignment and domain information |
|---|
| >PF13671 AAA_33: AAA domain; PDB: 1LTQ_A 2IA5_K 1RC8_A 1LY1_A 1RRC_A 1RPZ_A 3ZVM_A 1YJ5_A 3ZVL_A 3U7E_B | Back alignment and domain information |
|---|
| >PF13238 AAA_18: AAA domain; PDB: 3IIK_A 3IIJ_A 3IIL_A 1RKB_A 3IIM_A 2AXP_A 3KB2_A 1KHT_A 1NKS_A 3H86_C | Back alignment and domain information |
|---|
| >PF00005 ABC_tran: ABC transporter This structure is on hold until Dec 1999; InterPro: IPR003439 ABC transporters belong to the ATP-Binding Cassette (ABC) superfamily, which uses the hydrolysis of ATP to energise diverse biological systems | Back alignment and domain information |
|---|
| >cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends | Back alignment and domain information |
|---|
| >PRK14530 adenylate kinase; Provisional | Back alignment and domain information |
|---|
| >PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 | Back alignment and domain information |
|---|
| >cd00227 CPT Chloramphenicol (Cm) phosphotransferase (CPT) | Back alignment and domain information |
|---|
| >PRK14956 DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >PF05729 NACHT: NACHT domain | Back alignment and domain information |
|---|
| >PRK06217 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >TIGR01360 aden_kin_iso1 adenylate kinase, isozyme 1 subfamily | Back alignment and domain information |
|---|
| >PRK14088 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >cd01127 TrwB Bacterial conjugation protein TrwB, ATP binding domain | Back alignment and domain information |
|---|
| >TIGR00176 mobB molybdopterin-guanine dinucleotide biosynthesis protein MobB | Back alignment and domain information |
|---|
| >PRK10744 pstB phosphate transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK14737 gmk guanylate kinase; Provisional | Back alignment and domain information |
|---|
| >COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] | Back alignment and domain information |
|---|
| >PRK00625 shikimate kinase; Provisional | Back alignment and domain information |
|---|
| >cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion | Back alignment and domain information |
|---|
| >PRK14721 flhF flagellar biosynthesis regulator FlhF; Provisional | Back alignment and domain information |
|---|
| >COG4098 comFA Superfamily II DNA/RNA helicase required for DNA uptake (late competence protein) [DNA replication, recombination, and repair] | Back alignment and domain information |
|---|
| >PTZ00088 adenylate kinase 1; Provisional | Back alignment and domain information |
|---|
| >PF02223 Thymidylate_kin: Thymidylate kinase; InterPro: IPR018094 Thymidylate kinase (2 | Back alignment and domain information |
|---|
| >TIGR00347 bioD dethiobiotin synthase | Back alignment and domain information |
|---|
| >PRK14086 dnaA chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >PHA02653 RNA helicase NPH-II; Provisional | Back alignment and domain information |
|---|
| >PRK14273 phosphate ABC transporter ATP-binding protein; Provisional | Back alignment and domain information |
|---|
| >PRK08116 hypothetical protein; Validated | Back alignment and domain information |
|---|
| >PF03796 DnaB_C: DnaB-like helicase C terminal domain; InterPro: IPR007694 The hexameric helicase DnaB unwinds the DNA duplex at the Escherichia coli chromosome replication fork | Back alignment and domain information |
|---|
| >PRK14494 putative molybdopterin-guanine dinucleotide biosynthesis protein MobB/FeS domain-containing protein protein; Provisional | Back alignment and domain information |
|---|
| >KOG0926|consensus | Back alignment and domain information |
|---|
| >PF02562 PhoH: PhoH-like protein; InterPro: IPR003714 PhoH is a cytoplasmic protein and predicted ATPase that is induced by phosphate starvation and belongings to the phosphate regulon (pho) in Escherichia coli [] | Back alignment and domain information |
|---|
| >TIGR03263 guanyl_kin guanylate kinase | Back alignment and domain information |
|---|
| >PF04665 Pox_A32: Poxvirus A32 protein; InterPro: IPR006758 This entry contains uncharacterised proteins belonging to the B354L family which include the pox virus A32 protein | Back alignment and domain information |
|---|
| >TIGR01967 DEAH_box_HrpA ATP-dependent helicase HrpA | Back alignment and domain information |
|---|
| >PF00580 UvrD-helicase: UvrD/REP helicase N-terminal domain; InterPro: IPR000212 Members of this family are helicases that catalyse ATP dependent unwinding of double stranded DNA to single stranded DNA | Back alignment and domain information |
|---|
| >COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] | Back alignment and domain information |
|---|
| >PHA02544 44 clamp loader, small subunit; Provisional | Back alignment and domain information |
|---|
| >TIGR03819 heli_sec_ATPase helicase/secretion neighborhood ATPase | Back alignment and domain information |
|---|
| >TIGR00959 ffh signal recognition particle protein | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 353 | ||||
| 2orv_A | 234 | Human Thymidine Kinase 1 In Complex With Tp4a Lengt | 1e-45 | ||
| 1w4r_A | 195 | Structure Of A Type Ii Thymidine Kinase With Bound | 1e-45 | ||
| 1xbt_A | 193 | Crystal Structure Of Human Thymidine Kinase 1 Lengt | 2e-45 | ||
| 2wvj_A | 193 | Mutation Of Thr163 To Ser In Human Thymidine Kinase | 4e-45 | ||
| 2j87_A | 177 | Structure Of Vaccinia Virus Thymidine Kinase In Com | 2e-44 | ||
| 2j9r_A | 214 | Thymidine Kinase From B. Anthracis In Complex With | 3e-19 | ||
| 2ja1_A | 197 | Thymidine Kinase From B. Cereus With Ttp Bound As P | 7e-19 | ||
| 3e2i_A | 219 | Crystal Structure Of Thymidine Kinase From S. Aureu | 5e-18 | ||
| 3e2i_A | 219 | Crystal Structure Of Thymidine Kinase From S. Aureu | 2e-17 | ||
| 1xx6_A | 191 | X-Ray Structure Of Clostridium Acetobutylicum Thymi | 1e-15 | ||
| 1xx6_A | 191 | X-Ray Structure Of Clostridium Acetobutylicum Thymi | 2e-15 | ||
| 2b8t_A | 223 | Crystal Structure Of Thymidine Kinase From U.Urealy | 1e-12 | ||
| 2uz3_A | 243 | Crystal Structure Of Thymidine Kinase With Dttp Fro | 1e-12 | ||
| 2orw_A | 184 | Thermotoga Maritima Thymidine Kinase 1 Like Enzyme | 3e-05 |
| >pdb|2ORV|A Chain A, Human Thymidine Kinase 1 In Complex With Tp4a Length = 234 | Back alignment and structure |
|
| >pdb|1W4R|A Chain A, Structure Of A Type Ii Thymidine Kinase With Bound Dttp Length = 195 | Back alignment and structure |
| >pdb|1XBT|A Chain A, Crystal Structure Of Human Thymidine Kinase 1 Length = 193 | Back alignment and structure |
| >pdb|2WVJ|A Chain A, Mutation Of Thr163 To Ser In Human Thymidine Kinase Shifts The Specificity From Thymidine Towards The Nucleoside Analogue Azidothymidine Length = 193 | Back alignment and structure |
| >pdb|2J87|A Chain A, Structure Of Vaccinia Virus Thymidine Kinase In Complex With Dttp: Insights For Drug Design Length = 177 | Back alignment and structure |
| >pdb|2J9R|A Chain A, Thymidine Kinase From B. Anthracis In Complex With Dt Length = 214 | Back alignment and structure |
| >pdb|2JA1|A Chain A, Thymidine Kinase From B. Cereus With Ttp Bound As Phosphate Donor Length = 197 | Back alignment and structure |
| >pdb|3E2I|A Chain A, Crystal Structure Of Thymidine Kinase From S. Aureus Length = 219 | Back alignment and structure |
| >pdb|3E2I|A Chain A, Crystal Structure Of Thymidine Kinase From S. Aureus Length = 219 | Back alignment and structure |
| >pdb|1XX6|A Chain A, X-Ray Structure Of Clostridium Acetobutylicum Thymidine Kinase With Adp. Northeast Structural Genomics Target Car26. Length = 191 | Back alignment and structure |
| >pdb|1XX6|A Chain A, X-Ray Structure Of Clostridium Acetobutylicum Thymidine Kinase With Adp. Northeast Structural Genomics Target Car26. Length = 191 | Back alignment and structure |
| >pdb|2B8T|A Chain A, Crystal Structure Of Thymidine Kinase From U.Urealyticum In Complex With Thymidine Length = 223 | Back alignment and structure |
| >pdb|2UZ3|A Chain A, Crystal Structure Of Thymidine Kinase With Dttp From U. Urealyticum Length = 243 | Back alignment and structure |
| >pdb|2ORW|A Chain A, Thermotoga Maritima Thymidine Kinase 1 Like Enzyme In Complex With Tp4a Length = 184 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 353 | |||
| 3e2i_A | 219 | Thymidine kinase; Zn-binding, ATP-binding, DNA syn | 2e-58 | |
| 3e2i_A | 219 | Thymidine kinase; Zn-binding, ATP-binding, DNA syn | 3e-51 | |
| 3e2i_A | 219 | Thymidine kinase; Zn-binding, ATP-binding, DNA syn | 4e-04 | |
| 1w4r_A | 195 | Thymidine kinase; type II, human, cytosolic, phosp | 2e-57 | |
| 1w4r_A | 195 | Thymidine kinase; type II, human, cytosolic, phosp | 1e-52 | |
| 1w4r_A | 195 | Thymidine kinase; type II, human, cytosolic, phosp | 3e-05 | |
| 1xx6_A | 191 | Thymidine kinase; NESG, northeast structural genom | 3e-57 | |
| 1xx6_A | 191 | Thymidine kinase; NESG, northeast structural genom | 1e-50 | |
| 1xx6_A | 191 | Thymidine kinase; NESG, northeast structural genom | 6e-04 | |
| 2j9r_A | 214 | Thymidine kinase; TK1, DNK, lasso, transferase, AT | 2e-56 | |
| 2j9r_A | 214 | Thymidine kinase; TK1, DNK, lasso, transferase, AT | 2e-49 | |
| 2j9r_A | 214 | Thymidine kinase; TK1, DNK, lasso, transferase, AT | 2e-04 | |
| 2orv_A | 234 | Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 | 8e-55 | |
| 2orv_A | 234 | Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 | 4e-50 | |
| 2orw_A | 184 | Thymidine kinase; TMTK, TP4A, transferase; HET: 4T | 2e-54 | |
| 2orw_A | 184 | Thymidine kinase; TMTK, TP4A, transferase; HET: 4T | 3e-51 | |
| 2orw_A | 184 | Thymidine kinase; TMTK, TP4A, transferase; HET: 4T | 8e-05 | |
| 2b8t_A | 223 | Thymidine kinase; deoxyribonucleoside kinase, zinc | 4e-54 | |
| 2b8t_A | 223 | Thymidine kinase; deoxyribonucleoside kinase, zinc | 5e-48 | |
| 2b8t_A | 223 | Thymidine kinase; deoxyribonucleoside kinase, zinc | 3e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 8e-09 |
| >3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} Length = 219 | Back alignment and structure |
|---|
Score = 187 bits (477), Expect = 2e-58
Identities = 62/202 (30%), Positives = 96/202 (47%), Gaps = 46/202 (22%)
Query: 153 EVILGPMFSGKTTELIRRIRRYQYANYRCMIVRYAKDDRYDTEKVSTHDQQKLTAVSAVE 212
E I G MFSGK+ ELIRR+RR YA + ++ + A DDRY EKV +H+ + A++ +
Sbjct: 31 ECITGSMFSGKSEELIRRLRRGIYAKQKVVVFKPAIDDRYHKEKVVSHNGNAIEAINISK 90
Query: 213 LNKLIPH-TKDIDVIGIDEGQFVEVIGGSDKYMAVCRECYKQKAPIKRSPFKTLANENAA 271
++++ H ++DVIGIDE QF F
Sbjct: 91 ASEIMTHDLTNVDVIGIDEVQF----------------------------FD-------- 114
Query: 272 LNVPPPPEFPDVVSFAESMANAGKIVVVAALDGTFQRTGFNDILSLIPLAECVEKLTAVC 331
++VS E ++ G V+VA LD F+ F + L+ ++E V KL AVC
Sbjct: 115 ---------DEIVSIVEKLSADGHRVIVAGLDMDFRGEPFEPMPKLMAVSEQVTKLQAVC 165
Query: 332 MSCFRDAAFTKRIGQEKEVRIE 353
C ++ T+R+ K +I+
Sbjct: 166 AVCGSSSSRTQRLINGKPAKID 187
|
| >3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} Length = 219 | Back alignment and structure |
|---|
| >3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} Length = 219 | Back alignment and structure |
|---|
| >1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Length = 195 | Back alignment and structure |
|---|
| >1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Length = 195 | Back alignment and structure |
|---|
| >1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* Length = 195 | Back alignment and structure |
|---|
| >1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Length = 191 | Back alignment and structure |
|---|
| >1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Length = 191 | Back alignment and structure |
|---|
| >1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 Length = 191 | Back alignment and structure |
|---|
| >2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Length = 214 | Back alignment and structure |
|---|
| >2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Length = 214 | Back alignment and structure |
|---|
| >2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* Length = 214 | Back alignment and structure |
|---|
| >2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 Length = 234 | Back alignment and structure |
|---|
| >2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 Length = 234 | Back alignment and structure |
|---|
| >2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Length = 184 | Back alignment and structure |
|---|
| >2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Length = 184 | Back alignment and structure |
|---|
| >2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* Length = 184 | Back alignment and structure |
|---|
| >2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Length = 223 | Back alignment and structure |
|---|
| >2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Length = 223 | Back alignment and structure |
|---|
| >2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* Length = 223 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 353 | |||
| 3e2i_A | 219 | Thymidine kinase; Zn-binding, ATP-binding, DNA syn | 100.0 | |
| 1w4r_A | 195 | Thymidine kinase; type II, human, cytosolic, phosp | 100.0 | |
| 3e2i_A | 219 | Thymidine kinase; Zn-binding, ATP-binding, DNA syn | 100.0 | |
| 1w4r_A | 195 | Thymidine kinase; type II, human, cytosolic, phosp | 100.0 | |
| 2j9r_A | 214 | Thymidine kinase; TK1, DNK, lasso, transferase, AT | 100.0 | |
| 2orv_A | 234 | Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 | 100.0 | |
| 1xx6_A | 191 | Thymidine kinase; NESG, northeast structural genom | 100.0 | |
| 2j9r_A | 214 | Thymidine kinase; TK1, DNK, lasso, transferase, AT | 100.0 | |
| 2orv_A | 234 | Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2 | 100.0 | |
| 1xx6_A | 191 | Thymidine kinase; NESG, northeast structural genom | 100.0 | |
| 2b8t_A | 223 | Thymidine kinase; deoxyribonucleoside kinase, zinc | 100.0 | |
| 2orw_A | 184 | Thymidine kinase; TMTK, TP4A, transferase; HET: 4T | 100.0 | |
| 2orw_A | 184 | Thymidine kinase; TMTK, TP4A, transferase; HET: 4T | 100.0 | |
| 2b8t_A | 223 | Thymidine kinase; deoxyribonucleoside kinase, zinc | 100.0 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 97.12 | |
| 2r2a_A | 199 | Uncharacterized protein; zonular occludens toxin, | 96.87 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 96.71 | |
| 3e1s_A | 574 | Exodeoxyribonuclease V, subunit RECD; alpha and be | 96.71 | |
| 1g5t_A | 196 | COB(I)alamin adenosyltransferase; P-loop protein, | 96.57 | |
| 1rif_A | 282 | DAR protein, DNA helicase UVSW; bacteriophage, REC | 96.47 | |
| 1g5t_A | 196 | COB(I)alamin adenosyltransferase; P-loop protein, | 96.42 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 96.35 | |
| 3upu_A | 459 | ATP-dependent DNA helicase DDA; RECA-like domain, | 96.29 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 96.27 | |
| 2w0m_A | 235 | SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus | 96.23 | |
| 2zr9_A | 349 | Protein RECA, recombinase A; recombination, RECA m | 96.14 | |
| 2fz4_A | 237 | DNA repair protein RAD25; RECA-like domain, DNA da | 96.1 | |
| 2oca_A | 510 | DAR protein, ATP-dependent DNA helicase UVSW; ATP- | 95.95 | |
| 3hr8_A | 356 | Protein RECA; alpha and beta proteins (A/B, A+B), | 95.93 | |
| 2z4s_A | 440 | Chromosomal replication initiator protein DNAA; AA | 95.89 | |
| 2fwr_A | 472 | DNA repair protein RAD25; DNA unwinding, XPB, DNA | 95.72 | |
| 3vkw_A | 446 | Replicase large subunit; alpha/beta domain, helica | 95.67 | |
| 3jvv_A | 356 | Twitching mobility protein; hexameric P-loop ATPas | 95.53 | |
| 2jlq_A | 451 | Serine protease subunit NS3; ribonucleoprotein, nu | 95.33 | |
| 2w58_A | 202 | DNAI, primosome component (helicase loader); ATP-b | 95.2 | |
| 3llm_A | 235 | ATP-dependent RNA helicase A; alpha-beta-alpha, st | 95.14 | |
| 3h1t_A | 590 | Type I site-specific restriction-modification syst | 95.02 | |
| 3io5_A | 333 | Recombination and repair protein; storage dimer, i | 94.83 | |
| 1jbk_A | 195 | CLPB protein; beta barrel, chaperone; 1.80A {Esche | 94.83 | |
| 2p65_A | 187 | Hypothetical protein PF08_0063; CLPB, malaria, str | 94.8 | |
| 1yks_A | 440 | Genome polyprotein [contains: flavivirin protease | 94.63 | |
| 2z83_A | 459 | Helicase/nucleoside triphosphatase; hydrolase, mem | 94.61 | |
| 1hv8_A | 367 | Putative ATP-dependent RNA helicase MJ0669; RNA-bi | 94.56 | |
| 1wp9_A | 494 | ATP-dependent RNA helicase, putative; ATPase, DNA | 94.55 | |
| 1xjc_A | 169 | MOBB protein homolog; structural genomics, midwest | 94.53 | |
| 1xp8_A | 366 | RECA protein, recombinase A; recombination, radior | 94.49 | |
| 2v6i_A | 431 | RNA helicase; membrane, hydrolase, transmembrane, | 94.46 | |
| 1u94_A | 356 | RECA protein, recombinase A; homologous recombinat | 94.43 | |
| 3oiy_A | 414 | Reverse gyrase helicase domain; topoisomerase, DNA | 94.34 | |
| 1w36_D | 608 | RECD, exodeoxyribonuclease V alpha chain; recombin | 94.14 | |
| 2kjq_A | 149 | DNAA-related protein; solution structure, NESG, st | 94.0 | |
| 3e1s_A | 574 | Exodeoxyribonuclease V, subunit RECD; alpha and be | 93.95 | |
| 2whx_A | 618 | Serine protease/ntpase/helicase NS3; transcription | 93.93 | |
| 3upu_A | 459 | ATP-dependent DNA helicase DDA; RECA-like domain, | 93.87 | |
| 2qgz_A | 308 | Helicase loader, putative primosome component; str | 93.86 | |
| 2z0m_A | 337 | 337AA long hypothetical ATP-dependent RNA helicase | 93.81 | |
| 3kl4_A | 433 | SRP54, signal recognition 54 kDa protein; signal r | 93.73 | |
| 1vec_A | 206 | ATP-dependent RNA helicase P54; DEAD-box protein, | 93.71 | |
| 2zts_A | 251 | Putative uncharacterized protein PH0186; KAIC like | 93.71 | |
| 3e70_C | 328 | DPA, signal recognition particle receptor; FTSY, S | 93.51 | |
| 2pl3_A | 236 | Probable ATP-dependent RNA helicase DDX10; DEAD, s | 93.33 | |
| 2r8r_A | 228 | Sensor protein; KDPD, PFAM02702, MCSG, structural | 93.24 | |
| 3iuy_A | 228 | Probable ATP-dependent RNA helicase DDX53; REC-A-l | 93.1 | |
| 2wv9_A | 673 | Flavivirin protease NS2B regulatory subunit, FLAV | 93.09 | |
| 2yvu_A | 186 | Probable adenylyl-sulfate kinase; transferase, str | 92.99 | |
| 1s2m_A | 400 | Putative ATP-dependent RNA helicase DHH1; ATP-bind | 92.99 | |
| 2v3c_C | 432 | SRP54, signal recognition 54 kDa protein; nucleoti | 92.98 | |
| 3a8t_A | 339 | Adenylate isopentenyltransferase; rossmann fold pr | 92.93 | |
| 3pey_A | 395 | ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, A | 92.93 | |
| 2qby_A | 386 | CDC6 homolog 1, cell division control protein 6 ho | 92.92 | |
| 2chg_A | 226 | Replication factor C small subunit; DNA-binding pr | 92.9 | |
| 2va8_A | 715 | SSO2462, SKI2-type helicase; hydrolase, DNA repair | 92.83 | |
| 3lw7_A | 179 | Adenylate kinase related protein (ADKA-like); AMP, | 92.65 | |
| 3syl_A | 309 | Protein CBBX; photosynthesis, rubisco activase, AA | 92.62 | |
| 2ewv_A | 372 | Twitching motility protein PILT; pilus retraction | 92.61 | |
| 2dr3_A | 247 | UPF0273 protein PH0284; RECA superfamily ATPase, h | 92.42 | |
| 2z0h_A | 197 | DTMP kinase, thymidylate kinase; ATP-binding, nucl | 92.4 | |
| 1fnn_A | 389 | CDC6P, cell division control protein 6; ORC1, AAA | 92.37 | |
| 2zj8_A | 720 | DNA helicase, putative SKI2-type helicase; RECA fo | 92.29 | |
| 4a2p_A | 556 | RIG-I, retinoic acid inducible protein I; hydrolas | 92.28 | |
| 1sxj_A | 516 | Activator 1 95 kDa subunit; clamp loader, processi | 92.27 | |
| 3eiq_A | 414 | Eukaryotic initiation factor 4A-I; PDCD4, anti-onc | 92.21 | |
| 3dm5_A | 443 | SRP54, signal recognition 54 kDa protein; protein- | 92.12 | |
| 1nks_A | 194 | Adenylate kinase; thermophilic, transferase; HET: | 92.1 | |
| 1z63_A | 500 | Helicase of the SNF2/RAD54 hamily; protein-DNA com | 92.08 | |
| 3tbk_A | 555 | RIG-I helicase domain; DECH helicase, ATP binding, | 92.0 | |
| 1ex7_A | 186 | Guanylate kinase; substrate-induced FIT, domain mo | 91.97 | |
| 1qde_A | 224 | EIF4A, translation initiation factor 4A; DEAD box | 91.88 | |
| 3bos_A | 242 | Putative DNA replication factor; P-loop containing | 91.8 | |
| 1t6n_A | 220 | Probable ATP-dependent RNA helicase; RECA-like fol | 91.64 | |
| 3uie_A | 200 | Adenylyl-sulfate kinase 1, chloroplastic; rossmann | 91.58 | |
| 2vhj_A | 331 | Ntpase P4, P4; non- hydrolysable ATP analogue, hyd | 91.47 | |
| 2v1u_A | 387 | Cell division control protein 6 homolog; DNA repli | 91.46 | |
| 2ykg_A | 696 | Probable ATP-dependent RNA helicase DDX58; hydrola | 91.44 | |
| 3u61_B | 324 | DNA polymerase accessory protein 44; AAA+, ATP hyd | 91.38 | |
| 2p6r_A | 702 | Afuhel308 helicase; protein-DNA complex, SF2 helic | 91.34 | |
| 1wrb_A | 253 | DJVLGB; RNA helicase, DEAD BOX, VASA, structural g | 91.27 | |
| 3dmq_A | 968 | RNA polymerase-associated protein RAPA; SWF2/SNF2, | 91.26 | |
| 2qor_A | 204 | Guanylate kinase; phosphotransferase, purine metab | 91.18 | |
| 3fho_A | 508 | ATP-dependent RNA helicase DBP5; mRNA export, ATPa | 91.18 | |
| 1xti_A | 391 | Probable ATP-dependent RNA helicase P47; alpha-bet | 91.13 | |
| 3cmw_A | 1706 | Protein RECA, recombinase A; homologous recombinat | 91.07 | |
| 2pez_A | 179 | Bifunctional 3'-phosphoadenosine 5'- phosphosulfat | 91.06 | |
| 1nn5_A | 215 | Similar to deoxythymidylate kinase (thymidylate K; | 90.97 | |
| 1qhx_A | 178 | CPT, protein (chloramphenicol phosphotransferase); | 90.95 | |
| 1fuu_A | 394 | Yeast initiation factor 4A; IF4A, helicase, DEAD-b | 90.79 | |
| 2pbr_A | 195 | DTMP kinase, thymidylate kinase; transferase, nucl | 90.73 | |
| 1njg_A | 250 | DNA polymerase III subunit gamma; rossman-like fol | 90.7 | |
| 3bor_A | 237 | Human initiation factor 4A-II; translation initiat | 90.7 | |
| 3pfi_A | 338 | Holliday junction ATP-dependent DNA helicase RUVB; | 90.58 | |
| 2wwf_A | 212 | Thymidilate kinase, putative; transferase, malaria | 90.48 | |
| 1u0l_A | 301 | Probable GTPase ENGC; permutation, OB-fold, zinc-f | 90.47 | |
| 4gl2_A | 699 | Interferon-induced helicase C domain-containing P; | 90.36 | |
| 1zp6_A | 191 | Hypothetical protein ATU3015; alpha-beta protein., | 90.36 | |
| 3eph_A | 409 | TRNA isopentenyltransferase; transferase, alternat | 90.32 | |
| 2i4i_A | 417 | ATP-dependent RNA helicase DDX3X; DEAD, structural | 90.32 | |
| 4b3f_X | 646 | DNA-binding protein smubp-2; hydrolase, helicase; | 90.3 | |
| 2j0s_A | 410 | ATP-dependent RNA helicase DDX48; mRNA processing, | 90.27 | |
| 1rif_A | 282 | DAR protein, DNA helicase UVSW; bacteriophage, REC | 90.23 | |
| 3fmp_B | 479 | ATP-dependent RNA helicase DDX19B; nuclear porin, | 90.04 | |
| 3l9o_A | 1108 | ATP-dependent RNA helicase DOB1; REC-A fold, winge | 90.0 | |
| 1m7g_A | 211 | Adenylylsulfate kinase; APS kinase, transferase, s | 89.96 | |
| 1ofh_A | 310 | ATP-dependent HSL protease ATP-binding subunit HSL | 89.71 | |
| 3cmu_A | 2050 | Protein RECA, recombinase A; homologous recombinat | 89.55 | |
| 1gm5_A | 780 | RECG; helicase, replication restart; HET: DNA ADP; | 89.52 | |
| 4a4z_A | 997 | Antiviral helicase SKI2; hydrolase, ATPase, mRNA d | 89.5 | |
| 2ehv_A | 251 | Hypothetical protein PH0186; KAIC, RECA ATPase, un | 89.49 | |
| 3pvs_A | 447 | Replication-associated recombination protein A; ma | 89.47 | |
| 2plr_A | 213 | DTMP kinase, probable thymidylate kinase; TMP-bind | 89.41 | |
| 4a2q_A | 797 | RIG-I, retinoic acid inducible protein I; hydrolas | 89.35 | |
| 1kht_A | 192 | Adenylate kinase; phosphotransferase, signaling pr | 89.33 | |
| 1cr0_A | 296 | DNA primase/helicase; RECA-type protein fold, tran | 89.27 | |
| 3crm_A | 323 | TRNA delta(2)-isopentenylpyrophosphate transferase | 89.12 | |
| 2xgj_A | 1010 | ATP-dependent RNA helicase DOB1; hydrolase-RNA com | 89.09 | |
| 1hqc_A | 324 | RUVB; extended AAA-ATPase domain, complex with nuc | 89.02 | |
| 3o8b_A | 666 | HCV NS3 protease/helicase; ntpase, RNA, translocat | 88.93 | |
| 1wp9_A | 494 | ATP-dependent RNA helicase, putative; ATPase, DNA | 88.93 | |
| 3exa_A | 322 | TRNA delta(2)-isopentenylpyrophosphate transferase | 88.82 | |
| 3cmw_A | 1706 | Protein RECA, recombinase A; homologous recombinat | 88.8 | |
| 4eaq_A | 229 | DTMP kinase, thymidylate kinase; structural genomi | 88.73 | |
| 1gtv_A | 214 | TMK, thymidylate kinase; transferase, transferase | 88.72 | |
| 2px0_A | 296 | Flagellar biosynthesis protein FLHF; SRP GTPase, f | 88.71 | |
| 4dzz_A | 206 | Plasmid partitioning protein PARF; deviant walker | 88.67 | |
| 2v54_A | 204 | DTMP kinase, thymidylate kinase; nucleotide biosyn | 88.64 | |
| 2cvh_A | 220 | DNA repair and recombination protein RADB; filamen | 88.62 | |
| 3foz_A | 316 | TRNA delta(2)-isopentenylpyrophosphate transferas; | 88.45 | |
| 1p5z_B | 263 | DCK, deoxycytidine kinase; nucleoside kinase, P-lo | 88.38 | |
| 2oca_A | 510 | DAR protein, ATP-dependent DNA helicase UVSW; ATP- | 88.35 | |
| 2r2a_A | 199 | Uncharacterized protein; zonular occludens toxin, | 88.26 | |
| 2bdt_A | 189 | BH3686; alpha-beta protein, structural genomics, P | 88.25 | |
| 1vma_A | 306 | Cell division protein FTSY; TM0570, structural gen | 88.23 | |
| 2jlq_A | 451 | Serine protease subunit NS3; ribonucleoprotein, nu | 88.07 | |
| 3rc3_A | 677 | ATP-dependent RNA helicase SUPV3L1, mitochondrial; | 88.02 | |
| 3vkw_A | 446 | Replicase large subunit; alpha/beta domain, helica | 87.95 | |
| 1yrb_A | 262 | ATP(GTP)binding protein; GTPase, P-loop, rossman f | 87.85 | |
| 1um8_A | 376 | ATP-dependent CLP protease ATP-binding subunit CL; | 87.77 | |
| 1np6_A | 174 | Molybdopterin-guanine dinucleotide biosynthesis pr | 87.73 | |
| 1l8q_A | 324 | Chromosomal replication initiator protein DNAA; AA | 87.67 | |
| 4eun_A | 200 | Thermoresistant glucokinase; putative sugar kinase | 87.63 | |
| 1sxj_B | 323 | Activator 1 37 kDa subunit; clamp loader, processi | 87.52 | |
| 4gp7_A | 171 | Metallophosphoesterase; polynucleotide kinase phos | 87.52 | |
| 3kb2_A | 173 | SPBC2 prophage-derived uncharacterized protein YOR | 87.5 | |
| 3cmu_A | 2050 | Protein RECA, recombinase A; homologous recombinat | 87.47 | |
| 1kag_A | 173 | SKI, shikimate kinase I; transferase, structural g | 87.46 | |
| 2v6i_A | 431 | RNA helicase; membrane, hydrolase, transmembrane, | 87.38 | |
| 1sxj_C | 340 | Activator 1 40 kDa subunit; clamp loader, processi | 87.25 | |
| 2gno_A | 305 | DNA polymerase III, gamma subunit-related protein; | 87.24 | |
| 3a4m_A | 260 | L-seryl-tRNA(SEC) kinase; P-loop motif, walker A m | 87.21 | |
| 2zr9_A | 349 | Protein RECA, recombinase A; recombination, RECA m | 87.15 | |
| 4ddu_A | 1104 | Reverse gyrase; topoisomerase, DNA supercoiling, a | 87.05 | |
| 3b9q_A | 302 | Chloroplast SRP receptor homolog, alpha subunit CP | 86.97 | |
| 4edh_A | 213 | DTMP kinase, thymidylate kinase; structural genomi | 86.81 | |
| 2db3_A | 434 | ATP-dependent RNA helicase VASA; DEAD-BOX, protein | 86.6 | |
| 1gku_B | 1054 | Reverse gyrase, TOP-RG; topoisomerase, DNA superco | 86.52 | |
| 2whx_A | 618 | Serine protease/ntpase/helicase NS3; transcription | 86.51 | |
| 3hjn_A | 197 | DTMP kinase, thymidylate kinase; ATP-binding, nucl | 86.42 | |
| 1xwi_A | 322 | SKD1 protein; VPS4B, AAA ATPase, protein transport | 86.32 | |
| 1e9r_A | 437 | Conjugal transfer protein TRWB; coupling protein, | 86.28 | |
| 1knq_A | 175 | Gluconate kinase; ALFA/beta structure, transferase | 86.2 | |
| 2chq_A | 319 | Replication factor C small subunit; DNA-binding pr | 86.18 | |
| 3uk6_A | 368 | RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding | 86.12 | |
| 4ag6_A | 392 | VIRB4 ATPase, type IV secretory pathway VIRB4 comp | 86.11 | |
| 3vaa_A | 199 | Shikimate kinase, SK; structural genomics, center | 86.1 | |
| 3vfd_A | 389 | Spastin; ATPase, microtubule severing, hydrolase; | 86.09 | |
| 4a2w_A | 936 | RIG-I, retinoic acid inducible protein I; hydrolas | 86.08 | |
| 3h4m_A | 285 | Proteasome-activating nucleotidase; ATPase, PAN, A | 85.91 | |
| 2qz4_A | 262 | Paraplegin; AAA+, SPG7, protease, ADP, structural | 85.87 | |
| 1jjv_A | 206 | Dephospho-COA kinase; P-loop nucleotide-binding fo | 85.84 | |
| 1in4_A | 334 | RUVB, holliday junction DNA helicase RUVB; AAA+-cl | 85.72 | |
| 2j41_A | 207 | Guanylate kinase; GMP, GMK, transferase, ATP-bindi | 85.72 | |
| 2eyu_A | 261 | Twitching motility protein PILT; pilus retraction | 85.57 | |
| 1y63_A | 184 | LMAJ004144AAA protein; structural genomics, protei | 85.56 | |
| 3tr0_A | 205 | Guanylate kinase, GMP kinase; purines, pyrimidines | 85.54 | |
| 2zu0_C | 267 | Probable ATP-dependent transporter SUFC; iron-sulf | 85.36 | |
| 1vht_A | 218 | Dephospho-COA kinase; structural genomics, transfe | 85.35 | |
| 1rj9_A | 304 | FTSY, signal recognition protein; SRP-GTPase domai | 85.23 | |
| 2rhm_A | 193 | Putative kinase; P-loop containing nucleoside trip | 85.2 | |
| 3cm0_A | 186 | Adenylate kinase; ATP-binding, cytoplasm, nucleoti | 85.16 | |
| 1zu4_A | 320 | FTSY; GTPase, signal recognition particle, SRP, re | 85.14 | |
| 3bh0_A | 315 | DNAB-like replicative helicase; ATPase, replicatio | 85.13 | |
| 2z83_A | 459 | Helicase/nucleoside triphosphatase; hydrolase, mem | 85.1 | |
| 2jaq_A | 205 | Deoxyguanosine kinase; transferase, deoxyribonucle | 84.96 | |
| 3trf_A | 185 | Shikimate kinase, SK; amino acid biosynthesis, tra | 84.94 | |
| 1yks_A | 440 | Genome polyprotein [contains: flavivirin protease | 84.83 | |
| 1zak_A | 222 | Adenylate kinase; ATP:AMP-phosphotransferase, tran | 84.78 | |
| 3sqw_A | 579 | ATP-dependent RNA helicase MSS116, mitochondrial; | 84.61 | |
| 3v9p_A | 227 | DTMP kinase, thymidylate kinase; ssgcid, STRU geno | 84.57 | |
| 3ec2_A | 180 | DNA replication protein DNAC; helicase loader, rep | 84.56 | |
| 3iuy_A | 228 | Probable ATP-dependent RNA helicase DDX53; REC-A-l | 84.54 | |
| 1jr3_A | 373 | DNA polymerase III subunit gamma; processivity, pr | 84.48 | |
| 2og2_A | 359 | Putative signal recognition particle receptor; nuc | 84.19 | |
| 1rz3_A | 201 | Hypothetical protein rbstp0775; MCSG, structural g | 84.16 | |
| 2fwr_A | 472 | DNA repair protein RAD25; DNA unwinding, XPB, DNA | 84.11 | |
| 2wsm_A | 221 | Hydrogenase expression/formation protein (HYPB); m | 84.11 | |
| 1n0w_A | 243 | DNA repair protein RAD51 homolog 1; DNA repair, ho | 83.95 | |
| 3n70_A | 145 | Transport activator; sigma-54, ntpase, PSI, MCSG, | 83.76 | |
| 2ze6_A | 253 | Isopentenyl transferase; crown GALL tumor, cytokin | 83.68 | |
| 2l8b_A | 189 | Protein TRAI, DNA helicase I; RECD, hydrolase; NMR | 83.66 | |
| 2z4s_A | 440 | Chromosomal replication initiator protein DNAA; AA | 83.55 | |
| 1a5t_A | 334 | Delta prime, HOLB; zinc finger, DNA replication; 2 | 83.55 | |
| 3lv8_A | 236 | DTMP kinase, thymidylate kinase; structural genomi | 83.43 | |
| 3ld9_A | 223 | DTMP kinase, thymidylate kinase; ssgcid, NIH, niai | 83.4 | |
| 1qvr_A | 854 | CLPB protein; coiled coil, AAA ATPase, chaperone; | 83.38 | |
| 3mwy_W | 800 | Chromo domain-containing protein 1; SWI2/SNF2 ATPa | 83.32 | |
| 4tmk_A | 213 | Protein (thymidylate kinase); ATP:DTMP phosphotran | 83.28 | |
| 1ly1_A | 181 | Polynucleotide kinase; PNK, phosphatase, transfera | 83.26 | |
| 1kgd_A | 180 | CASK, peripheral plasma membrane CASK; maguk, guan | 83.19 | |
| 3hr8_A | 356 | Protein RECA; alpha and beta proteins (A/B, A+B), | 83.12 | |
| 3iij_A | 180 | Coilin-interacting nuclear ATPase protein; alpha a | 83.12 | |
| 1nij_A | 318 | Hypothetical protein YJIA; structural genomics, P- | 83.12 | |
| 1sxj_E | 354 | Activator 1 40 kDa subunit; clamp loader, processi | 83.05 | |
| 1aky_A | 220 | Adenylate kinase; ATP:AMP phosphotransferase, myok | 83.05 | |
| 1j8m_F | 297 | SRP54, signal recognition 54 kDa protein; signalin | 82.99 | |
| 1iqp_A | 327 | RFCS; clamp loader, extended AAA-ATPase domain, co | 82.8 | |
| 2yhs_A | 503 | FTSY, cell division protein FTSY; cell cycle, prot | 82.75 | |
| 2fz4_A | 237 | DNA repair protein RAD25; RECA-like domain, DNA da | 82.61 | |
| 3lfu_A | 647 | DNA helicase II; SF1 helicase, ATP-binding, DNA da | 82.45 | |
| 3t61_A | 202 | Gluconokinase; PSI-biology, structural genomics, p | 82.43 | |
| 2if2_A | 204 | Dephospho-COA kinase; alpha-beta protein, structur | 82.41 | |
| 4a1f_A | 338 | DNAB helicase, replicative DNA helicase; hydrolase | 82.21 | |
| 4a74_A | 231 | DNA repair and recombination protein RADA; hydrola | 82.2 | |
| 3tau_A | 208 | Guanylate kinase, GMP kinase; structural genomics, | 82.17 | |
| 2wv9_A | 673 | Flavivirin protease NS2B regulatory subunit, FLAV | 82.05 | |
| 1htw_A | 158 | HI0065; nucleotide-binding fold, structural genomi | 82.02 | |
| 3kta_A | 182 | Chromosome segregation protein SMC; structural mai | 81.86 | |
| 1w5s_A | 412 | Origin recognition complex subunit 2 ORC2; replica | 81.86 | |
| 1nlf_A | 279 | Regulatory protein REPA; replicative DNA helicase | 81.85 | |
| 2c95_A | 196 | Adenylate kinase 1; transferase, AP4A, nucleotide | 81.74 | |
| 1znw_A | 207 | Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans | 81.71 | |
| 3bgw_A | 444 | DNAB-like replicative helicase; ATPase, replicatio | 81.64 | |
| 2w0m_A | 235 | SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus | 81.57 | |
| 3c8u_A | 208 | Fructokinase; YP_612366.1, putative fructose trans | 81.33 | |
| 2bbw_A | 246 | Adenylate kinase 4, AK4; nucleotide kinase, nucleo | 81.24 | |
| 3oiy_A | 414 | Reverse gyrase helicase domain; topoisomerase, DNA | 81.1 | |
| 1e4v_A | 214 | Adenylate kinase; transferase(phosphotransferase); | 81.07 | |
| 2xb4_A | 223 | Adenylate kinase; ATP-binding, nucleotide-binding, | 81.01 | |
| 4e22_A | 252 | Cytidylate kinase; P-loop, CMP/ATP binding, transf | 80.97 | |
| 3fb4_A | 216 | Adenylate kinase; psychrophIle, phosphotransferase | 80.93 | |
| 3b9p_A | 297 | CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc | 80.93 | |
| 3be4_A | 217 | Adenylate kinase; malaria, cryptosporidium parvum | 80.93 | |
| 2w00_A | 1038 | HSDR, R.ECOR124I; ATP-binding, DNA-binding, restri | 80.7 | |
| 3a00_A | 186 | Guanylate kinase, GMP kinase; domain movement, dim | 80.64 | |
| 2r6a_A | 454 | DNAB helicase, replicative helicase; replication, | 80.63 | |
| 1via_A | 175 | Shikimate kinase; structural genomics, transferase | 80.61 | |
| 3umf_A | 217 | Adenylate kinase; rossmann fold, transferase; 2.05 | 80.47 | |
| 1uf9_A | 203 | TT1252 protein; P-loop, nucleotide binding domain, | 80.4 | |
| 3hu3_A | 489 | Transitional endoplasmic reticulum ATPase; VCP, tr | 80.39 | |
| 2oap_1 | 511 | GSPE-2, type II secretion system protein; hexameri | 80.33 | |
| 1ukz_A | 203 | Uridylate kinase; transferase; HET: ADP AMP; 1.90A | 80.3 | |
| 2bwj_A | 199 | Adenylate kinase 5; phosphoryl transfer reaction, | 80.19 | |
| 3tif_A | 235 | Uncharacterized ABC transporter ATP-binding prote; | 80.12 | |
| 2z43_A | 324 | DNA repair and recombination protein RADA; archaea | 80.01 | |
| 3h1t_A | 590 | Type I site-specific restriction-modification syst | 80.01 |
| >3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} | Back alignment and structure |
|---|
Probab=100.00 E-value=7.9e-50 Score=370.45 Aligned_cols=142 Identities=35% Similarity=0.570 Sum_probs=123.9
Q ss_pred CCCchHHHHHHHHHHHHHcCceEEEEeeccCCCCCCCceeeccCCceeeeecCChhhhccc-CCCccEEEEccccChH-H
Q psy8456 9 RINPYIVHFCRRIRRYQYANYRCMIVRYAKDDRYDTEKVATHDQQKLTAVSAVELNKLIPH-TKDIDVIGIDEGQFFP-D 86 (353)
Q Consensus 9 ~~~GKSteLLrr~~ry~~agkkvlv~Kp~iDtRy~~~~I~Sr~G~~~~Ai~i~~l~ei~~~-~~~~dvV~IDEaQFF~-d 86 (353)
.-|||||+||++++||..+|++|++|||++|+||+.+.|+||+|++++|+.+.++.++... .+++|||+|||||||+ +
T Consensus 37 M~sGKTT~Llr~~~r~~~~g~kvli~kp~~D~R~~~~~I~Sr~G~~~~a~~v~~~~di~~~i~~~~dvV~IDEaQFf~~~ 116 (219)
T 3e2i_A 37 MFSGKSEELIRRLRRGIYAKQKVVVFKPAIDDRYHKEKVVSHNGNAIEAINISKASEIMTHDLTNVDVIGIDEVQFFDDE 116 (219)
T ss_dssp TTSCHHHHHHHHHHHHHHTTCCEEEEEEC-----------CBTTBCCEEEEESSGGGGGGSCCTTCSEEEECCGGGSCTH
T ss_pred CCCCHHHHHHHHHHHHHHcCCceEEEEeccCCcchhhhHHHhcCCceeeEEeCCHHHHHHHHhcCCCEEEEechhcCCHH
Confidence 3689999999999999999999999999999999999999999999999999998888754 4789999999999998 7
Q ss_pred HHHHHHHHHhCCCEEEEEecccccccCCchhHhhhhccccceEeccceeccccccccccccccc
Q psy8456 87 VVSFAESMANAGKIVVVAALDGTFQRTGFNDILSLIPLAECVEKLTAVCMSCFRDAAFTKRIGQ 150 (353)
Q Consensus 87 Iv~l~~~l~~~G~~VivaGLd~DFr~~pF~~~~~Ll~lAD~I~kL~AvC~~CG~~A~f~~Ri~g 150 (353)
++++++.+++.|++|||||||+||+++||+++++||++||+|+||+|+|++||++|+||+|+++
T Consensus 117 ~v~~l~~la~~gi~Vi~~GLd~DF~~~~F~~~~~Ll~~Ad~v~kl~aiC~~CG~~A~~~~R~~~ 180 (219)
T 3e2i_A 117 IVSIVEKLSADGHRVIVAGLDMDFRGEPFEPMPKLMAVSEQVTKLQAVCAVCGSSSSRTQRLIN 180 (219)
T ss_dssp HHHHHHHHHHTTCEEEEEEESBCTTSCBCTTHHHHHHHCSEEEEECEECTTTCSEECEEEEEET
T ss_pred HHHHHHHHHHCCCEEEEeecccccccCCCccHHHHHHhcceEEEeeeEccCCCCcceEEEEEEC
Confidence 9999998899999999999999999999999999999999999999999999999999999865
|
| >1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* | Back alignment and structure |
|---|
| >3e2i_A Thymidine kinase; Zn-binding, ATP-binding, DNA synthesis, nucleotide-B transferase; HET: MSE; 2.01A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >1w4r_A Thymidine kinase; type II, human, cytosolic, phosphorylation, transferase; HET: TTP; 1.83A {Homo sapiens} PDB: 1xbt_A* 2wvj_A* 2j87_A* | Back alignment and structure |
|---|
| >2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* | Back alignment and structure |
|---|
| >2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 | Back alignment and structure |
|---|
| >1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 | Back alignment and structure |
|---|
| >2j9r_A Thymidine kinase; TK1, DNK, lasso, transferase, ATP-binding, deoxyribonucleoside kinase, DNA synthesis, phosphate accept nucleotide-binding; HET: THM; 2.7A {Bacillus anthracis} PDB: 2ja1_A* | Back alignment and structure |
|---|
| >2orv_A Thymidine kinase; TP4A (P1-(5'-adenosyl)P4-(5'- (2'deoxythymidil))tetraphosphate, transferase; HET: 4TA; 2.30A {Homo sapiens} SCOP: c.37.1.24 g.39.1.14 | Back alignment and structure |
|---|
| >1xx6_A Thymidine kinase; NESG, northeast structural genomics consortium, protein STRU initiative, PSI, structural genomics, DNA synthesis; HET: ADP; 2.00A {Clostridium acetobutylicum} SCOP: c.37.1.24 g.39.1.14 | Back alignment and structure |
|---|
| >2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* | Back alignment and structure |
|---|
| >2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* | Back alignment and structure |
|---|
| >2orw_A Thymidine kinase; TMTK, TP4A, transferase; HET: 4TA; 1.50A {Thermotoga maritima} PDB: 2qpo_A 2qq0_A* 2qqe_A* | Back alignment and structure |
|---|
| >2b8t_A Thymidine kinase; deoxyribonucleoside kinase, zinc-binding domain, TK1, UU-TK, transferase; HET: THM; 2.00A {Ureaplasma parvum} SCOP: c.37.1.24 g.39.1.14 PDB: 2uz3_A* | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* | Back alignment and structure |
|---|
| >1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* | Back alignment and structure |
|---|
| >1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 | Back alignment and structure |
|---|
| >1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A* | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... | Back alignment and structure |
|---|
| >2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} | Back alignment and structure |
|---|
| >2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* | Back alignment and structure |
|---|
| >2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* | Back alignment and structure |
|---|
| >3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} | Back alignment and structure |
|---|
| >3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* | Back alignment and structure |
|---|
| >2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A | Back alignment and structure |
|---|
| >2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} | Back alignment and structure |
|---|
| >3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >3io5_A Recombination and repair protein; storage dimer, inactive conformation, RECA like core domain, binding, DNA damage, DNA recombination; 2.40A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} | Back alignment and structure |
|---|
| >1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* | Back alignment and structure |
|---|
| >2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A | Back alignment and structure |
|---|
| >1hv8_A Putative ATP-dependent RNA helicase MJ0669; RNA-binding protein, ATPase, RNA binding protein; 3.00A {Methanocaldococcus jannaschii} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >1xjc_A MOBB protein homolog; structural genomics, midwest center for structural GEN PSI, protein structure initiative, MCSG; 2.10A {Geobacillus stearothermophilus} SCOP: c.37.1.10 | Back alignment and structure |
|---|
| >1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 | Back alignment and structure |
|---|
| >2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A | Back alignment and structure |
|---|
| >1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A | Back alignment and structure |
|---|
| >3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* | Back alignment and structure |
|---|
| >1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* | Back alignment and structure |
|---|
| >2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} | Back alignment and structure |
|---|
| >3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* | Back alignment and structure |
|---|
| >2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A | Back alignment and structure |
|---|
| >3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} | Back alignment and structure |
|---|
| >2z0m_A 337AA long hypothetical ATP-dependent RNA helicase DEAD; ATP-binding, hydrolase, nucleotide-binding, RNA binding protein, structural genomics; 1.90A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A | Back alignment and structure |
|---|
| >1vec_A ATP-dependent RNA helicase P54; DEAD-box protein, RNA binding protein; HET: TLA; 2.01A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* | Back alignment and structure |
|---|
| >2pl3_A Probable ATP-dependent RNA helicase DDX10; DEAD, structural genomics, structural genomic consortium, SGC, hydrolase; HET: ADP; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >2r8r_A Sensor protein; KDPD, PFAM02702, MCSG, structural genomics, protein structure initiative, midwest center for structural genomics, kinase; 2.30A {Pseudomonas syringae PV} | Back alignment and structure |
|---|
| >3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} | Back alignment and structure |
|---|
| >2yvu_A Probable adenylyl-sulfate kinase; transferase, structural genomics, NPPSFA, national P protein structural and functional analyses; 2.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >1s2m_A Putative ATP-dependent RNA helicase DHH1; ATP-binding, RNA-binding, RNA binding protein; 2.10A {Saccharomyces cerevisiae} SCOP: c.37.1.19 c.37.1.19 PDB: 2wax_A* 2way_A | Back alignment and structure |
|---|
| >2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B | Back alignment and structure |
|---|
| >3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} | Back alignment and structure |
|---|
| >3pey_A ATP-dependent RNA helicase DBP5; RECA, DEAD-BOX, ATPase, helicase, mRNA-export, nuclear pore, hydrolase-RNA complex; HET: ADP; 1.40A {Saccharomyces cerevisiae} PDB: 3pew_A* 3pex_A* 3pez_A* 3rrm_A* 3rrn_A* 2kbe_A 3gfp_A 2kbf_A 3pev_A* 3peu_A* | Back alignment and structure |
|---|
| >2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >2va8_A SSO2462, SKI2-type helicase; hydrolase, DNA repair, ATP-bindin nucleotide-binding; 2.30A {Sulfolobus solfataricus} | Back alignment and structure |
|---|
| >3lw7_A Adenylate kinase related protein (ADKA-like); AMP, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: AMP; 2.30A {Sulfolobus solfataricus} PDB: 3h0k_A | Back alignment and structure |
|---|
| >3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* | Back alignment and structure |
|---|
| >2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* | Back alignment and structure |
|---|
| >2dr3_A UPF0273 protein PH0284; RECA superfamily ATPase, hexamer, structural genomics; HET: ADP; 2.00A {Pyrococcus horikoshii} | Back alignment and structure |
|---|
| >1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 | Back alignment and structure |
|---|
| >2zj8_A DNA helicase, putative SKI2-type helicase; RECA fold, ATP-binding, hydrolase, nucleotide- binding; 2.00A {Pyrococcus furiosus} PDB: 2zj5_A* 2zj2_A 2zja_A* | Back alignment and structure |
|---|
| >4a2p_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.00A {Anas platyrhynchos} PDB: 4a36_A* | Back alignment and structure |
|---|
| >1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3eiq_A Eukaryotic initiation factor 4A-I; PDCD4, anti-oncogene, apoptosis, cell cycle, nucleus, phosph RNA-binding, ATP-binding, helicase, hydrolase; 3.50A {Homo sapiens} | Back alignment and structure |
|---|
| >3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} | Back alignment and structure |
|---|
| >1nks_A Adenylate kinase; thermophilic, transferase; HET: AMP ADP; 2.57A {Sulfolobus acidocaldarius} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1z63_A Helicase of the SNF2/RAD54 hamily; protein-DNA complex, hydrolase/DNA complex complex; 3.00A {Sulfolobus solfataricus} SCOP: c.37.1.19 c.37.1.19 PDB: 1z6a_A | Back alignment and structure |
|---|
| >3tbk_A RIG-I helicase domain; DECH helicase, ATP binding, hydrolase; HET: ANP; 2.14A {Mus musculus} | Back alignment and structure |
|---|
| >1ex7_A Guanylate kinase; substrate-induced FIT, domain movement, GMP, ATP, substrate specificity, X-RAY diffraction, transferase; HET: 5GP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1ex6_A* 1gky_A* 3sqk_A 4f4j_A | Back alignment and structure |
|---|
| >1qde_A EIF4A, translation initiation factor 4A; DEAD box protein family, gene regulation; 2.00A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 1qva_A | Back alignment and structure |
|---|
| >3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A | Back alignment and structure |
|---|
| >1t6n_A Probable ATP-dependent RNA helicase; RECA-like fold, PRE-mRNA processing protein; HET: FLC; 1.94A {Homo sapiens} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3uie_A Adenylyl-sulfate kinase 1, chloroplastic; rossmann fold, transferase-transferase complex; HET: ADX ANP; 1.79A {Arabidopsis thaliana} SCOP: c.37.1.0 PDB: 4fxp_A* | Back alignment and structure |
|---|
| >2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* | Back alignment and structure |
|---|
| >2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} | Back alignment and structure |
|---|
| >2ykg_A Probable ATP-dependent RNA helicase DDX58; hydrolase, innate immunity; 2.50A {Homo sapiens} PDB: 3tmi_A* | Back alignment and structure |
|---|
| >3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* | Back alignment and structure |
|---|
| >2p6r_A Afuhel308 helicase; protein-DNA complex, SF2 helicase, archaeal helicase, DNA repair,, DNA binding protein/DNA complex; 3.00A {Archaeoglobus fulgidus} SCOP: a.4.5.43 a.289.1.2 c.37.1.19 c.37.1.19 PDB: 2p6u_A | Back alignment and structure |
|---|
| >1wrb_A DJVLGB; RNA helicase, DEAD BOX, VASA, structural genomics, NPPSFA, N project on protein structural and functional analyses; 2.40A {Dugesia japonica} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3dmq_A RNA polymerase-associated protein RAPA; SWF2/SNF2, transcription factor, RNA polymerase recycling, activator, ATP-binding, DNA-binding; 3.20A {Escherichia coli K12} | Back alignment and structure |
|---|
| >2qor_A Guanylate kinase; phosphotransferase, purine metabolism, structural genomics, structural genomics of pathogenic protozoa consortium; HET: 5GP POP; 1.80A {Plasmodium vivax} | Back alignment and structure |
|---|
| >1xti_A Probable ATP-dependent RNA helicase P47; alpha-beta fold, gene regulation; 1.95A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 1xtj_A* 1xtk_A | Back alignment and structure |
|---|
| >3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* | Back alignment and structure |
|---|
| >2pez_A Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthetase 1 (PAPS synthetase...; NMP-kinase fold, protein in complex with nucleic acid; HET: GGZ DAT; 1.40A {Homo sapiens} PDB: 2pey_A* 2ax4_A* | Back alignment and structure |
|---|
| >1nn5_A Similar to deoxythymidylate kinase (thymidylate K; P-loop, D4TMP, transferase; HET: 2DT ANP; 1.50A {Homo sapiens} SCOP: c.37.1.1 PDB: 1e2e_A* 1e2d_A* 1e2g_A* 1e2q_A* 1e99_A* 1e9a_A* 1e9b_A* 1nmx_A* 1nmz_A* 1nn0_A* 1nn1_A* 1e2f_A* 1nn3_A* 2xx3_A* 1e9c_A* 1e9d_A* 1e9e_A* 1e98_A* 1nmy_A* 1e9f_A* | Back alignment and structure |
|---|
| >1qhx_A CPT, protein (chloramphenicol phosphotransferase); kinase, antibiotic resistance, phosphorylation, mononucleoti binding fold; HET: ATP; 2.50A {Streptomyces venezuelae} SCOP: c.37.1.3 PDB: 1grr_A* 1grq_A 1qhs_A* 1qhn_A* 1qhy_A* | Back alignment and structure |
|---|
| >1fuu_A Yeast initiation factor 4A; IF4A, helicase, DEAD-box protein, translation; 2.50A {Saccharomyces cerevisiae} SCOP: c.37.1.19 PDB: 2vso_A* 2vsx_A* | Back alignment and structure |
|---|
| >2pbr_A DTMP kinase, thymidylate kinase; transferase, nucleotide biosynthesis, TMP-binding, A binding, structural genomics, NPPSFA; 1.96A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* | Back alignment and structure |
|---|
| >3bor_A Human initiation factor 4A-II; translation initiation, DEAD BOX, structural genomics, helic binding, HOST-virus interaction, hydrolase; 1.85A {Homo sapiens} PDB: 2g9n_A* | Back alignment and structure |
|---|
| >3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >2wwf_A Thymidilate kinase, putative; transferase, malaria; HET: TMP ADP; 1.89A {Plasmodium falciparum} PDB: 2wwg_A* 2wwh_A* 2wwi_A* | Back alignment and structure |
|---|
| >1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 | Back alignment and structure |
|---|
| >4gl2_A Interferon-induced helicase C domain-containing P; MDA5, dsRNA, anti-viral signaling, RIG-I, MAVS, oligomerizat helicase, ATPase; HET: ANP; 3.56A {Homo sapiens} | Back alignment and structure |
|---|
| >1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >3eph_A TRNA isopentenyltransferase; transferase, alternative initiation, ATP-binding, cytoplasm, mitochondrion, nucleotide-binding, nucleus; 2.95A {Saccharomyces cerevisiae} PDB: 3epj_A 3epk_A* 3epl_A* | Back alignment and structure |
|---|
| >2i4i_A ATP-dependent RNA helicase DDX3X; DEAD, structural genomics, SGC, structural GE consortium, hydrolase; HET: AMP; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >4b3f_X DNA-binding protein smubp-2; hydrolase, helicase; 2.50A {Homo sapiens} PDB: 4b3g_A | Back alignment and structure |
|---|
| >2j0s_A ATP-dependent RNA helicase DDX48; mRNA processing, phosphorylation, rRNA processing, mRNA splicing, mRNA transport; HET: ANP; 2.21A {Homo sapiens} SCOP: c.37.1.19 c.37.1.19 PDB: 2j0q_A* 2hyi_C* 3ex7_C* 2xb2_A* 2hxy_A 2j0u_A 2j0u_B 2zu6_A | Back alignment and structure |
|---|
| >1rif_A DAR protein, DNA helicase UVSW; bacteriophage, RECG, SF2, DNA binding protein; HET: DNA; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.23 | Back alignment and structure |
|---|
| >3fmp_B ATP-dependent RNA helicase DDX19B; nuclear porin, nuclear pore complex, nucleocytoplasmic trans mRNA export, protein interaction, beta-propeller; HET: ADP; 3.19A {Homo sapiens} | Back alignment and structure |
|---|
| >3l9o_A ATP-dependent RNA helicase DOB1; REC-A fold, winged-helix-turn-helix, antiparallel-coiled-COI domain, ATP-binding, helicase, hydrolase; 3.39A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1m7g_A Adenylylsulfate kinase; APS kinase, transferase, sulfate Met nucleotide 2 kinase; HET: AV2 ADX ADP; 1.43A {Penicillium chrysogenum} SCOP: c.37.1.4 PDB: 1d6j_A* 1m7h_A* 3cr7_A* | Back alignment and structure |
|---|
| >1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* | Back alignment and structure |
|---|
| >3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} | Back alignment and structure |
|---|
| >1gm5_A RECG; helicase, replication restart; HET: DNA ADP; 3.24A {Thermotoga maritima} SCOP: a.24.21.1 b.40.4.9 c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >4a4z_A Antiviral helicase SKI2; hydrolase, ATPase, mRNA degradation, exosome; HET: ANP; 2.40A {Saccharomyces cerevisiae} PDB: 4a4k_A | Back alignment and structure |
|---|
| >3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} | Back alignment and structure |
|---|
| >2plr_A DTMP kinase, probable thymidylate kinase; TMP-binding, ATP-binding, structural GEN NPPSFA; HET: 1PE PGE EPE PG4; 1.60A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >4a2q_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.40A {Anas platyrhynchos} | Back alignment and structure |
|---|
| >1kht_A Adenylate kinase; phosphotransferase, signaling protein, transferase; HET: AMP; 2.50A {Methanococcus voltae} SCOP: c.37.1.1 PDB: 3h86_B* 1ki9_A | Back alignment and structure |
|---|
| >1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* | Back alignment and structure |
|---|
| >3crm_A TRNA delta(2)-isopentenylpyrophosphate transferase; ATP-binding, nucleotide-binding, nucleotidyltransferase, tRNA processing; 1.90A {Pseudomonas aeruginosa} PDB: 3crq_A 3crr_A | Back alignment and structure |
|---|
| >2xgj_A ATP-dependent RNA helicase DOB1; hydrolase-RNA complex, hydrolase, tramp, exosome, DEAD, nucleotide-binding; HET: ADP; 2.90A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* | Back alignment and structure |
|---|
| >3o8b_A HCV NS3 protease/helicase; ntpase, RNA, translocation, protein-RNA compl protease/ntpase/helicase, hydrolase; 1.95A {Hepatitis c virus} PDB: 3o8c_A* 3o8d_A* 3o8r_A* 4b71_A* 4b73_A* 4b74_A* 4b76_A* 4b75_A* 4a92_A* 1cu1_A 4b6e_A* 4b6f_A* 2zjo_A* 1a1v_A* 1hei_A 3kqn_A* 3kql_A* 3kqu_A* 3kqh_A 3kqk_A ... | Back alignment and structure |
|---|
| >1wp9_A ATP-dependent RNA helicase, putative; ATPase, DNA replication, DNA repair, DNA recombina hydrolase; 2.90A {Pyrococcus furiosus} SCOP: c.37.1.19 c.37.1.19 | Back alignment and structure |
|---|
| >3exa_A TRNA delta(2)-isopentenylpyrophosphate transferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 2.30A {Bacillus halodurans} PDB: 2qgn_A | Back alignment and structure |
|---|
| >3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* | Back alignment and structure |
|---|
| >4eaq_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, MTBI, transferase; HET: ATM; 1.85A {Staphylococcus aureus subsp} PDB: 4dwj_A* 4f4i_A | Back alignment and structure |
|---|
| >1gtv_A TMK, thymidylate kinase; transferase, transferase (ATP:TMP phosphotransferase); HET: TYD TMP; 1.55A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1g3u_A* 1gsi_A* 1mrn_A* 1mrs_A* 1n5i_A* 1n5j_A* 1n5k_A* 1n5l_A* 1w2g_A* 1w2h_A* | Back alignment and structure |
|---|
| >2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* | Back alignment and structure |
|---|
| >4dzz_A Plasmid partitioning protein PARF; deviant walker BOX, DNA segregation, unknown function; HET: ADP; 1.80A {Escherichia coli} PDB: 4e03_A* 4e07_A* 4e09_A* | Back alignment and structure |
|---|
| >2v54_A DTMP kinase, thymidylate kinase; nucleotide biosynthesis, ATP-binding, nucleotide-binding, poxvirus, transferase; HET: TYD POP; 2.4A {Vaccinia virus copenhagen} PDB: 2w0s_A* | Back alignment and structure |
|---|
| >2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* | Back alignment and structure |
|---|
| >3foz_A TRNA delta(2)-isopentenylpyrophosphate transferas; nucleoside modification, isopentenyl-tRNA transferase, transferase-RNA complex; 2.50A {Escherichia coli k-12} PDB: 2zxu_A* 2zm5_A | Back alignment and structure |
|---|
| >1p5z_B DCK, deoxycytidine kinase; nucleoside kinase, P-loop, ARAC, cytarabine, transferase; HET: AR3 ADP; 1.60A {Homo sapiens} SCOP: c.37.1.1 PDB: 1p60_A* 1p61_B* 1p62_B* 2a7q_A* 2qrn_A* 2qro_A* 3exk_A* 3hp1_A* 2no7_A* 2no1_A* 2no6_A* 2no0_A* 2no9_A* 2noa_A* 2zi5_A* 2zi4_A* 2zi6_A* 2zi7_B* 2zia_A* 3kfx_A* ... | Back alignment and structure |
|---|
| >2oca_A DAR protein, ATP-dependent DNA helicase UVSW; ATP-dependant helicase, T4-bacteriophage, recombination, hydrolase; 2.70A {Enterobacteria phage T4} | Back alignment and structure |
|---|
| >2r2a_A Uncharacterized protein; zonular occludens toxin, structural genomics, APC84050.2, PS protein structure initiative; HET: MSE; 1.82A {Neisseria meningitidis MC58} | Back alignment and structure |
|---|
| >2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 | Back alignment and structure |
|---|
| >1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 | Back alignment and structure |
|---|
| >2jlq_A Serine protease subunit NS3; ribonucleoprotein, nucleotide-binding, viral nucleoprotein, endoplasmic reticulum, helicase, hydrolase; 1.67A {Dengue virus 4} PDB: 2jly_A* 2jls_A* 2jlu_A 2jlv_A* 2jlw_A 2jlx_A* 2jlz_A* 2jlr_A* 2bmf_A 2bhr_A | Back alignment and structure |
|---|
| >3rc3_A ATP-dependent RNA helicase SUPV3L1, mitochondrial; SUV3, nucleus, hydrolase; HET: ANP; 2.08A {Homo sapiens} PDB: 3rc8_A | Back alignment and structure |
|---|
| >3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} | Back alignment and structure |
|---|
| >1yrb_A ATP(GTP)binding protein; GTPase, P-loop, rossman fold, GDP, HYDR; HET: GDP; 1.75A {Pyrococcus abyssi} SCOP: c.37.1.10 PDB: 1yr6_A* 1yr8_A* 1yr9_A* 1yra_A* 1yr7_A* 2oxr_A* | Back alignment and structure |
|---|
| >1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 | Back alignment and structure |
|---|
| >1np6_A Molybdopterin-guanine dinucleotide biosynthesis protein B; mixed alpha-beta fold, elongated beta-sheet, walker A motif, P-loop structural motif; 1.90A {Escherichia coli} SCOP: c.37.1.10 PDB: 1p9n_A | Back alignment and structure |
|---|
| >1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* | Back alignment and structure |
|---|
| >4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} | Back alignment and structure |
|---|
| >1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* | Back alignment and structure |
|---|
| >3kb2_A SPBC2 prophage-derived uncharacterized protein YORR; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; HET: G3D; 2.20A {Bacillus subtilis} SCOP: c.37.1.1 PDB: 2axp_A* | Back alignment and structure |
|---|
| >3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} | Back alignment and structure |
|---|
| >1kag_A SKI, shikimate kinase I; transferase, structural genomics, PSI, protein structure initiative; 2.05A {Escherichia coli} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >2v6i_A RNA helicase; membrane, hydrolase, transmembrane, RNA replication, viral replication, nucleotide-binding; 2.10A {Kokobera virus} PDB: 2v6j_A | Back alignment and structure |
|---|
| >1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2gno_A DNA polymerase III, gamma subunit-related protein; structural genomics, joint center for structural genomics, J protein structure initiative; HET: DNA; 2.00A {Thermotoga maritima} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >3a4m_A L-seryl-tRNA(SEC) kinase; P-loop motif, walker A motif, ATP binding motif, ATP- binding, nucleotide-binding, transferase; HET: ADP; 1.79A {Methanocaldococcus jannaschii} PDB: 3a4l_A* 3a4n_A 3am1_A* 3add_A* 3adc_A* 3adb_A* | Back alignment and structure |
|---|
| >2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... | Back alignment and structure |
|---|
| >4ddu_A Reverse gyrase; topoisomerase, DNA supercoiling, archaea, helicase, hydrolas; 3.00A {Thermotoga maritima} PDB: 4ddt_A 4ddv_A 4ddw_A 4ddx_A | Back alignment and structure |
|---|
| >3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >4edh_A DTMP kinase, thymidylate kinase; structural genomics, PSI-biology; HET: TMP ADP; 1.32A {Pseudomonas aeruginosa PAO1} PDB: 4e5u_A* 4esh_A* 4gmd_A* 3uwk_A* 3uwo_A* 3uxm_A* | Back alignment and structure |
|---|
| >2db3_A ATP-dependent RNA helicase VASA; DEAD-BOX, protein-RNA complex, ATPase, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.20A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >1gku_B Reverse gyrase, TOP-RG; topoisomerase, DNA supercoiling, archaea, helicase; 2.7A {Archaeoglobus fulgidus} SCOP: c.37.1.16 c.37.1.16 e.10.1.1 PDB: 1gl9_B* | Back alignment and structure |
|---|
| >2whx_A Serine protease/ntpase/helicase NS3; transcription, hydrolase, ATP-binding, reticulum, nucleotidyltransferase, multifunctional enzyme; HET: ADP; 2.20A {Dengue virus 4} PDB: 2vbc_A 2wzq_A | Back alignment and structure |
|---|
| >3hjn_A DTMP kinase, thymidylate kinase; ATP-binding, nucleotide biosynth nucleotide-binding, transferase, structural genomics; HET: ADP TYD; 2.10A {Thermotoga maritima} | Back alignment and structure |
|---|
| >1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1e9r_A Conjugal transfer protein TRWB; coupling protein, bacterial conjugation, F1-ATPase-like quaternary structure, ring helicases; 2.4A {Escherichia coli} SCOP: c.37.1.11 PDB: 1e9s_A 1gki_A* 1gl7_A* 1gl6_A* | Back alignment and structure |
|---|
| >1knq_A Gluconate kinase; ALFA/beta structure, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.17 PDB: 1ko1_A 1ko4_A 1ko5_A* 1ko8_A* 1kof_A* | Back alignment and structure |
|---|
| >2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A | Back alignment and structure |
|---|
| >3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* | Back alignment and structure |
|---|
| >4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A | Back alignment and structure |
|---|
| >3vaa_A Shikimate kinase, SK; structural genomics, center for structural genomics of infec diseases, csgid, metal binding, transferase; 1.70A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} | Back alignment and structure |
|---|
| >4a2w_A RIG-I, retinoic acid inducible protein I; hydrolase, superfamily 2 RNA helicase, ATP and dsRNA binding antiviral signalling pathway; 3.70A {Anas platyrhynchos} | Back alignment and structure |
|---|
| >3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} | Back alignment and structure |
|---|
| >2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} | Back alignment and structure |
|---|
| >1jjv_A Dephospho-COA kinase; P-loop nucleotide-binding fold, structure 2 function project, S2F, structural genomics, transferase; HET: ATP; 2.00A {Haemophilus influenzae} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* | Back alignment and structure |
|---|
| >2j41_A Guanylate kinase; GMP, GMK, transferase, ATP-binding, nucleotide- binding; HET: 5GP; 1.9A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >1y63_A LMAJ004144AAA protein; structural genomics, protein structure initiative, PSI, SGPP structural genomics of pathogenic protozoa consortium; HET: ADP; 1.70A {Leishmania major} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} | Back alignment and structure |
|---|
| >2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A | Back alignment and structure |
|---|
| >1vht_A Dephospho-COA kinase; structural genomics, transferase; HET: BA3; 1.59A {Escherichia coli} SCOP: c.37.1.1 PDB: 1vhl_A* 1viy_A 1t3h_A 1n3b_A | Back alignment and structure |
|---|
| >1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* | Back alignment and structure |
|---|
| >2rhm_A Putative kinase; P-loop containing nucleoside triphosphate hydrolases fold, S genomics, joint center for structural genomics, JCSG; HET: MSE; 1.70A {Chloroflexus aurantiacus} | Back alignment and structure |
|---|
| >3cm0_A Adenylate kinase; ATP-binding, cytoplasm, nucleotide biosynthesis, nucleotide-binding, transferase, structural genomics; 1.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A | Back alignment and structure |
|---|
| >3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >2z83_A Helicase/nucleoside triphosphatase; hydrolase, membrane, nucleotide-binding, RNA replication, transmembrane, viral protein; 1.80A {Japanese encephalitis virus} PDB: 2v8o_A 2qeq_A | Back alignment and structure |
|---|
| >2jaq_A Deoxyguanosine kinase; transferase, deoxyribonucleoside kinase; HET: DCP; 2.3A {Mycoplasma mycoides subsp} PDB: 2jat_A* 2jas_A* | Back alignment and structure |
|---|
| >3trf_A Shikimate kinase, SK; amino acid biosynthesis, transferase; 2.60A {Coxiella burnetii} | Back alignment and structure |
|---|
| >1yks_A Genome polyprotein [contains: flavivirin protease NS3 catalytic subunit]; helicase, flavivirus, DEAD-BOX, ATPase, rtpase, hydrolase; 1.80A {Yellow fever virus} SCOP: c.37.1.14 c.37.1.14 PDB: 1ymf_A* | Back alignment and structure |
|---|
| >1zak_A Adenylate kinase; ATP:AMP-phosphotransferase, transferase; HET: AP5; 3.50A {Zea mays} SCOP: c.37.1.1 g.41.2.1 | Back alignment and structure |
|---|
| >3sqw_A ATP-dependent RNA helicase MSS116, mitochondrial; RECA fold, RNA dependent ATPase, RNA helicase; HET: ANP; 1.91A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >3v9p_A DTMP kinase, thymidylate kinase; ssgcid, STRU genomics, seattle structural genomics center for infectious transferase; 1.90A {Burkholderia thailandensis} | Back alignment and structure |
|---|
| >3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* | Back alignment and structure |
|---|
| >3iuy_A Probable ATP-dependent RNA helicase DDX53; REC-A-like, DEAD-BOX, structural genomics, structural genomi consortium, SGC, ATP-binding, hydrolase; HET: AMP; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* | Back alignment and structure |
|---|
| >2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} | Back alignment and structure |
|---|
| >1rz3_A Hypothetical protein rbstp0775; MCSG, structural genomics, PSI, protein structure initiative; 1.90A {Geobacillus stearothermophilus} SCOP: c.37.1.6 | Back alignment and structure |
|---|
| >2fwr_A DNA repair protein RAD25; DNA unwinding, XPB, DNA binding protein; HET: DNA; 2.60A {Archaeoglobus fulgidus} SCOP: c.37.1.19 c.37.1.19 PDB: 2fzl_A* | Back alignment and structure |
|---|
| >2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} | Back alignment and structure |
|---|
| >1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 | Back alignment and structure |
|---|
| >3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} | Back alignment and structure |
|---|
| >2ze6_A Isopentenyl transferase; crown GALL tumor, cytokinin biosynthesis; HET: DST AMP; 2.10A {Agrobacterium tumefaciens} PDB: 2ze5_A* 2ze7_A* 2ze8_A | Back alignment and structure |
|---|
| >2l8b_A Protein TRAI, DNA helicase I; RECD, hydrolase; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* | Back alignment and structure |
|---|
| >1a5t_A Delta prime, HOLB; zinc finger, DNA replication; 2.20A {Escherichia coli K12} SCOP: a.80.1.1 c.37.1.20 PDB: 1jr3_E* 1xxh_E* 1xxi_E* 3glf_E* 3glg_E* 3glh_E* 3gli_E* | Back alignment and structure |
|---|
| >3lv8_A DTMP kinase, thymidylate kinase; structural genomics, in diseases, center for structural genomics of infectious DISE ATP-binding; HET: ADP TMP TYD; 1.80A {Vibrio cholerae o1 biovar eltor} PDB: 3n2i_A* | Back alignment and structure |
|---|
| >3ld9_A DTMP kinase, thymidylate kinase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 2.15A {Ehrlichia chaffeensis} | Back alignment and structure |
|---|
| >1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 | Back alignment and structure |
|---|
| >3mwy_W Chromo domain-containing protein 1; SWI2/SNF2 ATPase, double chromodomains, hydrolase; HET: ATG; 3.70A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >4tmk_A Protein (thymidylate kinase); ATP:DTMP phosphotransferase, transferase; HET: T5A; 1.98A {Escherichia coli} SCOP: c.37.1.1 PDB: 5tmp_A* | Back alignment and structure |
|---|
| >1ly1_A Polynucleotide kinase; PNK, phosphatase, transferase; 2.00A {Enterobacteria phage T4} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >1kgd_A CASK, peripheral plasma membrane CASK; maguk, guanylate kinase like domain, protein binding; 1.31A {Homo sapiens} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} | Back alignment and structure |
|---|
| >3iij_A Coilin-interacting nuclear ATPase protein; alpha and beta proteins (A/B), protein binding, transferase, phosphotransferase; HET: ADP; 1.76A {Homo sapiens} SCOP: c.37.1.1 PDB: 3iik_A 3iil_A* 3iim_A* 1rkb_A | Back alignment and structure |
|---|
| >1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 | Back alignment and structure |
|---|
| >1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >1aky_A Adenylate kinase; ATP:AMP phosphotransferase, myokinase, transferase (phosphotransferase); HET: AP5; 1.63A {Saccharomyces cerevisiae} SCOP: c.37.1.1 g.41.2.1 PDB: 2aky_A* 3aky_A* 1dvr_A* | Back alignment and structure |
|---|
| >1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F | Back alignment and structure |
|---|
| >1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 | Back alignment and structure |
|---|
| >2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A | Back alignment and structure |
|---|
| >2fz4_A DNA repair protein RAD25; RECA-like domain, DNA damage recognition domain, DNA binding; HET: DNA; 2.40A {Archaeoglobus fulgidus} SCOP: c.37.1.19 | Back alignment and structure |
|---|
| >3lfu_A DNA helicase II; SF1 helicase, ATP-binding, DNA damage, DNA REP replication, DNA-binding, hydrolase, nucleotide-B SOS response; HET: DNA; 1.80A {Escherichia coli} PDB: 2is6_A* 2is2_A* 2is1_A* 2is4_A* | Back alignment and structure |
|---|
| >3t61_A Gluconokinase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium, nysgrc; 2.20A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >2if2_A Dephospho-COA kinase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; 3.00A {Aquifex aeolicus} | Back alignment and structure |
|---|
| >4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} | Back alignment and structure |
|---|
| >4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* | Back alignment and structure |
|---|
| >3tau_A Guanylate kinase, GMP kinase; structural genomics, center for structural genomics of infec diseases, csgid, putative guanylate kinase; HET: MSE; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2wv9_A Flavivirin protease NS2B regulatory subunit, FLAV protease NS3 catalytic subunit; nucleotide-binding, capsid protein; 2.75A {Murray valley encephalitis virus} | Back alignment and structure |
|---|
| >1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A | Back alignment and structure |
|---|
| >3kta_A Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xex_A* 1xew_X* | Back alignment and structure |
|---|
| >1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* | Back alignment and structure |
|---|
| >1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A | Back alignment and structure |
|---|
| >2c95_A Adenylate kinase 1; transferase, AP4A, nucleotide kinase, transferase ATP-bindi; HET: B4P; 1.71A {Homo sapiens} PDB: 1z83_A* 3adk_A | Back alignment and structure |
|---|
| >1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A | Back alignment and structure |
|---|
| >3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} | Back alignment and structure |
|---|
| >2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} | Back alignment and structure |
|---|
| >3c8u_A Fructokinase; YP_612366.1, putative fructose transport system kinase, STRU genomics, joint center for structural genomics, JCSG; 1.95A {Silicibacter SP} | Back alignment and structure |
|---|
| >2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A | Back alignment and structure |
|---|
| >3oiy_A Reverse gyrase helicase domain; topoisomerase, DNA supercoiling, archaea, isomeras; 2.35A {Thermotoga maritima} PDB: 3p4y_A 3p4x_A* | Back alignment and structure |
|---|
| >1e4v_A Adenylate kinase; transferase(phosphotransferase); HET: AP5; 1.85A {Escherichia coli} SCOP: c.37.1.1 g.41.2.1 PDB: 1e4y_A* 1ake_A* 1ank_A* 2eck_A* 3hpq_A* 4ake_A 3hpr_A* | Back alignment and structure |
|---|
| >2xb4_A Adenylate kinase; ATP-binding, nucleotide-binding, transferase; HET: SRT; 1.80A {Desulfovibrio gigas} PDB: 3l0s_A* 3l0p_A* | Back alignment and structure |
|---|
| >4e22_A Cytidylate kinase; P-loop, CMP/ATP binding, transferase; 2.32A {Yersinia pseudotuberculosis} | Back alignment and structure |
|---|
| >3fb4_A Adenylate kinase; psychrophIle, phosphotransferase, ATP-binding, nucleotide-binding, transferase; HET: AP5; 2.00A {Marinibacillus marinus} | Back alignment and structure |
|---|
| >3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} | Back alignment and structure |
|---|
| >3be4_A Adenylate kinase; malaria, cryptosporidium parvum nonprotein inhibitors, nucleotide-binding, transferase; HET: AP5; 1.60A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >2w00_A HSDR, R.ECOR124I; ATP-binding, DNA-binding, restriction system, helicase, HYDR R.ECOR124I, nucleotide-binding; HET: ATP; 2.6A {Escherichia coli} PDB: 2y3t_A* 2w74_B* | Back alignment and structure |
|---|
| >2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A | Back alignment and structure |
|---|
| >1via_A Shikimate kinase; structural genomics, transferase; HET: MSE; 1.57A {Campylobacter jejuni} SCOP: c.37.1.2 | Back alignment and structure |
|---|
| >3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} | Back alignment and structure |
|---|
| >1uf9_A TT1252 protein; P-loop, nucleotide binding domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ATP; 2.80A {Thermus thermophilus} SCOP: c.37.1.1 | Back alignment and structure |
|---|
| >3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* | Back alignment and structure |
|---|
| >2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 | Back alignment and structure |
|---|
| >1ukz_A Uridylate kinase; transferase; HET: ADP AMP; 1.90A {Saccharomyces cerevisiae} SCOP: c.37.1.1 PDB: 1uky_A* | Back alignment and structure |
|---|
| >2bwj_A Adenylate kinase 5; phosphoryl transfer reaction, transferase; HET: AMP; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* | Back alignment and structure |
|---|
| >2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* | Back alignment and structure |
|---|
| >3h1t_A Type I site-specific restriction-modification system, R (restriction) subunit; hydrolase, restriction enzyme HSDR, ATP-binding; 2.30A {Vibrio vulnificus} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 353 | ||||
| d1xx6a1 | 141 | c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-termi | 3e-26 | |
| d1xx6a1 | 141 | c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-termi | 3e-19 | |
| d1xbta1 | 133 | c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-term | 3e-26 | |
| d1xbta1 | 133 | c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-term | 3e-21 | |
| d2b8ta1 | 139 | c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-term | 2e-25 | |
| d2b8ta1 | 139 | c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-term | 4e-19 | |
| d1xbta2 | 41 | g.39.1.14 (A:151-191) Thymidine kinase, TK1, C-ter | 5e-04 | |
| d1xbta2 | 41 | g.39.1.14 (A:151-191) Thymidine kinase, TK1, C-ter | 6e-04 | |
| d1xx6a2 | 49 | g.39.1.14 (A:143-191) Thymidine kinase, TK1, C-ter | 6e-04 | |
| d2b8ta2 | 67 | g.39.1.14 (A:150-216) Thymidine kinase, TK1, C-ter | 0.001 | |
| d2b8ta2 | 67 | g.39.1.14 (A:150-216) Thymidine kinase, TK1, C-ter | 0.002 |
| >d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} Length = 141 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Type II thymidine kinase domain: Thymidine kinase, TK1, N-terminal domain species: Clostridium acetobutylicum [TaxId: 1488]
Score = 99.8 bits (248), Expect = 3e-26
Identities = 48/176 (27%), Positives = 79/176 (44%), Gaps = 46/176 (26%)
Query: 153 EVILGPMFSGKTTELIRRIRRYQYANYRCMIVRYAKDDRYDTEKVSTHDQQKLTAVSAVE 212
EVI+GPM+SGK+ ELIRRIRR + A + + + D+RY E V +H +K AV+
Sbjct: 10 EVIVGPMYSGKSEELIRRIRRAKIAKQKIQVFKPEIDNRYSKEDVVSHMGEKEQAVAIKN 69
Query: 213 LNKLIPHTKD-IDVIGIDEGQFVEVIGGSDKYMAVCRECYKQKAPIKRSPFKTLANENAA 271
+++ + ++ +VI IDE QF + D+ + + + +
Sbjct: 70 SREILKYFEEDTEVIAIDEVQFFD-----DEIVEIVNKIAES------------------ 106
Query: 272 LNVPPPPEFPDVVSFAESMANAGKIVVVAALDGTFQRTGFNDILSLIPLAECVEKL 327
G+ V+ A LD F+ F I L+ +AE V+K+
Sbjct: 107 ----------------------GRRVICAGLDMDFRGKPFGPIPELMAIAEFVDKI 140
|
| >d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} Length = 141 | Back information, alignment and structure |
|---|
| >d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 133 | Back information, alignment and structure |
|---|
| >d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 133 | Back information, alignment and structure |
|---|
| >d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Length = 139 | Back information, alignment and structure |
|---|
| >d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Length = 139 | Back information, alignment and structure |
|---|
| >d1xbta2 g.39.1.14 (A:151-191) Thymidine kinase, TK1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 41 | Back information, alignment and structure |
|---|
| >d1xbta2 g.39.1.14 (A:151-191) Thymidine kinase, TK1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 41 | Back information, alignment and structure |
|---|
| >d1xx6a2 g.39.1.14 (A:143-191) Thymidine kinase, TK1, C-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} Length = 49 | Back information, alignment and structure |
|---|
| >d2b8ta2 g.39.1.14 (A:150-216) Thymidine kinase, TK1, C-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Length = 67 | Back information, alignment and structure |
|---|
| >d2b8ta2 g.39.1.14 (A:150-216) Thymidine kinase, TK1, C-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} Length = 67 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 353 | |||
| d1xx6a1 | 141 | Thymidine kinase, TK1, N-terminal domain {Clostrid | 100.0 | |
| d2b8ta1 | 139 | Thymidine kinase, TK1, N-terminal domain {Ureaplas | 100.0 | |
| d1xbta1 | 133 | Thymidine kinase, TK1, N-terminal domain {Human (H | 100.0 | |
| d1xx6a1 | 141 | Thymidine kinase, TK1, N-terminal domain {Clostrid | 100.0 | |
| d1xbta1 | 133 | Thymidine kinase, TK1, N-terminal domain {Human (H | 100.0 | |
| d2b8ta1 | 139 | Thymidine kinase, TK1, N-terminal domain {Ureaplas | 100.0 | |
| d1xbta2 | 41 | Thymidine kinase, TK1, C-terminal domain {Human (H | 98.94 | |
| d2b8ta2 | 67 | Thymidine kinase, TK1, C-terminal domain {Ureaplas | 98.9 | |
| d1xx6a2 | 49 | Thymidine kinase, TK1, C-terminal domain {Clostrid | 98.85 | |
| d1yksa1 | 140 | YFV helicase domain {Yellow fever virus [TaxId: 11 | 97.62 | |
| d2b8ta2 | 67 | Thymidine kinase, TK1, C-terminal domain {Ureaplas | 97.4 | |
| d1xx6a2 | 49 | Thymidine kinase, TK1, C-terminal domain {Clostrid | 97.39 | |
| d1a1va1 | 136 | HCV helicase domain {Human hepatitis C virus (HCV) | 97.25 | |
| d1xbta2 | 41 | Thymidine kinase, TK1, C-terminal domain {Human (H | 97.18 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 96.6 | |
| d2fz4a1 | 206 | DNA repair protein RAD25 {Archaeoglobus fulgidus [ | 96.58 | |
| d2bmfa2 | 305 | Dengue virus helicase {Dengue virus type 2 [TaxId: | 96.49 | |
| d1tf7a2 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 95.82 | |
| d1w36d1 | 359 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 95.76 | |
| d1p9ra_ | 401 | Extracellular secretion NTPase EpsE {Vibrio choler | 95.73 | |
| d1yksa1 | 140 | YFV helicase domain {Yellow fever virus [TaxId: 11 | 95.56 | |
| d1np6a_ | 170 | Molybdopterin-guanine dinucleotide biosynthesis pr | 95.4 | |
| d1khta_ | 190 | Adenylate kinase {Archaeon Methanococcus voltae [T | 95.29 | |
| d1ly1a_ | 152 | Polynucleotide kinase, kinase domain {Bacteriophag | 95.28 | |
| d1a1va1 | 136 | HCV helicase domain {Human hepatitis C virus (HCV) | 95.22 | |
| d1g5ta_ | 157 | ATP:corrinoid adenosyltransferase CobA {Salmonella | 95.12 | |
| d1xjca_ | 165 | Molybdopterin-guanine dinucleotide biosynthesis pr | 95.07 | |
| d1ls1a2 | 207 | GTPase domain of the signal sequence recognition p | 94.8 | |
| d1vmaa2 | 213 | GTPase domain of the signal recognition particle r | 94.8 | |
| d1wp9a1 | 200 | putative ATP-dependent RNA helicase PF2015 {Pyroco | 94.72 | |
| d1ye8a1 | 178 | Hypothetical kinase-like protein Aq_1292 {Aquifex | 94.68 | |
| d2p6ra3 | 202 | Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 | 94.65 | |
| d1j8yf2 | 211 | GTPase domain of the signal sequence recognition p | 94.55 | |
| d1okkd2 | 207 | GTPase domain of the signal recognition particle r | 94.45 | |
| d1nn5a_ | 209 | Thymidylate kinase {Human (Homo sapiens) [TaxId: 9 | 94.28 | |
| d1nksa_ | 194 | Adenylate kinase {Archaeon Sulfolobus acidocaldari | 94.23 | |
| d1rifa_ | 282 | DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] | 94.13 | |
| d2i3ba1 | 189 | Cancer-related NTPase, C1orf57 {Human (Homo sapien | 94.05 | |
| d2qy9a2 | 211 | GTPase domain of the signal recognition particle r | 93.79 | |
| d1zp6a1 | 176 | Hypothetical protein Atu3015 {Agrobacterium tumefa | 93.23 | |
| d1g5ta_ | 157 | ATP:corrinoid adenosyltransferase CobA {Salmonella | 92.8 | |
| d1sxjd2 | 237 | Replication factor C2 {Baker's yeast (Saccharomyce | 92.75 | |
| d2bmfa2 | 305 | Dengue virus helicase {Dengue virus type 2 [TaxId: | 92.7 | |
| d1kaga_ | 169 | Shikimate kinase (AroK) {Escherichia coli [TaxId: | 92.54 | |
| d1qhxa_ | 178 | Chloramphenicol phosphotransferase {Streptomyces v | 92.13 | |
| d1ewqa2 | 224 | DNA repair protein MutS, the C-terminal domain {Th | 91.56 | |
| d1pjra1 | 318 | DEXX box DNA helicase {Bacillus stearothermophilus | 91.51 | |
| d1gsia_ | 208 | Thymidylate kinase {Mycobacterium tuberculosis [Ta | 91.48 | |
| d1rkba_ | 173 | Adenylate kinase {Human (Homo sapiens), isoenzyme | 91.4 | |
| d1m8pa3 | 183 | ATP sulfurylase C-terminal domain {Fungus (Penicil | 91.15 | |
| d1wb9a2 | 234 | DNA repair protein MutS, the C-terminal domain {Es | 91.12 | |
| d1uaaa1 | 306 | DEXX box DNA helicase {Escherichia coli, RepD [Tax | 91.12 | |
| d1in4a2 | 238 | Holliday junction helicase RuvB {Thermotoga mariti | 91.04 | |
| g1ii8.1 | 369 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 90.99 | |
| d1nija1 | 222 | Hypothetical protein YjiA, N-terminal domain {Esch | 90.45 | |
| g1xew.1 | 329 | Smc head domain {Pyrococcus furiosus [TaxId: 2261] | 90.38 | |
| d1g6oa_ | 323 | Hexameric traffic ATPase, HP0525 {Helicobacter pyl | 90.36 | |
| g1f2t.1 | 292 | Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} | 90.36 | |
| d1mo6a1 | 269 | RecA protein, ATPase-domain {Mycobacterium tubercu | 90.13 | |
| d1knqa_ | 171 | Gluconate kinase {Escherichia coli [TaxId: 562]} | 89.96 | |
| d2gnoa2 | 198 | gamma subunit of DNA polymerase III, N-domain {The | 89.96 | |
| d1s96a_ | 205 | Guanylate kinase {Escherichia coli [TaxId: 562]} | 89.92 | |
| d1lvga_ | 190 | Guanylate kinase {Mouse (Mus musculus) [TaxId: 100 | 89.52 | |
| d1x6va3 | 195 | Adenosine-5'phosphosulfate kinase (APS kinase) {Hu | 89.44 | |
| d1yrba1 | 244 | ATP(GTP)-binding protein PAB0955 {Pyrococcus abyss | 89.44 | |
| d1cr2a_ | 277 | Gene 4 protein (g4p, DNA primase), helicase domain | 89.42 | |
| d1gkub1 | 237 | Helicase-like "domain" of reverse gyrase {Archaeon | 89.37 | |
| d1u94a1 | 263 | RecA protein, ATPase-domain {Escherichia coli [Tax | 89.31 | |
| d1byia_ | 224 | Dethiobiotin synthetase {Escherichia coli [TaxId: | 89.28 | |
| d2bdta1 | 176 | Hypothetical protein BH3686 {Bacillus halodurans [ | 89.28 | |
| d4tmka_ | 210 | Thymidylate kinase {Escherichia coli [TaxId: 562]} | 89.05 | |
| d1zaka1 | 189 | Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | 88.93 | |
| d2iyva1 | 165 | Shikimate kinase (AroK) {Mycobacterium tuberculosi | 88.85 | |
| d2cdna1 | 181 | Adenylate kinase {Mycobacterium tuberculosis [TaxI | 88.59 | |
| d1y63a_ | 174 | Probable kinase LmjF30.1890 {Leishmania major [Tax | 88.46 | |
| d1s3ga1 | 182 | Adenylate kinase {Bacillus globisporus [TaxId: 145 | 88.44 | |
| d1bifa1 | 213 | 6-phosphofructo-2-kinase/fructose-2,6-bisphosphata | 88.41 | |
| d1e4va1 | 179 | Adenylate kinase {Escherichia coli [TaxId: 562]} | 88.3 | |
| d1sxja2 | 253 | Replication factor C1 {Baker's yeast (Saccharomyce | 88.29 | |
| d1zina1 | 182 | Adenylate kinase {Bacillus stearothermophilus [Tax | 88.1 | |
| d1akya1 | 180 | Adenylate kinase {Baker's yeast (Saccharomyces cer | 87.92 | |
| d1e9ra_ | 433 | Bacterial conjugative coupling protein TrwB {Esche | 87.85 | |
| d2p6ra3 | 202 | Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 | 87.74 | |
| d1rz3a_ | 198 | Hypothetical protein rbstp0775 {Bacillus stearothe | 87.43 | |
| d1teva_ | 194 | UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606] | 87.2 | |
| d1ukza_ | 196 | Uridylate kinase {Baker's yeast (Saccharomyces cer | 86.96 | |
| d1gkya_ | 186 | Guanylate kinase {Baker's yeast (Saccharomyces cer | 86.83 | |
| d1qf9a_ | 194 | UMP/CMP kinase {Dictyostelium discoideum [TaxId: 4 | 86.79 | |
| d1l8qa2 | 213 | Chromosomal replication initiation factor DnaA {Aq | 86.75 | |
| d1lw7a2 | 192 | Transcriptional regulator NadR, ribosylnicotinamid | 86.53 | |
| d2fz4a1 | 206 | DNA repair protein RAD25 {Archaeoglobus fulgidus [ | 86.47 | |
| d1ofha_ | 309 | HslU {Haemophilus influenzae [TaxId: 727]} | 86.46 | |
| d1znwa1 | 182 | Guanylate kinase {Mycobacterium tuberculosis [TaxI | 86.37 | |
| d1nlfa_ | 274 | Hexameric replicative helicase repA {Escherichia c | 86.21 | |
| d1n0wa_ | 242 | DNA repair protein Rad51, catalytic domain {Human | 85.81 | |
| d1tf7a1 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 85.72 | |
| d1tf7a2 | 242 | Circadian clock protein KaiC {Synechococcus sp. st | 85.61 | |
| d1ak2a1 | 190 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 85.57 | |
| d1w36d1 | 359 | Exodeoxyribonuclease V alpha chain (RecD) {Escheri | 85.39 | |
| d1e32a2 | 258 | Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu | 85.17 | |
| d2qm8a1 | 323 | Metallochaperone MeaB {Methylobacterium extorquens | 85.0 | |
| d1e6ca_ | 170 | Shikimate kinase (AroK) {Erwinia chrysanthemi [Tax | 84.73 | |
| d2ak3a1 | 189 | Adenylate kinase {Cow (Bos taurus), mitochondrial | 84.51 | |
| d2p67a1 | 327 | LAO/AO transport system kinase ArgK {Escherichia c | 84.34 | |
| d1rifa_ | 282 | DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665] | 84.07 | |
| d1e69a_ | 308 | Smc head domain {Thermotoga maritima [TaxId: 2336] | 83.98 | |
| d1kgda_ | 178 | Guanylate kinase-like domain of Cask {Human (Homo | 83.76 | |
| d1viaa_ | 161 | Shikimate kinase (AroK) {Campylobacter jejuni [Tax | 83.28 | |
| d1njfa_ | 239 | delta prime subunit of DNA polymerase III, N-domai | 83.22 | |
| d1uaaa1 | 306 | DEXX box DNA helicase {Escherichia coli, RepD [Tax | 83.2 | |
| d1m7ga_ | 208 | Adenosine-5'phosphosulfate kinase (APS kinase) {Fu | 83.19 | |
| d1w44a_ | 321 | NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | 82.83 | |
| d2i1qa2 | 258 | DNA repair protein Rad51, catalytic domain {Archae | 82.71 | |
| d2eyqa3 | 233 | Transcription-repair coupling factor, TRCF {Escher | 82.33 | |
| d1pzna2 | 254 | DNA repair protein Rad51, catalytic domain {Archae | 82.19 | |
| d1szpa2 | 251 | DNA repair protein Rad51, catalytic domain {Baker' | 82.18 | |
| d1sxjc2 | 227 | Replication factor C3 {Baker's yeast (Saccharomyce | 81.91 | |
| d3adka_ | 194 | Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | 81.74 | |
| d1pjra1 | 318 | DEXX box DNA helicase {Bacillus stearothermophilus | 81.72 | |
| d1xjca_ | 165 | Molybdopterin-guanine dinucleotide biosynthesis pr | 81.58 | |
| d1lv7a_ | 256 | AAA domain of cell division protein FtsH {Escheric | 81.11 | |
| d1qhla_ | 222 | Cell division protein MukB {Escherichia coli [TaxI | 80.38 | |
| d1xp8a1 | 268 | RecA protein, ATPase-domain {Deinococcus radiodura | 80.36 | |
| d1sgwa_ | 200 | Putative ABC transporter PF0895 {Pyrococcus furios | 80.26 | |
| d1tmka_ | 214 | Thymidylate kinase {Baker's yeast (Saccharomyces c | 80.09 | |
| d1ckea_ | 225 | CMP kinase {Escherichia coli [TaxId: 562]} | 80.04 |
| >d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: P-loop containing nucleoside triphosphate hydrolases superfamily: P-loop containing nucleoside triphosphate hydrolases family: Type II thymidine kinase domain: Thymidine kinase, TK1, N-terminal domain species: Clostridium acetobutylicum [TaxId: 1488]
Probab=100.00 E-value=5.4e-43 Score=302.49 Aligned_cols=134 Identities=39% Similarity=0.600 Sum_probs=119.1
Q ss_pred ccceeeeeccCCCCchhHHHHHHHHHHHhCCEEEEEeeecCCCCCCCceeeccCcccceeecccHhhhccc-CCCccEEE
Q psy8456 149 GQEKEVILGPMFSGKTTELIRRIRRYQYANYRCMIVRYAKDDRYDTEKVSTHDQQKLTAVSAVELNKLIPH-TKDIDVIG 227 (353)
Q Consensus 149 ~geI~vi~G~M~sGKt~~Li~~~~~~~~~~~~~~~~k~~~D~R~~~~~i~s~~g~~~~a~~~~~~~~~~~~-~~~~~~i~ 227 (353)
.|++++|+|||||||||||||+++||+.+|++|++++|+.|+||+.+.++||+|.+.+|+.+.++.++... .+++|||+
T Consensus 6 ~G~l~lI~GpMfSGKTteLi~~~~~~~~~g~~vl~i~~~~D~Ry~~~~i~sh~g~~~~a~~~~~~~~~~~~~~~~~dvI~ 85 (141)
T d1xx6a1 6 HGWVEVIVGPMYSGKSEELIRRIRRAKIAKQKIQVFKPEIDNRYSKEDVVSHMGEKEQAVAIKNSREILKYFEEDTEVIA 85 (141)
T ss_dssp CCEEEEEECSTTSSHHHHHHHHHHHHHHTTCCEEEEEEC-------CEEECTTSCEEECEEESSSTHHHHHCCTTCSEEE
T ss_pred ceeEEEEEeccccHHHHHHHHHHHHhhhcCCcEEEEEeccccccccceeeecccceEEEEEecchhhhhhhhcccccEEE
Confidence 48899999999999999999999999999999999999999999999999999999999999888777643 57899999
Q ss_pred EecccccceecCCccchhhhhhhhccCCCCCcchHHHHHHHhhccCCCCCCCCcc-HHHHHHHHHhCCCEEEEEeccccc
Q psy8456 228 IDEGQFVEVIGGSDKYMAVCRECYKQKAPIKRSPFKTLANENAALNVPPPPEFPD-VVSFAESMANAGKIVVVAALDGTF 306 (353)
Q Consensus 228 IDE~QF~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~f~~-~~~~~~~~~~~g~~Vi~~gLd~df 306 (353)
|||+|| |++ +++++..+++.|++|+|||||+||
T Consensus 86 IDE~QF----------------------------------------------f~d~~~~~~~~l~~~g~~Viv~GLd~Df 119 (141)
T d1xx6a1 86 IDEVQF----------------------------------------------FDDEIVEIVNKIAESGRRVICAGLDMDF 119 (141)
T ss_dssp ECSGGG----------------------------------------------SCTHHHHHHHHHHHTTCEEEEEECSBCT
T ss_pred Eeehhh----------------------------------------------ccccHHHHHHhheeCCcEEEEEEecccc
Confidence 999999 654 788899999999999999999999
Q ss_pred cCCCchhHHhhhhcccceEEee
Q psy8456 307 QRTGFNDILSLIPLAECVEKLT 328 (353)
Q Consensus 307 ~~~~F~~~~~L~~~ad~v~kl~ 328 (353)
+|+||+++++|||+||+|+||+
T Consensus 120 ~~~~F~~~~~Ll~~Ad~v~kLk 141 (141)
T d1xx6a1 120 RGKPFGPIPELMAIAEFVDKIQ 141 (141)
T ss_dssp TSCBCTTHHHHHHHCSEEEECC
T ss_pred ccCccchHHHHHhhcCeeEECC
Confidence 9999999999999999999985
|
| >d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} | Back information, alignment and structure |
|---|
| >d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xx6a1 c.37.1.24 (A:2-142) Thymidine kinase, TK1, N-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} | Back information, alignment and structure |
|---|
| >d1xbta1 c.37.1.24 (A:18-150) Thymidine kinase, TK1, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b8ta1 c.37.1.24 (A:11-149) Thymidine kinase, TK1, N-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} | Back information, alignment and structure |
|---|
| >d1xbta2 g.39.1.14 (A:151-191) Thymidine kinase, TK1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2b8ta2 g.39.1.14 (A:150-216) Thymidine kinase, TK1, C-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} | Back information, alignment and structure |
|---|
| >d1xx6a2 g.39.1.14 (A:143-191) Thymidine kinase, TK1, C-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} | Back information, alignment and structure |
|---|
| >d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} | Back information, alignment and structure |
|---|
| >d2b8ta2 g.39.1.14 (A:150-216) Thymidine kinase, TK1, C-terminal domain {Ureaplasma urealyticum [TaxId: 2130]} | Back information, alignment and structure |
|---|
| >d1xx6a2 g.39.1.14 (A:143-191) Thymidine kinase, TK1, C-terminal domain {Clostridium acetobutylicum [TaxId: 1488]} | Back information, alignment and structure |
|---|
| >d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d1xbta2 g.39.1.14 (A:151-191) Thymidine kinase, TK1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} | Back information, alignment and structure |
|---|
| >d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1yksa1 c.37.1.14 (A:185-324) YFV helicase domain {Yellow fever virus [TaxId: 11089]} | Back information, alignment and structure |
|---|
| >d1np6a_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1khta_ c.37.1.1 (A:) Adenylate kinase {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d1ly1a_ c.37.1.1 (A:) Polynucleotide kinase, kinase domain {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1a1va1 c.37.1.14 (A:190-325) HCV helicase domain {Human hepatitis C virus (HCV), different isolates [TaxId: 11103]} | Back information, alignment and structure |
|---|
| >d1g5ta_ c.37.1.11 (A:) ATP:corrinoid adenosyltransferase CobA {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1ls1a2 c.37.1.10 (A:89-295) GTPase domain of the signal sequence recognition protein Ffh {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1vmaa2 c.37.1.10 (A:82-294) GTPase domain of the signal recognition particle receptor FtsY {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1wp9a1 c.37.1.19 (A:1-200) putative ATP-dependent RNA helicase PF2015 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1j8yf2 c.37.1.10 (F:87-297) GTPase domain of the signal sequence recognition protein Ffh {Archaeon Acidianus ambivalens [TaxId: 2283]} | Back information, alignment and structure |
|---|
| >d1okkd2 c.37.1.10 (D:97-303) GTPase domain of the signal recognition particle receptor FtsY {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1nn5a_ c.37.1.1 (A:) Thymidylate kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1nksa_ c.37.1.1 (A:) Adenylate kinase {Archaeon Sulfolobus acidocaldarius [TaxId: 2285]} | Back information, alignment and structure |
|---|
| >d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d2i3ba1 c.37.1.11 (A:1-189) Cancer-related NTPase, C1orf57 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2qy9a2 c.37.1.10 (A:285-495) GTPase domain of the signal recognition particle receptor FtsY {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} | Back information, alignment and structure |
|---|
| >d1g5ta_ c.37.1.11 (A:) ATP:corrinoid adenosyltransferase CobA {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2bmfa2 c.37.1.14 (A:178-482) Dengue virus helicase {Dengue virus type 2 [TaxId: 11060]} | Back information, alignment and structure |
|---|
| >d1kaga_ c.37.1.2 (A:) Shikimate kinase (AroK) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} | Back information, alignment and structure |
|---|
| >d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} | Back information, alignment and structure |
|---|
| >d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1gsia_ c.37.1.1 (A:) Thymidylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1rkba_ c.37.1.1 (A:) Adenylate kinase {Human (Homo sapiens), isoenzyme 6 [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m8pa3 c.37.1.15 (A:391-573) ATP sulfurylase C-terminal domain {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1nija1 c.37.1.10 (A:2-223) Hypothetical protein YjiA, N-terminal domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1knqa_ c.37.1.17 (A:) Gluconate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2gnoa2 c.37.1.20 (A:11-208) gamma subunit of DNA polymerase III, N-domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1lvga_ c.37.1.1 (A:) Guanylate kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1x6va3 c.37.1.4 (A:34-228) Adenosine-5'phosphosulfate kinase (APS kinase) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yrba1 c.37.1.10 (A:1-244) ATP(GTP)-binding protein PAB0955 {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} | Back information, alignment and structure |
|---|
| >d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1byia_ c.37.1.10 (A:) Dethiobiotin synthetase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2bdta1 c.37.1.25 (A:1-176) Hypothetical protein BH3686 {Bacillus halodurans [TaxId: 86665]} | Back information, alignment and structure |
|---|
| >d4tmka_ c.37.1.1 (A:) Thymidylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zaka1 c.37.1.1 (A:3-127,A:159-222) Adenylate kinase {Maize (Zea mays) [TaxId: 4577]} | Back information, alignment and structure |
|---|
| >d2iyva1 c.37.1.2 (A:2-166) Shikimate kinase (AroK) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d2cdna1 c.37.1.1 (A:1-181) Adenylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1y63a_ c.37.1.1 (A:) Probable kinase LmjF30.1890 {Leishmania major [TaxId: 5664]} | Back information, alignment and structure |
|---|
| >d1s3ga1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus globisporus [TaxId: 1459]} | Back information, alignment and structure |
|---|
| >d1bifa1 c.37.1.7 (A:37-249) 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase, kinase domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1e4va1 c.37.1.1 (A:1-121,A:157-214) Adenylate kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1zina1 c.37.1.1 (A:1-125,A:161-217) Adenylate kinase {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1akya1 c.37.1.1 (A:3-130,A:169-220) Adenylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1rz3a_ c.37.1.6 (A:) Hypothetical protein rbstp0775 {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1teva_ c.37.1.1 (A:) UMP/CMP kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ukza_ c.37.1.1 (A:) Uridylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1gkya_ c.37.1.1 (A:) Guanylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1qf9a_ c.37.1.1 (A:) UMP/CMP kinase {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1lw7a2 c.37.1.1 (A:220-411) Transcriptional regulator NadR, ribosylnicotinamide kinase domain {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d2fz4a1 c.37.1.19 (A:24-229) DNA repair protein RAD25 {Archaeoglobus fulgidus [TaxId: 2234]} | Back information, alignment and structure |
|---|
| >d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} | Back information, alignment and structure |
|---|
| >d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1n0wa_ c.37.1.11 (A:) DNA repair protein Rad51, catalytic domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1tf7a1 c.37.1.11 (A:14-255) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1tf7a2 c.37.1.11 (A:256-497) Circadian clock protein KaiC {Synechococcus sp. strain PCC 7942 (Anacystis nidulans R2) [TaxId: 1140]} | Back information, alignment and structure |
|---|
| >d1ak2a1 c.37.1.1 (A:14-146,A:177-233) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-2 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1e6ca_ c.37.1.2 (A:) Shikimate kinase (AroK) {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d2ak3a1 c.37.1.1 (A:0-124,A:162-225) Adenylate kinase {Cow (Bos taurus), mitochondrial izozyme-3 [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1rifa_ c.37.1.23 (A:) DNA helicase UvsW {Bacteriophage T4 [TaxId: 10665]} | Back information, alignment and structure |
|---|
| >d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1kgda_ c.37.1.1 (A:) Guanylate kinase-like domain of Cask {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1viaa_ c.37.1.2 (A:) Shikimate kinase (AroK) {Campylobacter jejuni [TaxId: 197]} | Back information, alignment and structure |
|---|
| >d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1uaaa1 c.37.1.19 (A:2-307) DEXX box DNA helicase {Escherichia coli, RepD [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1m7ga_ c.37.1.4 (A:) Adenosine-5'phosphosulfate kinase (APS kinase) {Fungus (Penicillium chrysogenum) [TaxId: 5076]} | Back information, alignment and structure |
|---|
| >d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} | Back information, alignment and structure |
|---|
| >d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} | Back information, alignment and structure |
|---|
| >d2eyqa3 c.37.1.19 (A:546-778) Transcription-repair coupling factor, TRCF {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d3adka_ c.37.1.1 (A:) Adenylate kinase {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1pjra1 c.37.1.19 (A:1-318) DEXX box DNA helicase {Bacillus stearothermophilus, PcrA [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1xjca_ c.37.1.10 (A:) Molybdopterin-guanine dinucleotide biosynthesis protein MobB {Bacillus stearothermophilus [TaxId: 1422]} | Back information, alignment and structure |
|---|
| >d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1qhla_ c.37.1.12 (A:) Cell division protein MukB {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} | Back information, alignment and structure |
|---|
| >d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1tmka_ c.37.1.1 (A:) Thymidylate kinase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ckea_ c.37.1.1 (A:) CMP kinase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|