Psyllid ID: psy852

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-
MVLLFHFLSHQVTHWQHPRFHAYFPSGNSYPSVLADMLSDAIGCIGFSWAASPSCTELETIVLDWLGKAIGLPEKFLMYPPQGKNATTPNDIDMNIEDYMTPANQPQSLGGGVIQSVQNIIVLTRGQKKIHPFVDEGVLLSKLMAYCSKEAHSCVEKAAMMAFVRLKILEPDDKNSLRGATLRQVMQQDETMGYIPFFVSTTLGTTSCCSFDNLAEIGPVAKEFDVWLHVDGAYAGSSFICPEFRPFMNGKTSFDNLHLSPIWYERPSSASECIFVCMLSARAQAISKLKKIHPFVDEGVLLSKLMAYCSKEAHSCVETRGHIQSYRDAIFDVWLHVDGAYAGSSFICPEFRPFMNGIEYADSFNVNVNKWLLTAFDSSCLWVADRYKLTSALVVDPLYLQHGHEGAIDYRHWGIPLSRRFRSLKLWFVIRTYGLSGLQKYIRRHCELAKLFEGKVRRDPRFEISNDVRSSASECIFVCMLAARAQAISKLKKIHPFVDEGVLLSKLMAYCSKEAHSCVEKAAMMAFVRLKILEPDDKNSLRGATLRQVMQQDETMGYIPFFVSTTLGTTSCYRKSQGIEYADSFNVNVNKWLLTAFDSSCLWVADRYKLTSALVVDPLYLQHGHEGAIDYRHWGIPLSRRFRSLKLWFVIRTYGLSGLQKYIRRHCELAKLFEGKVRRDPRFEISNDVRLGLVCFRLRSENNLIADQNNRKLLEDINASGRLHMVPASQEQNDEVFELQERKRKDDLAYKRSFFVRMLGLVCFRLRSENNLIADHPLQLGLVCFRLRSENNVIADQNNRKLLEDINASGRLHMVPASFELQERKRKDDLAYKRSFFVRMVSDPKIYNPKIAVATPTSRRPTCLASSAEEDEEAESDERSSEQGSYTPTWI
cHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHcccccccccccccEEEEEcccccHHHHHHHHHccccEEEEcccccccccHHHHHHHHHHHHHcccEEEEEEEccccccccccccHHHHHHHHHHcccEEEcHHHHHHccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHccccccccccccHHHHHHcccccccccccccHHcHHHHHHHcccEEEEccccccccccccccccccccccccccccccccccEEcccccEEEEEcccHHHHHHHccccccccccccccccccccccccccccccHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccccEEEEEccccccHHHHHHHHcccEEEEccccccccccHHHHHHHHHHHHHccccEEEEEEccccccccccccccccccEEEEccccccccccccEEEEEccHHHHHHHHccccccccccccccccccccccccccccccHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHccccEEEEccccEEEEEEEEEccccHHHHHHHHHHHHHHHHcccEEEEEEEEEccEEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccHHHHcHHHHHHHHHccccccccccccHHHHHHHHHHHHHHcccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccc
cccHHHEEccccccccccccEEEccccccHHHHHHHHHHHHHHHHcHHHcccHHHHHHHHHHHHHHHHHHcccHHHHcccccccccccccccccEEEccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHccHHHcHHHHHHHHHHHEEEEEccccccccccHHHHHHHHHHHHHccccEEEEEEEcccccccccccHHHHcHHHHcccEEEEEEEHHcccccccHHHHHHHHcHHHHcccccccccEEEEccccHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHcHHHHcHHEHHHHHHHHHHcHHHHcccccccccEEEEEEcccEEEEccHHHHHHHcccccEEEEcccccccccccccccccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEccHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHccHHHccHHHHHHHHHHEEEEEccccccccccHHHHHHHHHHHHHccccEEEEEEEcccHHHHHcccccEEccccccccccEEEEEEcccEEEEccHHHHHHHcccccEEEEccccccccccccccccHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHccccEEEcccEEEEEEEEEEcccccccHHHHHHHHHHHHHccccEEEEEccccccEEEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccEccEEEEccccccccccHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHEccccccccccHcccccccccccccccccccccccHcccccccccccccccc
MVLLFHFLShqvthwqhprfhayfpsgnsypSVLADMLSDAIGcigfswaaspscteLETIVLDWLGkaiglpekflmyppqgknattpndidmniedymtpanqpqslgggviQSVQNIIVLTrgqkkihpfvdEGVLLSKLMAYCSKEAHSCVEKAAMMAFVRLKilepddknslrgATLRQVMQqdetmgyipffvsttlgttsccsfdnlaeigpvakEFDVWLhvdgayagssficpefrpfmngktsfdnlhlspiwyerpssaseCIFVCMLSARAQAISKLKKIHPFVDEGVLLSKLMAYCSKEahscvetrghIQSYRDAIFDVWLHvdgayagssficpefrpfmngieyaDSFNVNVNKWLLTAfdssclwvaDRYKLTsalvvdplylqhghegaidyrhwgiplsrRFRSLKLWFVIRTYGLSGLQKYIRRHCELAKLFegkvrrdprfeisndvrssASECIFVCMLAARAQAISKLKKIHPFVDEGVLLSKLMAYCSKEAHSCVEKAAMMAFVRLKilepddknslrgATLRQVMQqdetmgyipffvsttlgttscyrksqgieyadsFNVNVNKWLLTAfdssclwvaDRYKLTsalvvdplylqhghegaidyrhwgiplsrRFRSLKLWFVIRTYGLSGLQKYIRRHCELAKLFegkvrrdprfeisndVRLGLVCFRLRSENNLIADQNNRKLLEDINasgrlhmvpasqeqNDEVFELQErkrkddlayKRSFFVRMLGLVCFRLRsennliadhplQLGLVCFRLRSENNVIADQNNRKLLEDINasgrlhmvpasfelqerkrkddlayKRSFFVRMvsdpkiynpkiavatptsrrptclassaeedeeaesdersseqgsytptwi
MVLLFHFLSHQVTHWQHPRFHAYFPSGNSYPSVLADMLSDAIGCIGFSWAASPSCTELETIVLDWLGKAIGLPEKFLMYPPQGKNATTPNDIDMNIEDYMTPANQPQSLGGGVIQSVQNIIVLTRGQKKIHPFVDEGVLLSKLMAYCSKEAHSCVEKAAMMAFVRLKIlepddknslrGATLRQVMQQDETMGYIPFFVSTTLGTTSCCSFDNLAEIGPVAKEFDVWLHVDGAYAGSSFICPEFRPFMNGKTSFDNLHLSPIWYERPSSASECIFVCMLSARAQAISKLKKIHPFVDEGVLLSKLMAYCSKEAHSCVETRGHIQSYRDAIFDVWLHVDGAYAGSSFICPEFRPFMNGIEYADSFNVNVNKWLLTAFDSSCLWVADRYKLTSALVVDPLYLQHGHEGAIDYRHWGIPLSRRFRSLKLWFVIRTYGLSGLQKYIRRHCELAKlfegkvrrdprfeisndvrssASECIFVCMLAARAQAISKLKKIHPFVDEGVLLSKLMAYCSKEAHSCVEKAAMMAFVRLKIlepddknslrGATLRQVMQQDETMGYIPFFVSTTLGTTSCYRKSQGIEYADSFNVNVNKWLLTAFDSSCLWVADRYKLTSALVVDPLYLQHGHEGAIDYRHWGIPLSRRFRSLKLWFVIRTYGLSGLQKYIRRHCELAKlfegkvrrdprfeisndvrLGLVCFRLRSennliadqnnrKLLEDINASGRLhmvpasqeqndEVFELQerkrkddlaykrSFFVRMLGLVCFRLRSENNLIADHPLQLGLVCFRLRSENNVIADQNNRKLLEDINASGRLHMVpasfelqerkrkddlayKRSFFvrmvsdpkiynpkiavatptsrrpTCLASsaeedeeaesdersseqgsytptwi
MVLLFHFLSHQVTHWQHPRFHAYFPSGNSYPSVLADMLSDAIGCIGFSWAASPSCTELETIVLDWLGKAIGLPEKFLMYPPQGKNATTPNDIDMNIEDYMTPANQPQSLGGGVIQSVQNIIVLTRGQKKIHPFVDEGVLLSKLMAYCSKEAHSCVEKAAMMAFVRLKILEPDDKNSLRGATLRQVMQQDETMGYIPFFVSTTLGTTSCCSFDNLAEIGPVAKEFDVWLHVDGAYAGSSFICPEFRPFMNGKTSFDNLHLSPIWYERPSSASECIFVCMLSARAQAISKLKKIHPFVDEGVLLSKLMAYCSKEAHSCVETRGHIQSYRDAIFDVWLHVDGAYAGSSFICPEFRPFMNGIEYADSFNVNVNKWLLTAFDSSCLWVADRYKLTSALVVDPLYLQHGHEGAIDYRHWGIPLSRRFRSLKLWFVIRTYGLSGLQKYIRRHCELAKLFEGKVRRDPRFEISNDVRSSASECIFVCMLAARAQAISKLKKIHPFVDEGVLLSKLMAYCSKEAHSCVEKAAMMAFVRLKILEPDDKNSLRGATLRQVMQQDETMGYIPFFVSTTLGTTSCYRKSQGIEYADSFNVNVNKWLLTAFDSSCLWVADRYKLTSALVVDPLYLQHGHEGAIDYRHWGIPLSRRFRSLKLWFVIRTYGLSGLQKYIRRHCELAKLFEGKVRRDPRFEISNDVRLGLVCFRLRSENNLIADQNNRKLLEDINASGRLHMVPASQEQNDEVFELQERKRKDDLAYKRSFFVRMLGLVCFRLRSENNLIADHPLQLGLVCFRLRSENNVIADQNNRKLLEDINASGRLHMVPASFELQERKRKDDLAYKRSFFVRMVSDPKIYNPKIAVATPTSRRPTCLassaeedeeaesdersseQGSYTPTWI
*VLLFHFLSHQVTHWQHPRFHAYFPSGNSYPSVLADMLSDAIGCIGFSWAASPSCTELETIVLDWLGKAIGLPEKFLMYP****************************LGGGVIQSVQNIIVLTRGQKKIHPFVDEGVLLSKLMAYCSKEAHSCVEKAAMMAFVRLKILEPD****LRGATLRQVMQQDETMGYIPFFVSTTLGTTSCCSFDNLAEIGPVAKEFDVWLHVDGAYAGSSFICPEFRPFMNGKTSFDNLHLSPIWYERPSSASECIFVCMLSARAQAISKLKKIHPFVDEGVLLSKLMAYCSKEAHSCVETRGHIQSYRDAIFDVWLHVDGAYAGSSFICPEFRPFMNGIEYADSFNVNVNKWLLTAFDSSCLWVADRYKLTSALVVDPLYLQHGHEGAIDYRHWGIPLSRRFRSLKLWFVIRTYGLSGLQKYIRRHCELAKLFEGKVRRDPRFEISNDVRSSASECIFVCMLAARAQAISKLKKIHPFVDEGVLLSKLMAYCSKEAHSCVEKAAMMAFVRLKILEPD****LRGATLRQVMQQDETMGYIPFFVSTTLGTTSCYRKSQGIEYADSFNVNVNKWLLTAFDSSCLWVADRYKLTSALVVDPLYLQHGHEGAIDYRHWGIPLSRRFRSLKLWFVIRTYGLSGLQKYIRRHCELAKLFEGKVRRDPRFEISNDVRLGLVCFRLRSENNLIADQ****LL********************************DLAYKRSFFVRMLGLVCFRLRSENNLIADHPLQLGLVCFRLRSENNVIADQNNRKLLEDINASGRLHMVPA*F*********DLAYKRSFFVRMVSDPKIYNPKIAV**************************************
MVLLFHFLSHQVTHWQHPRFHAYFPSGNSYPSVLADMLSDAIGCIGFSWAASPSCTELETIVLDWLGKAIGLPEKFLMYPPQGK*ATTPNDIDMNIEDYMTPANQPQSLGGGVIQSVQNIIVLTRGQKKIHPFVDEGVLLSKLMAYCSKEAHSCVEKAAMMAFVRLKILEPDDKNSLRGATLRQVMQQDETMGYIPFFVSTTLGTTSCCSFDNLAEIGPVAKEFDVWLHVDGAYAGSSFICPEFRPFMNGKTSFDNLHLSPIWYERPSSASECIFVCMLSARAQAISKLKKIHPFVDEGVLLSKLMAYCSKEAHSCVETRGHIQSYRDAIFDVWLHVDGAYAGSSFICPEFRPFMNGIEYADSFNVNVNKWLLTAFDSSCLWVADRYKLTSALVVDPLYLQHGHEGAIDYRHWGIPLSRRFRSLKLWFVIRTYGLSGLQKYIRRHCELAKLFEGKVRRDPRFEISNDVRSSASECIFVCMLAARAQAISKLKKIHPFVDEGVLLSKLMAYCSKEAHSCVEKAAMMAFVRLKILEPDDKNSLRGATLRQVMQQDETMGYIPFFVSTTLGTTSCYRKSQGIEYADSFNVNVNKWLLTAFDSSCLWVADRYKLTSALVVDPLYLQHGHEGAIDYRHWGIPLSRRFRSLKLWFVIRTYGLSGLQKYIRRHCELAKLFEGKVRRDPRFEISNDVRLGLVCFRLRSENNLIADQNNRKLLEDINASGRLHMVPASQEQNDEVFELQERKRKDDLAYKRSFFVRMLGLVCF***************************************************************************MVSDPKI******************************************TWI
MVLLFHFLSHQVTHWQHPRFHAYFPSGNSYPSVLADMLSDAIGCIGFSWAASPSCTELETIVLDWLGKAIGLPEKFLMYPPQGKNATTPNDIDMNIEDYMTPANQPQSLGGGVIQSVQNIIVLTRGQKKIHPFVDEGVLLSKLMAYCSKEAHSCVEKAAMMAFVRLKILEPDDKNSLRGATLRQVMQQDETMGYIPFFVSTTLGTTSCCSFDNLAEIGPVAKEFDVWLHVDGAYAGSSFICPEFRPFMNGKTSFDNLHLSPIWYERPSSASECIFVCMLSARAQAISKLKKIHPFVDEGVLLSKLMAYCSKEAHSCVETRGHIQSYRDAIFDVWLHVDGAYAGSSFICPEFRPFMNGIEYADSFNVNVNKWLLTAFDSSCLWVADRYKLTSALVVDPLYLQHGHEGAIDYRHWGIPLSRRFRSLKLWFVIRTYGLSGLQKYIRRHCELAKLFEGKVRRDPRFEISNDVRSSASECIFVCMLAARAQAISKLKKIHPFVDEGVLLSKLMAYCSKEAHSCVEKAAMMAFVRLKILEPDDKNSLRGATLRQVMQQDETMGYIPFFVSTTLGTTSCYRKSQGIEYADSFNVNVNKWLLTAFDSSCLWVADRYKLTSALVVDPLYLQHGHEGAIDYRHWGIPLSRRFRSLKLWFVIRTYGLSGLQKYIRRHCELAKLFEGKVRRDPRFEISNDVRLGLVCFRLRSENNLIADQNNRKLLEDINASGRLHMVPASQEQNDEVFELQERKRKDDLAYKRSFFVRMLGLVCFRLRSENNLIADHPLQLGLVCFRLRSENNVIADQNNRKLLEDINASGRLHMVPASFELQERKRKDDLAYKRSFFVRMVSDPKIYNPKIAVATP***********************************
MVLLFHFLSHQVTHWQHPRFHAYFPSGNSYPSVLADMLSDAIGCIGFSWAASPSCTELETIVLDWLGKAIGLPEKFLMYP*************MNIEDYMTPANQPQSLGGGVIQSVQNIIVLTRGQKKIHPFVDEGVLLSKLMAYCSKEAHSCVEKAAMMAFVRLKILEPDDKNSLRGATLRQVMQQDETMGYIPFFVSTTLGTTSCCSFDNLAEIGPVAKEFDVWLHVDGAYAGSSFICPEFRPFMNGKTSFDNLHLSPIWYERPSSASECIFVCMLSARAQAISKLKKIHPFVDEGVLLSKLMAYCSKEAHSCVETRGHIQSYRDAIFDVWLHVDGAYAGSSFICPEFRPFMNGIEYADSFNVNVNKWLLTAFDSSCLWVADRYKLTSALVVDPLYLQHGHEGAIDYRHWGIPLSRRFRSLKLWFVIRTYGLSGLQKYIRRHCELAKLFEGKVRRDPRFEISNDVRSSASECIFVCMLAARAQAISKLKKIHPFVDEGVLLSKLMAYCSKEAHSCVEKAAMMAFVRLKILEPDDKNSLRGATLRQVMQQDETMGYIPFFVSTTLGTTSCYRKSQGIEYADSFNVNVNKWLLTAFDSSCLWVADRYKLTSALVVDPLYLQHGHEGAIDYRHWGIPLSRRFRSLKLWFVIRTYGLSGLQKYIRRHCELAKLFEGKVRRDPRFEISNDVRLGLVCFRLRSENNLIADQNNRKLLEDINASGRLHMVPASQEQNDEVFELQERKRKDDLAYKRSFFVRMLGLVCFRLRSENNLIADHPLQLGLVCFRLRSENNVIADQNNRKLLEDINASGRLHMVPASFELQERKRKDDLAYKRSFFVRMVSDPKIYNPKIAVA*************************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVLLFHFLSHQVTHWQHPRFHAYFPSGNSYPSVLADMLSDAIGCIGFSWAASPSCTELETIVLDWLGKAIGLPEKFLMYPPQGKNATTPNDIDMNIEDYMTPANQPQSLGGGVIQSVQNIIVLTRGQKKIHPFVDEGVLLSKLMAYCSKEAHSCVEKAAMMAFVRLKILEPDDKNSLRGATLRQVMQQDETMGYIPFFVSTTLGTTSCCSFDNLAEIGPVAKEFDVWLHVDGAYAGSSFICPEFRPFMNGKTSFDNLHLSPIWYERPSSASECIFVCMLSARAQAISKLKKIHPFVDEGVLLSKLMAYCSKEAHSCVETRGHIQSYRDAIFDVWLHVDGAYAGSSFICPEFRPFMNGIEYADSFNVNVNKWLLTAFDSSCLWVADRYKLTSALVVDPLYLQHGHEGAIDYRHWGIPLSRRFRSLKLWFVIRTYGLSGLQKYIRRHCELAKLFEGKVRRDPRFEISNDVRSSASECIFVCMLAARAQAISKLKKIHPFVDEGVLLSKLMAYCSKEAHSCVEKAAMMAFVRLKILEPDDKNSLRGATLRQVMQQDETMGYIPFFVSTTLGTTSCYRKSQGIEYADSFNVNVNKWLLTAFDSSCLWVADRYKLTSALVVDPLYLQHGHEGAIDYRHWGIPLSRRFRSLKLWFVIRTYGLSGLQKYIRRHCELAKLFEGKVRRDPRFEISNDVRLGLVCFRLRSENNLIADQNNRKLLEDINASGRLHMVPASQEQNDEVFELQERKRKDDLAYKRSFFVRMLGLVCFRLRSENNLIADHPLQLGLVCFRLRSENNVIADQNNRKLLEDINASGRLHMVPASFELQERKRKDDLAYKRSFFVRMVSDPKIYNPKIAVATPTSRRPTCLASSAEEDEEAESDERSSEQGSYTPTWI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query891 2.2.26 [Sep-21-2011]
P14173480 Aromatic-L-amino-acid dec yes N/A 0.286 0.531 0.444 3e-67
O88533480 Aromatic-L-amino-acid dec yes N/A 0.286 0.531 0.441 7e-67
P80041486 Aromatic-L-amino-acid dec yes N/A 0.286 0.524 0.434 8e-67
P22781480 Aromatic-L-amino-acid dec yes N/A 0.286 0.531 0.434 1e-66
P27718487 Aromatic-L-amino-acid dec yes N/A 0.288 0.527 0.435 4e-66
P20711480 Aromatic-L-amino-acid dec no N/A 0.286 0.531 0.424 9e-65
P48861508 Aromatic-L-amino-acid dec N/A N/A 0.262 0.460 0.488 2e-64
Q05733847 Histidine decarboxylase O no N/A 0.252 0.265 0.457 2e-63
P05031510 Aromatic-L-amino-acid dec no N/A 0.286 0.5 0.419 2e-61
O96567510 Aromatic-L-amino-acid dec N/A N/A 0.286 0.5 0.419 3e-61
>sp|P14173|DDC_RAT Aromatic-L-amino-acid decarboxylase OS=Rattus norvegicus GN=Ddc PE=1 SV=1 Back     alignment and function desciption
 Score =  257 bits (656), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 133/299 (44%), Positives = 179/299 (59%), Gaps = 44/299 (14%)

Query: 468 VRSSASECIFVCMLAARAQAISKLKKIHPFVDEGVLLSKLMAYCSKEAHSCVEKAAMMAF 527
           ++ SASE   V +LAAR + I +L+   P + +  L+ KL+AY S +AHS VE+A ++  
Sbjct: 144 IQGSASEATLVALLAARTKMIRQLQAASPELTQAALMEKLVAYTSDQAHSSVERAGLIGG 203

Query: 528 VRLKILEPDDKNSLRGATLRQVMQQDETMGYIPFFVSTTLGTTSC--------------- 572
           V++K +  D   S+R A LR+ +++D+  G IPFFV  TLGTTSC               
Sbjct: 204 VKIKAIPSDGNYSMRAAALREALERDKAAGLIPFFVVVTLGTTSCCSFDNLLEVGPICNQ 263

Query: 573 ----------YRKS-----------QGIEYADSFNVNVNKWLLTAFDSSCLWVADRYKLT 611
                     Y  S            G+E+ADSFN N +KWLL  FD S +WV  R  LT
Sbjct: 264 EGVWLHIDAAYAGSAFICPEFRYLLNGVEFADSFNFNPHKWLLVNFDCSAMWVKKRTDLT 323

Query: 612 SALVVDPLYLQHGHEGA---IDYRHWGIPLSRRFRSLKLWFVIRTYGLSGLQKYIRRHCE 668
            A  +DP+YL+H H+ +    DYRHW IPL RRFRSLK+WFV R YG+ GLQ YIR+H +
Sbjct: 324 EAFNMDPVYLRHSHQDSGLITDYRHWQIPLGRRFRSLKMWFVFRMYGVKGLQAYIRKHVK 383

Query: 669 LAKLFEGKVRRDPRFEISNDVRLGLVCFRLRSENNLIADQNNRKLLEDINASGRLHMVP 727
           L+  FE  VR+DPRFEI  +V LGLVCFRL+  N L     N  LL+ IN++ ++H+VP
Sbjct: 384 LSHEFESLVRQDPRFEICTEVILGLVCFRLKGSNQL-----NETLLQRINSAKKIHLVP 437
Catalyzes the decarboxylation of L-3,4-dihydroxyphenylalanine (DOPA) to dopamine, L-5-hydroxytryptophan to serotonin and L-tryptophan to tryptamine.
Rattus norvegicus (taxid: 10116)
EC: 4EC: .EC: 1EC: .EC: 1EC: .EC: 2EC: 8
>sp|O88533|DDC_MOUSE Aromatic-L-amino-acid decarboxylase OS=Mus musculus GN=Ddc PE=2 SV=1 Back     alignment and function description
>sp|P80041|DDC_PIG Aromatic-L-amino-acid decarboxylase OS=Sus scrofa GN=DDC PE=1 SV=2 Back     alignment and function description
>sp|P22781|DDC_CAVPO Aromatic-L-amino-acid decarboxylase OS=Cavia porcellus GN=DDC PE=2 SV=1 Back     alignment and function description
>sp|P27718|DDC_BOVIN Aromatic-L-amino-acid decarboxylase OS=Bos taurus GN=DDC PE=2 SV=2 Back     alignment and function description
>sp|P20711|DDC_HUMAN Aromatic-L-amino-acid decarboxylase OS=Homo sapiens GN=DDC PE=1 SV=2 Back     alignment and function description
>sp|P48861|DDC_MANSE Aromatic-L-amino-acid decarboxylase OS=Manduca sexta GN=Ddc PE=2 SV=1 Back     alignment and function description
>sp|Q05733|DCHS_DROME Histidine decarboxylase OS=Drosophila melanogaster GN=Hdc PE=2 SV=2 Back     alignment and function description
>sp|P05031|DDC_DROME Aromatic-L-amino-acid decarboxylase OS=Drosophila melanogaster GN=Ddc PE=1 SV=4 Back     alignment and function description
>sp|O96567|DDC_DROSI Aromatic-L-amino-acid decarboxylase OS=Drosophila simulans GN=Ddc PE=3 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query891
328713033664 PREDICTED: aromatic-L-amino-acid decarbo 0.381 0.512 0.536 1e-117
270013900627 hypothetical protein TcasGA2_TC012567 [T 0.322 0.457 0.566 1e-107
91090588625 PREDICTED: similar to aromatic amino aci 0.322 0.459 0.567 1e-106
195331887638 GM20861 [Drosophila sechellia] gi|194124 0.322 0.449 0.547 1e-100
158285900642 AGAP007305-PA [Anopheles gambiae str. PE 0.322 0.447 0.553 1e-100
24586044637 tyrosine decarboxylase 2 [Drosophila mel 0.322 0.450 0.547 1e-100
195474161632 GE24598 [Drosophila yakuba] gi|194175461 0.322 0.454 0.547 1e-100
194864046637 GG10812 [Drosophila erecta] gi|190662610 0.322 0.450 0.547 1e-100
195028524638 GH20147 [Drosophila grimshawi] gi|193903 0.322 0.449 0.544 1e-100
195121004659 GI20238 [Drosophila mojavensis] gi|19391 0.322 0.435 0.544 1e-99
>gi|328713033|ref|XP_003244978.1| PREDICTED: aromatic-L-amino-acid decarboxylase-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  430 bits (1105), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 233/434 (53%), Positives = 279/434 (64%), Gaps = 94/434 (21%)

Query: 416 PLSRRFRSLKLWFVIRTYGLSGLQKYIRRHCELAKLFEGKVRRDPRFEISND-----VRS 470
           P      ++ L ++ +  GL   Q+++    E +   +     D   EI N      ++S
Sbjct: 109 PSCTELETIVLDWLGKAIGLP--QEFLTFSEEASTTIDSVRNDDSETEIHNGKGGGVLQS 166

Query: 471 SASECIFVCMLAARAQAISKLKKIHPFVDEGVLLSKLMAYCSKEAHSCVEKAAMMAFVRL 530
           SASECIFVCMLAARAQAI +L+K+HPFV+EGVLLSKLMAYCSKE+HSCVEK AMMAFV+L
Sbjct: 167 SASECIFVCMLAARAQAIKRLRKLHPFVEEGVLLSKLMAYCSKESHSCVEKGAMMAFVKL 226

Query: 531 KILEPDDKNSLRGATLRQVMQQDETMGYIPFFVSTTLGTTSC------------------ 572
           +ILEPD+ NSLRGATLRQVM+QDE MG IPFFVSTTLGTTSC                  
Sbjct: 227 RILEPDENNSLRGATLRQVMEQDEAMGLIPFFVSTTLGTTSCCSFDNIPEIGQVCQQFET 286

Query: 573 --------YRKS-----------QGIEYADSFNVNVNKWLLTAFDSSCLWVADRYKLTSA 613
                   Y  S            G++YADSFN+N NKWLLT FD SCLWV DR+KLT A
Sbjct: 287 VWLHVDAAYAGSAFICPEFRSLMNGVQYADSFNLNTNKWLLTNFDCSCLWVKDRFKLTCA 346

Query: 614 LVVDPLYLQHGHEGAIDYRHWGIPLSRRFRSLKLWFVIRTYGLSGLQKYIRRHCELAKLF 673
           LVVDPLYLQHG+ GA+DYRHWGIPLSRRFRSLKLWFV+RTYG+SGLQKYIR HC+LAK F
Sbjct: 347 LVVDPLYLQHGYAGAVDYRHWGIPLSRRFRSLKLWFVLRTYGISGLQKYIRHHCQLAKRF 406

Query: 674 EGKVRRDPRFEISNDVRLGLVCFRLRSENNLIADQNNRKLLEDINASGRLHMVPA----- 728
           E  VR D ++E+ NDV++GLVCFRL+ +     ++ N+KLLE IN SG+LHMVP+     
Sbjct: 407 ERLVRSDNKYEVLNDVKMGLVCFRLKDDP---TNKLNKKLLETINESGKLHMVPSLVHDK 463

Query: 729 -----------------------------------------SQEQNDEVFELQERKRKD- 746
                                                     +EQ DEVFEL ERK+KD 
Sbjct: 464 YVIRFCVVAEHATEDDIDYAWKIIKETAVTVLYNEQELTEKREEQVDEVFELSERKKKDN 523

Query: 747 DLAYKRSFFVRMLG 760
           DLAY+RSFFVRM+ 
Sbjct: 524 DLAYRRSFFVRMVS 537

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|270013900|gb|EFA10348.1| hypothetical protein TcasGA2_TC012567 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|91090588|ref|XP_972688.1| PREDICTED: similar to aromatic amino acid decarboxylase [Tribolium castaneum] Back     alignment and taxonomy information
>gi|195331887|ref|XP_002032630.1| GM20861 [Drosophila sechellia] gi|194124600|gb|EDW46643.1| GM20861 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|158285900|ref|XP_308519.3| AGAP007305-PA [Anopheles gambiae str. PEST] gi|157020211|gb|EAA03914.4| AGAP007305-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|24586044|ref|NP_724489.1| tyrosine decarboxylase 2 [Drosophila melanogaster] gi|21645112|gb|AAM70812.1| tyrosine decarboxylase 2 [Drosophila melanogaster] gi|229892359|gb|ACQ89823.1| MIP05841p [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|195474161|ref|XP_002089360.1| GE24598 [Drosophila yakuba] gi|194175461|gb|EDW89072.1| GE24598 [Drosophila yakuba] Back     alignment and taxonomy information
>gi|194864046|ref|XP_001970743.1| GG10812 [Drosophila erecta] gi|190662610|gb|EDV59802.1| GG10812 [Drosophila erecta] Back     alignment and taxonomy information
>gi|195028524|ref|XP_001987126.1| GH20147 [Drosophila grimshawi] gi|193903126|gb|EDW01993.1| GH20147 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|195121004|ref|XP_002005011.1| GI20238 [Drosophila mojavensis] gi|193910079|gb|EDW08946.1| GI20238 [Drosophila mojavensis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query891
FB|FBgn0050446637 Tdc2 "Tyrosine decarboxylase 2 0.252 0.353 0.597 5.6e-143
WB|WBGene00006562705 tdc-1 [Caenorhabditis elegans 0.251 0.317 0.594 2e-130
UNIPROTKB|P80041486 DDC "Aromatic-L-amino-acid dec 0.251 0.460 0.480 4.6e-107
UNIPROTKB|P20711480 DDC "Aromatic-L-amino-acid dec 0.251 0.466 0.457 2.3e-105
UNIPROTKB|I3L7F0486 DDC "Aromatic-L-amino-acid dec 0.251 0.460 0.476 2e-103
UNIPROTKB|F1PFV0480 DDC "Uncharacterized protein" 0.251 0.466 0.476 2e-103
UNIPROTKB|E1BV90485 DDC "Uncharacterized protein" 0.262 0.482 0.448 3.7e-103
UNIPROTKB|P27718487 DDC "Aromatic-L-amino-acid dec 0.251 0.459 0.480 1.2e-102
RGD|2494480 Ddc "dopa decarboxylase (aroma 0.251 0.466 0.473 2.8e-102
MGI|MGI:94876480 Ddc "dopa decarboxylase" [Mus 0.251 0.466 0.465 9e-102
FB|FBgn0050446 Tdc2 "Tyrosine decarboxylase 2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 753 (270.1 bits), Expect = 5.6e-143, Sum P(3) = 5.6e-143
 Identities = 156/261 (59%), Positives = 184/261 (70%)

Query:    12 VTHWQHPRFHAYFPSGNSYPSVLADMLSDAIGCIGFSWAASPSCTELETIVLDWLGKAIG 71
             VTHWQHPRFHAYFP+GNS+PS+L DML D IGCIGFSWAASP+CTELETIVLDWLGKAIG
Sbjct:    68 VTHWQHPRFHAYFPAGNSFPSILGDMLGDGIGCIGFSWAASPACTELETIVLDWLGKAIG 127

Query:    72 LPEKFLMYPPQGKNATTPNDIDMNIEDYMTPANQPQSLGGGVIQ-SVQNIIVLT----RG 126
             LP+ FL      K  +T                     GGGVIQ S    +++T    R 
Sbjct:   128 LPDHFLAL----KEGST---------------------GGGVIQTSASECVLVTMLAARA 162

Query:   127 Q--KKI---HPFVDEGVLLSKLMAYCSKEAHSCVEKAAMMAFVRLKILEPDDKNSLRGAT 181
             Q  K++   HPFV+EG LLSKLMAYCSKEAHSCVEKAAM+ FV+L+ILEPDD  SLRG T
Sbjct:   163 QALKRLKAQHPFVEEGHLLSKLMAYCSKEAHSCVEKAAMICFVKLRILEPDDDASLRGQT 222

Query:   182 LRQVMQQDETMGYIPFFVSTTLGTTSCCSFDNLAEIGPVAKEFD-VWLHVDGAYAGSSFI 240
             + + M++DE  G +PFFVSTTLGTT  C+FDNL EIG   + F  VWLHVD AYAG+SFI
Sbjct:   223 IYEAMEEDELQGLVPFFVSTTLGTTGSCAFDNLPEIGKQLQRFPGVWLHVDAAYAGNSFI 282

Query:   241 CPEFRPFMNGKTSFDNLHLSP 261
             CPE +P + G    D+ + +P
Sbjct:   283 CPELKPLLKGIEYADSFNTNP 303
GO:0004058 "aromatic-L-amino-acid decarboxylase activity" evidence=ISS
GO:0006520 "cellular amino acid metabolic process" evidence=IEA
GO:0030170 "pyridoxal phosphate binding" evidence=IEA
GO:0018991 "oviposition" evidence=IMP
GO:0004837 "tyrosine decarboxylase activity" evidence=ISS
GO:0048148 "behavioral response to cocaine" evidence=IMP
GO:0007626 "locomotory behavior" evidence=IMP
WB|WBGene00006562 tdc-1 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|P80041 DDC "Aromatic-L-amino-acid decarboxylase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|P20711 DDC "Aromatic-L-amino-acid decarboxylase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|I3L7F0 DDC "Aromatic-L-amino-acid decarboxylase" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1PFV0 DDC "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E1BV90 DDC "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|P27718 DDC "Aromatic-L-amino-acid decarboxylase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
RGD|2494 Ddc "dopa decarboxylase (aromatic L-amino acid decarboxylase)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:94876 Ddc "dopa decarboxylase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer4.1.1LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query891
pfam00282373 pfam00282, Pyridoxal_deC, Pyridoxal-dependent deca 1e-76
pfam00282373 pfam00282, Pyridoxal_deC, Pyridoxal-dependent deca 2e-72
pfam00282373 pfam00282, Pyridoxal_deC, Pyridoxal-dependent deca 3e-64
cd06450345 cd06450, DOPA_deC_like, DOPA decarboxylase family 3e-56
PLN02880490 PLN02880, PLN02880, tyrosine decarboxylase 3e-55
PLN02880490 PLN02880, PLN02880, tyrosine decarboxylase 2e-50
cd06450345 cd06450, DOPA_deC_like, DOPA decarboxylase family 3e-50
PLN02880490 PLN02880, PLN02880, tyrosine decarboxylase 1e-49
PLN02590539 PLN02590, PLN02590, probable tyrosine decarboxylas 3e-45
PLN02590539 PLN02590, PLN02590, probable tyrosine decarboxylas 3e-43
PLN02590539 PLN02590, PLN02590, probable tyrosine decarboxylas 8e-41
cd06450345 cd06450, DOPA_deC_like, DOPA decarboxylase family 1e-35
COG0076460 COG0076, GadB, Glutamate decarboxylase and related 1e-26
COG0076460 COG0076, GadB, Glutamate decarboxylase and related 2e-23
COG0076460 COG0076, GadB, Glutamate decarboxylase and related 3e-23
cd01494170 cd01494, AAT_I, Aspartate aminotransferase (AAT) s 2e-07
TIGR03799522 TIGR03799, NOD_PanD_pyr, putative pyridoxal-depend 2e-04
PRK02769380 PRK02769, PRK02769, histidine decarboxylase; Provi 2e-04
TIGR03812373 TIGR03812, tyr_de_CO2_Arch, tyrosine decarboxylase 0.001
>gnl|CDD|215836 pfam00282, Pyridoxal_deC, Pyridoxal-dependent decarboxylase conserved domain Back     alignment and domain information 
 Score =  254 bits (650), Expect = 1e-76
 Identities = 112/258 (43%), Positives = 154/258 (59%), Gaps = 37/258 (14%)

Query: 11  QVTHWQHPRFHAYFPSGNSYPSVLADMLSDAIGCIGFSWAASPSCTELETIVLDWLGKAI 70
            VT W  P FHAYFP+GNSYPS+L DMLSDAI C GF+W +SP+CTELE +V+DWL K +
Sbjct: 33  GVTTWHSPNFHAYFPAGNSYPSLLGDMLSDAINCNGFTWESSPACTELENVVMDWLAKML 92

Query: 71  GLPEKFLMYPPQGKNATTPNDIDMNIEDYMTPANQPQSLGGGVIQ---SVQNIIVL---- 123
           GLP++FL                                GGGV+Q   S  N++ L    
Sbjct: 93  GLPKEFLGSGE----------------------------GGGVLQGGSSESNLLALLAAR 124

Query: 124 TRGQKKIHPFVDEGVLLSKLMAYCSKEAHSCVEKAAMMAFVRLKILEPDDKNSLRGATLR 183
           T+  +++         L KL+AY S +AHS +EKAA++A V L+ +  D+   +RG  L 
Sbjct: 125 TKWIRRMKA--AGKPSLGKLVAYTSDQAHSSIEKAALIAGVELREIPTDENGKMRGMDLE 182

Query: 184 QVMQQDETMGYIPFFVSTTLGTTSCCSFDNLAEIGPVAKEFDVWLHVDGAYAGSSFICPE 243
           + +++D+  G IPFFV  TLGTT   +FD L E+G +  ++D+WLHVD AYAGS+FICPE
Sbjct: 183 KAIEEDKENGLIPFFVCATLGTTGSGAFDPLQELGDICNKYDLWLHVDAAYAGSAFICPE 242

Query: 244 FRPFMNGKTSFDNLHLSP 261
           FR ++ G    D+   +P
Sbjct: 243 FRHWLFGIERADSFSFNP 260

Length = 373
>gnl|CDD|215836 pfam00282, Pyridoxal_deC, Pyridoxal-dependent decarboxylase conserved domain Back     alignment and domain information
>gnl|CDD|215836 pfam00282, Pyridoxal_deC, Pyridoxal-dependent decarboxylase conserved domain Back     alignment and domain information
>gnl|CDD|99743 cd06450, DOPA_deC_like, DOPA decarboxylase family Back     alignment and domain information
>gnl|CDD|215475 PLN02880, PLN02880, tyrosine decarboxylase Back     alignment and domain information
>gnl|CDD|215475 PLN02880, PLN02880, tyrosine decarboxylase Back     alignment and domain information
>gnl|CDD|99743 cd06450, DOPA_deC_like, DOPA decarboxylase family Back     alignment and domain information
>gnl|CDD|215475 PLN02880, PLN02880, tyrosine decarboxylase Back     alignment and domain information
>gnl|CDD|178200 PLN02590, PLN02590, probable tyrosine decarboxylase Back     alignment and domain information
>gnl|CDD|178200 PLN02590, PLN02590, probable tyrosine decarboxylase Back     alignment and domain information
>gnl|CDD|178200 PLN02590, PLN02590, probable tyrosine decarboxylase Back     alignment and domain information
>gnl|CDD|99743 cd06450, DOPA_deC_like, DOPA decarboxylase family Back     alignment and domain information
>gnl|CDD|223154 COG0076, GadB, Glutamate decarboxylase and related PLP-dependent proteins [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|223154 COG0076, GadB, Glutamate decarboxylase and related PLP-dependent proteins [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|223154 COG0076, GadB, Glutamate decarboxylase and related PLP-dependent proteins [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|99742 cd01494, AAT_I, Aspartate aminotransferase (AAT) superfamily (fold type I) of pyridoxal phosphate (PLP)-dependent enzymes Back     alignment and domain information
>gnl|CDD|163511 TIGR03799, NOD_PanD_pyr, putative pyridoxal-dependent aspartate 1-decarboxylase Back     alignment and domain information
>gnl|CDD|235068 PRK02769, PRK02769, histidine decarboxylase; Provisional Back     alignment and domain information
>gnl|CDD|234361 TIGR03812, tyr_de_CO2_Arch, tyrosine decarboxylase MnfA Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 891
KOG0628|consensus511 100.0
PLN02590539 probable tyrosine decarboxylase 100.0
PLN02880490 tyrosine decarboxylase 100.0
PF00282373 Pyridoxal_deC: Pyridoxal-dependent decarboxylase c 100.0
TIGR03799522 NOD_PanD_pyr putative pyridoxal-dependent aspartat 100.0
TIGR03811608 tyr_de_CO2_Ent tyrosine decarboxylase, Enterococcu 100.0
KOG0629|consensus510 100.0
PLN02263470 serine decarboxylase 100.0
COG0076460 GadB Glutamate decarboxylase and related PLP-depen 100.0
TIGR01788431 Glu-decarb-GAD glutamate decarboxylase. This model 100.0
PLN03032374 serine decarboxylase; Provisional 100.0
PRK02769380 histidine decarboxylase; Provisional 100.0
PF00282373 Pyridoxal_deC: Pyridoxal-dependent decarboxylase c 100.0
KOG0629|consensus510 100.0
TIGR03811608 tyr_de_CO2_Ent tyrosine decarboxylase, Enterococcu 100.0
PLN02263470 serine decarboxylase 100.0
COG0076460 GadB Glutamate decarboxylase and related PLP-depen 100.0
cd06450345 DOPA_deC_like DOPA decarboxylase family. This fami 100.0
COG1104386 NifS Cysteine sulfinate desulfinase/cysteine desul 100.0
PLN03032374 serine decarboxylase; Provisional 99.98
KOG0628|consensus511 99.97
PRK02769380 histidine decarboxylase; Provisional 99.97
PLN02590539 probable tyrosine decarboxylase 99.96
PLN02880490 tyrosine decarboxylase 99.94
KOG1383|consensus491 99.94
COG0520405 csdA Selenocysteine lyase/Cysteine desulfurase [Po 99.94
PRK05367954 glycine dehydrogenase; Provisional 99.93
TIGR03799522 NOD_PanD_pyr putative pyridoxal-dependent aspartat 99.92
PRK13520371 L-tyrosine decarboxylase; Provisional 99.92
TIGR03812373 tyr_de_CO2_Arch tyrosine decarboxylase MnfA. Membe 99.91
TIGR00461939 gcvP glycine dehydrogenase (decarboxylating). This 99.9
KOG1383|consensus491 99.89
PLN02414993 glycine dehydrogenase (decarboxylating) 99.86
TIGR03402379 FeS_nifS cysteine desulfurase NifS. Members of thi 99.85
PRK09295406 bifunctional cysteine desulfurase/selenocysteine l 99.83
PRK05367954 glycine dehydrogenase; Provisional 99.83
TIGR01788431 Glu-decarb-GAD glutamate decarboxylase. This model 99.83
KOG1549|consensus428 99.82
PLN02651364 cysteine desulfurase 99.82
PRK10874401 cysteine sulfinate desulfinase; Provisional 99.82
TIGR01979403 sufS cysteine desulfurases, SufS subfamily. This m 99.81
cd06453373 SufS_like Cysteine desulfurase (SufS)-like. This f 99.81
TIGR03392398 FeS_syn_CsdA cysteine desulfurase, catalytic subun 99.81
TIGR03403382 nifS_epsilon cysteine desulfurase, NifS family, ep 99.81
TIGR03531444 selenium_SpcS O-phosphoseryl-tRNA(Sec) selenium tr 99.8
PLN02855424 Bifunctional selenocysteine lyase/cysteine desulfu 99.78
TIGR02006402 IscS cysteine desulfurase IscS. This model represe 99.74
PRK04366481 glycine dehydrogenase subunit 2; Validated 99.73
PRK02948381 cysteine desulfurase; Provisional 99.73
PF00266371 Aminotran_5: Aminotransferase class-V; InterPro: I 99.73
TIGR03235353 DNA_S_dndA cysteine desulfurase DndA. This model d 99.73
TIGR01814406 kynureninase kynureninase. This model describes ky 99.72
PLN02724805 Molybdenum cofactor sulfurase 99.72
TIGR01977376 am_tr_V_EF2568 cysteine desulfurase family protein 99.71
TIGR01976397 am_tr_V_VC1184 cysteine desulfurase family protein 99.69
PRK14012404 cysteine desulfurase; Provisional 99.66
PLN02651364 cysteine desulfurase 99.66
cd06451356 AGAT_like Alanine-glyoxylate aminotransferase (AGA 99.65
PLN02414993 glycine dehydrogenase (decarboxylating) 99.65
TIGR01977376 am_tr_V_EF2568 cysteine desulfurase family protein 99.65
TIGR02006402 IscS cysteine desulfurase IscS. This model represe 99.63
PRK04366481 glycine dehydrogenase subunit 2; Validated 99.63
PRK09331387 Sep-tRNA:Cys-tRNA synthetase; Provisional 99.61
KOG1549|consensus428 99.58
KOG0630|consensus 838 99.58
PF00266371 Aminotran_5: Aminotransferase class-V; InterPro: I 99.58
PRK00451447 glycine dehydrogenase subunit 1; Validated 99.57
cd00613398 GDC-P Glycine cleavage system P-protein, alpha- an 99.53
PTZ00094452 serine hydroxymethyltransferase; Provisional 99.52
KOG0630|consensus838 99.51
cd06452361 SepCysS Sep-tRNA:Cys-tRNA synthase. This family be 99.5
TIGR03531444 selenium_SpcS O-phosphoseryl-tRNA(Sec) selenium tr 99.49
PRK12566954 glycine dehydrogenase; Provisional 99.46
TIGR02326363 transamin_PhnW 2-aminoethylphosphonate--pyruvate t 99.44
PRK14012404 cysteine desulfurase; Provisional 99.44
PRK03080378 phosphoserine aminotransferase; Provisional 99.44
PLN02409401 serine--glyoxylate aminotransaminase 99.43
cd00613398 GDC-P Glycine cleavage system P-protein, alpha- an 99.41
COG2008342 GLY1 Threonine aldolase [Amino acid transport and 99.39
PTZ00094452 serine hydroxymethyltransferase; Provisional 99.39
PRK12566954 glycine dehydrogenase; Provisional 99.38
PRK00451447 glycine dehydrogenase subunit 1; Validated 99.37
TIGR02326363 transamin_PhnW 2-aminoethylphosphonate--pyruvate t 99.36
PRK07179407 hypothetical protein; Provisional 99.34
PRK09331387 Sep-tRNA:Cys-tRNA synthetase; Provisional 99.33
TIGR03301355 PhnW-AepZ 2-aminoethylphosphonate aminotransferase 99.33
PLN02721353 threonine aldolase 99.31
TIGR03235353 DNA_S_dndA cysteine desulfurase DndA. This model d 99.31
TIGR00461939 gcvP glycine dehydrogenase (decarboxylating). This 99.31
KOG1368|consensus384 99.29
TIGR03301355 PhnW-AepZ 2-aminoethylphosphonate aminotransferase 99.29
cd06450345 DOPA_deC_like DOPA decarboxylase family. This fami 99.26
cd00615294 Orn_deC_like Ornithine decarboxylase family. This 99.25
TIGR02539370 SepCysS Sep-tRNA:Cys-tRNA synthase. Aminoacylation 99.25
PRK13479368 2-aminoethylphosphonate--pyruvate transaminase; Pr 99.24
cd06452361 SepCysS Sep-tRNA:Cys-tRNA synthase. This family be 99.24
PRK13479368 2-aminoethylphosphonate--pyruvate transaminase; Pr 99.23
PLN02409401 serine--glyoxylate aminotransaminase 99.22
cd06502338 TA_like Low-specificity threonine aldolase (TA). T 99.18
COG1003496 GcvP Glycine cleavage system protein P (pyridoxal- 99.17
cd00609350 AAT_like Aspartate aminotransferase family. This f 99.17
PRK05937370 8-amino-7-oxononanoate synthase; Provisional 99.17
PLN03226475 serine hydroxymethyltransferase; Provisional 99.16
PLN02721353 threonine aldolase 99.15
cd00616352 AHBA_syn 3-amino-5-hydroxybenzoic acid synthase fa 99.15
cd00611355 PSAT_like Phosphoserine aminotransferase (PSAT) fa 99.15
cd06502338 TA_like Low-specificity threonine aldolase (TA). T 99.14
cd00611355 PSAT_like Phosphoserine aminotransferase (PSAT) fa 99.14
PRK00011416 glyA serine hydroxymethyltransferase; Reviewed 99.13
cd00616352 AHBA_syn 3-amino-5-hydroxybenzoic acid synthase fa 99.11
PRK13580493 serine hydroxymethyltransferase; Provisional 99.1
PLN02271586 serine hydroxymethyltransferase 99.09
COG0520405 csdA Selenocysteine lyase/Cysteine desulfurase [Po 99.08
COG1104386 NifS Cysteine sulfinate desulfinase/cysteine desul 99.07
PF01212290 Beta_elim_lyase: Beta-eliminating lyase; InterPro: 99.06
PF01276417 OKR_DC_1: Orn/Lys/Arg decarboxylase, major domain; 99.06
cd01494170 AAT_I Aspartate aminotransferase (AAT) superfamily 99.06
cd00378402 SHMT Serine-glycine hydroxymethyltransferase (SHMT 99.05
TIGR02539370 SepCysS Sep-tRNA:Cys-tRNA synthase. Aminoacylation 99.03
TIGR01437363 selA_rel uncharacterized pyridoxal phosphate-depen 99.02
COG2008342 GLY1 Threonine aldolase [Amino acid transport and 99.02
COG1003496 GcvP Glycine cleavage system protein P (pyridoxal- 99.0
TIGR01822393 2am3keto_CoA 2-amino-3-ketobutyrate coenzyme A lig 98.99
cd06454349 KBL_like KBL_like; this family belongs to the pyri 98.97
PRK08134433 O-acetylhomoserine aminocarboxypropyltransferase; 98.94
PRK13393406 5-aminolevulinate synthase; Provisional 98.94
TIGR01437363 selA_rel uncharacterized pyridoxal phosphate-depen 98.92
TIGR01821402 5aminolev_synth 5-aminolevulinic acid synthase. Th 98.9
PRK05613437 O-acetylhomoserine aminocarboxypropyltransferase; 98.89
PRK05355360 3-phosphoserine/phosphohydroxythreonine aminotrans 98.89
TIGR02618450 tyr_phenol_ly tyrosine phenol-lyase. This model de 98.88
TIGR01364349 serC_1 phosphoserine aminotransferase. This model 98.88
PRK13520371 L-tyrosine decarboxylase; Provisional 98.86
PRK15029755 arginine decarboxylase; Provisional 98.84
COG0075383 Serine-pyruvate aminotransferase/archaeal aspartat 98.83
PRK13034416 serine hydroxymethyltransferase; Reviewed 98.82
PLN03226475 serine hydroxymethyltransferase; Provisional 98.81
PRK13238460 tnaA tryptophanase/L-cysteine desulfhydrase, PLP-d 98.81
TIGR03588380 PseC UDP-4-keto-6-deoxy-N-acetylglucosamine 4-amin 98.8
cd00609350 AAT_like Aspartate aminotransferase family. This f 98.79
PRK08133390 O-succinylhomoserine sulfhydrylase; Validated 98.78
PRK15399713 lysine decarboxylase LdcC; Provisional 98.78
PRK11658379 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate amin 98.78
TIGR01364349 serC_1 phosphoserine aminotransferase. This model 98.77
PRK13578720 ornithine decarboxylase; Provisional 98.76
PRK13237460 tyrosine phenol-lyase; Provisional 98.76
TIGR01366361 serC_3 phosphoserine aminotransferase, putative. T 98.76
PRK08361391 aspartate aminotransferase; Provisional 98.75
TIGR01329378 cysta_beta_ly_E cystathionine beta-lyase, eukaryot 98.75
PRK05355360 3-phosphoserine/phosphohydroxythreonine aminotrans 98.73
cd00614369 CGS_like CGS_like: Cystathionine gamma-synthase is 98.72
PRK07504398 O-succinylhomoserine sulfhydrylase; Reviewed 98.72
PRK13580493 serine hydroxymethyltransferase; Provisional 98.71
COG1103382 Archaea-specific pyridoxal phosphate-dependent enz 98.68
TIGR03812373 tyr_de_CO2_Arch tyrosine decarboxylase MnfA. Membe 98.68
PRK05958385 8-amino-7-oxononanoate synthase; Reviewed 98.67
TIGR01822393 2am3keto_CoA 2-amino-3-ketobutyrate coenzyme A lig 98.66
PLN02509464 cystathionine beta-lyase 98.66
TIGR01325380 O_suc_HS_sulf O-succinylhomoserine sulfhydrylase. 98.65
TIGR01328391 met_gam_lyase methionine gamma-lyase. This model d 98.65
TIGR03402379 FeS_nifS cysteine desulfurase NifS. Members of thi 98.64
PRK15400714 lysine decarboxylase CadA; Provisional 98.64
TIGR01366361 serC_3 phosphoserine aminotransferase, putative. T 98.62
PRK06767386 methionine gamma-lyase; Provisional 98.62
PRK08776405 cystathionine gamma-synthase; Provisional 98.61
TIGR03588380 PseC UDP-4-keto-6-deoxy-N-acetylglucosamine 4-amin 98.6
PRK08064390 cystathionine beta-lyase; Provisional 98.6
PRK06939397 2-amino-3-ketobutyrate coenzyme A ligase; Provisio 98.6
cd06454349 KBL_like KBL_like; this family belongs to the pyri 98.6
PRK07812436 O-acetylhomoserine aminocarboxypropyltransferase; 98.6
cd00378402 SHMT Serine-glycine hydroxymethyltransferase (SHMT 98.6
PF00464399 SHMT: Serine hydroxymethyltransferase; InterPro: I 98.6
KOG1368|consensus384 98.6
TIGR00474454 selA seryl-tRNA(sec) selenium transferase. In bact 98.6
PRK08574385 cystathionine gamma-synthase; Provisional 98.59
COG0112413 GlyA Glycine/serine hydroxymethyltransferase [Amin 98.58
PLN02483489 serine palmitoyltransferase 98.58
PRK07811388 cystathionine gamma-synthase; Provisional 98.58
PRK13392410 5-aminolevulinate synthase; Provisional 98.57
PRK08861388 cystathionine gamma-synthase; Provisional 98.57
PRK05968389 hypothetical protein; Provisional 98.56
PRK08114395 cystathionine beta-lyase; Provisional 98.56
PRK09064407 5-aminolevulinate synthase; Validated 98.54
PRK08249398 cystathionine gamma-synthase; Provisional 98.53
PRK05939397 hypothetical protein; Provisional 98.53
PRK07810403 O-succinylhomoserine sulfhydrylase; Provisional 98.52
PRK13034416 serine hydroxymethyltransferase; Reviewed 98.51
PRK07503403 methionine gamma-lyase; Provisional 98.51
TIGR03403382 nifS_epsilon cysteine desulfurase, NifS family, ep 98.51
PRK09028394 cystathionine beta-lyase; Provisional 98.51
TIGR01324377 cysta_beta_ly_B cystathionine beta-lyase, bacteria 98.51
PRK07050394 cystathionine beta-lyase; Provisional 98.51
PRK00011416 glyA serine hydroxymethyltransferase; Reviewed 98.5
PRK06108382 aspartate aminotransferase; Provisional 98.49
cd00617431 Tnase_like Tryptophanase family (Tnase). This fami 98.49
PRK05764393 aspartate aminotransferase; Provisional 98.49
PRK08248431 O-acetylhomoserine aminocarboxypropyltransferase; 98.48
PRK04311464 selenocysteine synthase; Provisional 98.46
PRK05994427 O-acetylhomoserine aminocarboxypropyltransferase; 98.46
PRK07671377 cystathionine beta-lyase; Provisional 98.45
PRK10534333 L-threonine aldolase; Provisional 98.42
PRK06176380 cystathionine gamma-synthase/cystathionine beta-ly 98.42
PRK08045386 cystathionine gamma-synthase; Provisional 98.41
PRK05937370 8-amino-7-oxononanoate synthase; Provisional 98.41
TIGR01825385 gly_Cac_T_rel pyridoxal phosphate-dependent acyltr 98.4
PRK08247366 cystathionine gamma-synthase; Reviewed 98.38
PF01212290 Beta_elim_lyase: Beta-eliminating lyase; InterPro: 98.38
TIGR01141346 hisC histidinol-phosphate aminotransferase. Histid 98.38
TIGR01141346 hisC histidinol-phosphate aminotransferase. Histid 98.38
PLN03227392 serine palmitoyltransferase-like protein; Provisio 98.37
PRK05958385 8-amino-7-oxononanoate synthase; Reviewed 98.36
PLN02822481 serine palmitoyltransferase 98.35
PRK06939397 2-amino-3-ketobutyrate coenzyme A ligase; Provisio 98.35
PLN02271586 serine hydroxymethyltransferase 98.34
PRK11658379 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate amin 98.34
TIGR02617467 tnaA_trp_ase tryptophanase, leader peptide-associa 98.33
KOG2862|consensus385 98.33
TIGR02080382 O_succ_thio_ly O-succinylhomoserine (thiol)-lyase. 98.32
PRK06234400 methionine gamma-lyase; Provisional 98.32
COG1103382 Archaea-specific pyridoxal phosphate-dependent enz 98.32
PLN02822481 serine palmitoyltransferase 98.32
PRK10534333 L-threonine aldolase; Provisional 98.32
PLN02242418 methionine gamma-lyase 98.32
PRK05957389 aspartate aminotransferase; Provisional 98.31
TIGR00858360 bioF 8-amino-7-oxononanoate synthase. This model r 98.31
KOG2040|consensus1001 98.27
TIGR01326418 OAH_OAS_sulfhy OAH/OAS sulfhydrylase. This model d 98.27
PRK09064407 5-aminolevulinate synthase; Validated 98.26
TIGR00858360 bioF 8-amino-7-oxononanoate synthase. This model r 98.26
COG3844407 Kynureninase [Amino acid transport and metabolism] 98.25
PRK06084425 O-acetylhomoserine aminocarboxypropyltransferase; 98.24
PRK08363398 alanine aminotransferase; Validated 98.23
PRK13392410 5-aminolevulinate synthase; Provisional 98.22
PRK07269364 cystathionine gamma-synthase; Reviewed 98.21
PLN02483489 serine palmitoyltransferase 98.21
PRK11706375 TDP-4-oxo-6-deoxy-D-glucose transaminase; Provisio 98.21
PRK06460376 hypothetical protein; Provisional 98.2
KOG2040|consensus1001 98.2
PRK15407438 lipopolysaccharide biosynthesis protein RfbH; Prov 98.19
cd00610413 OAT_like Acetyl ornithine aminotransferase family. 98.19
cd00610413 OAT_like Acetyl ornithine aminotransferase family. 98.18
COG0399374 WecE Predicted pyridoxal phosphate-dependent enzym 98.18
PRK06434384 cystathionine gamma-lyase; Validated 98.17
PF01041363 DegT_DnrJ_EryC1: DegT/DnrJ/EryC1/StrS aminotransfe 98.17
PRK09295406 bifunctional cysteine desulfurase/selenocysteine l 98.17
TIGR01825385 gly_Cac_T_rel pyridoxal phosphate-dependent acyltr 98.16
PRK02948381 cysteine desulfurase; Provisional 98.16
PRK08912387 hypothetical protein; Provisional 98.15
PLN02452365 phosphoserine transaminase 98.14
PRK07582366 cystathionine gamma-lyase; Validated 98.13
PF02347429 GDC-P: Glycine cleavage system P-protein; InterPro 98.11
PLN03227392 serine palmitoyltransferase-like protein; Provisio 98.11
PRK06207405 aspartate aminotransferase; Provisional 98.09
cd06453373 SufS_like Cysteine desulfurase (SufS)-like. This f 98.09
PRK06108382 aspartate aminotransferase; Provisional 98.09
PRK13238460 tnaA tryptophanase/L-cysteine desulfhydrase, PLP-d 98.07
PRK07777387 aminotransferase; Validated 98.06
PRK09082386 methionine aminotransferase; Validated 98.06
TIGR01814406 kynureninase kynureninase. This model describes ky 98.06
TIGR01979403 sufS cysteine desulfurases, SufS subfamily. This m 98.05
PRK05968389 hypothetical protein; Provisional 98.05
TIGR03392398 FeS_syn_CsdA cysteine desulfurase, catalytic subun 98.04
PLN02656409 tyrosine transaminase 98.04
PRK06225380 aspartate aminotransferase; Provisional 98.04
COG0156388 BioF 7-keto-8-aminopelargonate synthetase and rela 98.02
PRK08134433 O-acetylhomoserine aminocarboxypropyltransferase; 98.02
PRK08361391 aspartate aminotransferase; Provisional 98.02
PF01041363 DegT_DnrJ_EryC1: DegT/DnrJ/EryC1/StrS aminotransfe 98.01
PLN02955476 8-amino-7-oxononanoate synthase 98.01
PF00155363 Aminotran_1_2: Aminotransferase class I and II 1-a 98.0
PRK00950361 histidinol-phosphate aminotransferase; Validated 98.0
PLN00145430 tyrosine/nicotianamine aminotransferase; Provision 98.0
PRK05764393 aspartate aminotransferase; Provisional 98.0
PRK06702432 O-acetylhomoserine aminocarboxypropyltransferase; 98.0
PRK03244398 argD acetylornithine aminotransferase; Provisional 97.98
TIGR02379376 ECA_wecE TDP-4-keto-6-deoxy-D-glucose transaminase 97.98
PLN02724 805 Molybdenum cofactor sulfurase 97.98
PF00464399 SHMT: Serine hydroxymethyltransferase; InterPro: I 97.97
TIGR01265403 tyr_nico_aTase tyrosine/nicotianamine aminotransfe 97.97
PRK08960387 hypothetical protein; Provisional 97.96
PRK07505402 hypothetical protein; Provisional 97.96
cd06451356 AGAT_like Alanine-glyoxylate aminotransferase (AGA 97.96
PRK04870356 histidinol-phosphate aminotransferase; Provisional 97.96
PRK07582366 cystathionine gamma-lyase; Validated 97.94
PRK05387353 histidinol-phosphate aminotransferase; Provisional 97.94
PRK01688351 histidinol-phosphate aminotransferase; Provisional 97.93
PF02347429 GDC-P: Glycine cleavage system P-protein; InterPro 97.93
cd00614369 CGS_like CGS_like: Cystathionine gamma-synthase is 97.92
COG0399374 WecE Predicted pyridoxal phosphate-dependent enzym 97.92
PRK10874401 cysteine sulfinate desulfinase; Provisional 97.91
PRK07682378 hypothetical protein; Validated 97.91
PRK15407438 lipopolysaccharide biosynthesis protein RfbH; Prov 97.91
PRK05967395 cystathionine beta-lyase; Provisional 97.91
PRK11706375 TDP-4-oxo-6-deoxy-D-glucose transaminase; Provisio 97.9
PRK05964423 adenosylmethionine--8-amino-7-oxononanoate transam 97.89
PRK07568397 aspartate aminotransferase; Provisional 97.89
TIGR03540383 DapC_direct LL-diaminopimelate aminotransferase. T 97.86
PLN02855424 Bifunctional selenocysteine lyase/cysteine desulfu 97.86
PRK05613437 O-acetylhomoserine aminocarboxypropyltransferase; 97.85
PRK07550386 hypothetical protein; Provisional 97.84
PRK14807351 histidinol-phosphate aminotransferase; Provisional 97.83
TIGR01140330 L_thr_O3P_dcar L-threonine-O-3-phosphate decarboxy 97.83
PRK02731367 histidinol-phosphate aminotransferase; Validated 97.83
PRK12414384 putative aminotransferase; Provisional 97.83
PRK07309391 aromatic amino acid aminotransferase; Validated 97.82
COG0075383 Serine-pyruvate aminotransferase/archaeal aspartat 97.82
TIGR02379376 ECA_wecE TDP-4-keto-6-deoxy-D-glucose transaminase 97.81
PRK08064390 cystathionine beta-lyase; Provisional 97.81
PRK07337388 aminotransferase; Validated 97.81
PF05889389 SLA_LP_auto_ag: Soluble liver antigen/liver pancre 97.81
PRK00950361 histidinol-phosphate aminotransferase; Validated 97.78
PF05889389 SLA_LP_auto_ag: Soluble liver antigen/liver pancre 97.77
PRK14807351 histidinol-phosphate aminotransferase; Provisional 97.77
TIGR01885401 Orn_aminotrans ornithine aminotransferase. This mo 97.77
PRK06225380 aspartate aminotransferase; Provisional 97.77
PLN00175413 aminotransferase family protein; Provisional 97.76
TIGR01365374 serC_2 phosphoserine aminotransferase, Methanosarc 97.76
PRK08861388 cystathionine gamma-synthase; Provisional 97.76
PRK00854401 rocD ornithine--oxo-acid transaminase; Reviewed 97.75
PLN02452365 phosphoserine transaminase 97.75
PRK07681399 aspartate aminotransferase; Provisional 97.74
PLN03026380 histidinol-phosphate aminotransferase; Provisional 97.74
PRK07908349 hypothetical protein; Provisional 97.74
COG2873426 MET17 O-acetylhomoserine sulfhydrylase [Amino acid 97.73
PF01053386 Cys_Met_Meta_PP: Cys/Met metabolism PLP-dependent 97.73
PRK05942394 aspartate aminotransferase; Provisional 97.73
PRK15399713 lysine decarboxylase LdcC; Provisional 97.73
PRK08056356 threonine-phosphate decarboxylase; Provisional 97.72
PLN02187462 rooty/superroot1 97.72
PRK04635354 histidinol-phosphate aminotransferase; Provisional 97.72
cd00615294 Orn_deC_like Ornithine decarboxylase family. This 97.7
PF00155363 Aminotran_1_2: Aminotransferase class I and II 1-a 97.7
PRK08114395 cystathionine beta-lyase; Provisional 97.69
PRK07682378 hypothetical protein; Validated 97.68
PRK07777387 aminotransferase; Validated 97.68
PRK15029755 arginine decarboxylase; Provisional 97.68
PRK03244398 argD acetylornithine aminotransferase; Provisional 97.68
PRK07324373 transaminase; Validated 97.67
TIGR01365374 serC_2 phosphoserine aminotransferase, Methanosarc 97.65
PTZ00377481 alanine aminotransferase; Provisional 97.64
PRK06836394 aspartate aminotransferase; Provisional 97.64
TIGR01329378 cysta_beta_ly_E cystathionine beta-lyase, eukaryot 97.63
TIGR03537350 DapC succinyldiaminopimelate transaminase. Note: t 97.63
PRK13355517 bifunctional HTH-domain containing protein/aminotr 97.6
PTZ00433412 tyrosine aminotransferase; Provisional 97.6
PRK06767386 methionine gamma-lyase; Provisional 97.59
PRK08776405 cystathionine gamma-synthase; Provisional 97.59
PRK04073396 rocD ornithine--oxo-acid transaminase; Provisional 97.59
COG0403450 GcvP Glycine cleavage system protein P (pyridoxal- 97.59
PRK07683387 aminotransferase A; Validated 97.58
PRK13578720 ornithine decarboxylase; Provisional 97.58
TIGR03246397 arg_catab_astC succinylornithine transaminase fami 97.58
PRK05166371 histidinol-phosphate aminotransferase; Provisional 97.58
PRK07504398 O-succinylhomoserine sulfhydrylase; Reviewed 97.56
COG1982557 LdcC Arginine/lysine/ornithine decarboxylases [Ami 97.55
PRK06107402 aspartate aminotransferase; Provisional 97.55
PTZ00125400 ornithine aminotransferase-like protein; Provision 97.55
PRK08153369 histidinol-phosphate aminotransferase; Provisional 97.55
COG3033471 TnaA Tryptophanase [Amino acid transport and metab 97.55
PRK08045386 cystathionine gamma-synthase; Provisional 97.54
TIGR02618450 tyr_phenol_ly tyrosine phenol-lyase. This model de 97.53
PRK08175395 aminotransferase; Validated 97.53
COG0112413 GlyA Glycine/serine hydroxymethyltransferase [Amin 97.52
PRK07324373 transaminase; Validated 97.52
PRK04311464 selenocysteine synthase; Provisional 97.52
PRK06207405 aspartate aminotransferase; Provisional 97.52
COG0156388 BioF 7-keto-8-aminopelargonate synthetase and rela 97.52
cd01494170 AAT_I Aspartate aminotransferase (AAT) superfamily 97.52
PRK05994427 O-acetylhomoserine aminocarboxypropyltransferase; 97.51
TIGR03576346 pyridox_MJ0158 pyridoxal phosphate enzyme, MJ0158 97.5
PRK04870356 histidinol-phosphate aminotransferase; Provisional 97.5
cd00617431 Tnase_like Tryptophanase family (Tnase). This fami 97.49
TIGR01328391 met_gam_lyase methionine gamma-lyase. This model d 97.49
PRK03158359 histidinol-phosphate aminotransferase; Provisional 97.49
PRK15400714 lysine decarboxylase CadA; Provisional 97.47
PRK07505402 hypothetical protein; Provisional 97.47
PRK08363398 alanine aminotransferase; Validated 97.46
PRK06434384 cystathionine gamma-lyase; Validated 97.46
TIGR00474454 selA seryl-tRNA(sec) selenium transferase. In bact 97.45
PRK09105370 putative aminotransferase; Provisional 97.45
PRK05957389 aspartate aminotransferase; Provisional 97.45
PRK08248431 O-acetylhomoserine aminocarboxypropyltransferase; 97.45
PRK08133390 O-succinylhomoserine sulfhydrylase; Validated 97.45
PLN00175413 aminotransferase family protein; Provisional 97.44
PRK06348384 aspartate aminotransferase; Provisional 97.43
PRK09082386 methionine aminotransferase; Validated 97.42
COG0436393 Aspartate/tyrosine/aromatic aminotransferase [Amin 97.42
PLN02368407 alanine transaminase 97.41
PRK07812436 O-acetylhomoserine aminocarboxypropyltransferase; 97.41
PRK12462364 phosphoserine aminotransferase; Provisional 97.41
COG0436393 Aspartate/tyrosine/aromatic aminotransferase [Amin 97.4
PRK08068389 transaminase; Reviewed 97.39
TIGR01265403 tyr_nico_aTase tyrosine/nicotianamine aminotransfe 97.39
PRK09265404 aminotransferase AlaT; Validated 97.39
PRK05387353 histidinol-phosphate aminotransferase; Provisional 97.39
COG3844407 Kynureninase [Amino acid transport and metabolism] 97.39
PLN02760504 4-aminobutyrate:pyruvate transaminase 97.38
PRK07811388 cystathionine gamma-synthase; Provisional 97.37
PRK08574385 cystathionine gamma-synthase; Provisional 97.37
PRK07050394 cystathionine beta-lyase; Provisional 97.37
TIGR00707379 argD acetylornithine and succinylornithine aminotr 97.36
PRK09276385 LL-diaminopimelate aminotransferase; Provisional 97.36
PRK01278389 argD acetylornithine transaminase protein; Provisi 97.35
PRK08912387 hypothetical protein; Provisional 97.34
PRK04073396 rocD ornithine--oxo-acid transaminase; Provisional 97.34
PLN00143409 tyrosine/nicotianamine aminotransferase; Provision 97.33
PRK15481431 transcriptional regulatory protein PtsJ; Provision 97.32
TIGR01324377 cysta_beta_ly_B cystathionine beta-lyase, bacteria 97.32
PRK02627396 acetylornithine aminotransferase; Provisional 97.32
TIGR01264401 tyr_amTase_E tyrosine aminotransferase, eukaryotic 97.32
TIGR01325380 O_suc_HS_sulf O-succinylhomoserine sulfhydrylase. 97.31
TIGR02617467 tnaA_trp_ase tryptophanase, leader peptide-associa 97.31
PRK07568397 aspartate aminotransferase; Provisional 97.29
PLN02376496 1-aminocyclopropane-1-carboxylate synthase 97.29
TIGR01976397 am_tr_V_VC1184 cysteine desulfurase family protein 97.28
PLN02231534 alanine transaminase 97.27
PRK04260375 acetylornithine aminotransferase; Provisional 97.27
KOG2467|consensus477 97.27
PRK09148405 aminotransferase; Validated 97.26
PRK08249398 cystathionine gamma-synthase; Provisional 97.25
PRK00854401 rocD ornithine--oxo-acid transaminase; Reviewed 97.25
PRK07550386 hypothetical protein; Provisional 97.25
PRK03715395 argD acetylornithine transaminase protein; Provisi 97.25
PRK03321352 putative aminotransferase; Provisional 97.24
PTZ00433412 tyrosine aminotransferase; Provisional 97.24
PRK03715395 argD acetylornithine transaminase protein; Provisi 97.24
TIGR03537350 DapC succinyldiaminopimelate transaminase. Note: t 97.24
TIGR01140330 L_thr_O3P_dcar L-threonine-O-3-phosphate decarboxy 97.22
PTZ00125400 ornithine aminotransferase-like protein; Provision 97.21
PRK12381406 bifunctional succinylornithine transaminase/acetyl 97.21
TIGR02080382 O_succ_thio_ly O-succinylhomoserine (thiol)-lyase. 97.2
PRK03317368 histidinol-phosphate aminotransferase; Provisional 97.2
PRK04635354 histidinol-phosphate aminotransferase; Provisional 97.2
TIGR01885401 Orn_aminotrans ornithine aminotransferase. This mo 97.2
PRK02610374 histidinol-phosphate aminotransferase; Provisional 97.19
PLN00145430 tyrosine/nicotianamine aminotransferase; Provision 97.18
PRK08636403 aspartate aminotransferase; Provisional 97.18
PRK02936377 argD acetylornithine aminotransferase; Provisional 97.18
PRK03967337 histidinol-phosphate aminotransferase; Provisional 97.17
PRK02936377 argD acetylornithine aminotransferase; Provisional 97.16
PRK04781364 histidinol-phosphate aminotransferase; Provisional 97.16
PRK02731367 histidinol-phosphate aminotransferase; Validated 97.16
PF01276417 OKR_DC_1: Orn/Lys/Arg decarboxylase, major domain; 97.16
PRK08056356 threonine-phosphate decarboxylase; Provisional 97.16
TIGR00707379 argD acetylornithine and succinylornithine aminotr 97.15
TIGR03538393 DapC_gpp succinyldiaminopimelate transaminase. Thi 97.15
COG0403450 GcvP Glycine cleavage system protein P (pyridoxal- 97.14
PRK06176380 cystathionine gamma-synthase/cystathionine beta-ly 97.13
PRK06358354 threonine-phosphate decarboxylase; Provisional 97.13
PRK07309391 aromatic amino acid aminotransferase; Validated 97.13
COG0161449 BioA Adenosylmethionine-8-amino-7-oxononanoate ami 97.13
PRK06084425 O-acetylhomoserine aminocarboxypropyltransferase; 97.12
PRK06290410 aspartate aminotransferase; Provisional 97.12
PRK07681399 aspartate aminotransferase; Provisional 97.11
PRK07503403 methionine gamma-lyase; Provisional 97.11
PLN02509464 cystathionine beta-lyase 97.11
PRK07049427 methionine gamma-lyase; Validated 97.1
PRK06290410 aspartate aminotransferase; Provisional 97.1
PRK03317368 histidinol-phosphate aminotransferase; Provisional 97.09
PRK06836394 aspartate aminotransferase; Provisional 97.09
PRK09265404 aminotransferase AlaT; Validated 97.08
PRK07908349 hypothetical protein; Provisional 97.08
PRK05166371 histidinol-phosphate aminotransferase; Provisional 97.08
PRK05769441 4-aminobutyrate aminotransferase; Provisional 97.07
PRK08247366 cystathionine gamma-synthase; Reviewed 97.06
PRK01688351 histidinol-phosphate aminotransferase; Provisional 97.05
PRK06234400 methionine gamma-lyase; Provisional 97.04
PRK05942394 aspartate aminotransferase; Provisional 97.02
PRK06358354 threonine-phosphate decarboxylase; Provisional 97.01
PRK12414384 putative aminotransferase; Provisional 97.01
PRK11522459 putrescine--2-oxoglutarate aminotransferase; Provi 97.0
PRK06348384 aspartate aminotransferase; Provisional 96.99
TIGR03540383 DapC_direct LL-diaminopimelate aminotransferase. T 96.98
PLN02624474 ornithine-delta-aminotransferase 96.98
PRK03158359 histidinol-phosphate aminotransferase; Provisional 96.96
PRK08960387 hypothetical protein; Provisional 96.96
PRK13355517 bifunctional HTH-domain containing protein/aminotr 96.95
COG1168388 MalY Bifunctional PLP-dependent enzyme with beta-c 96.92
PTZ00377481 alanine aminotransferase; Provisional 96.91
PLN03026380 histidinol-phosphate aminotransferase; Provisional 96.91
COG0001432 HemL Glutamate-1-semialdehyde aminotransferase [Co 96.9
PRK09276385 LL-diaminopimelate aminotransferase; Provisional 96.9
PRK08068389 transaminase; Reviewed 96.9
PRK07810403 O-succinylhomoserine sulfhydrylase; Provisional 96.89
PRK09148405 aminotransferase; Validated 96.89
COG2873426 MET17 O-acetylhomoserine sulfhydrylase [Amino acid 96.89
COG4992404 ArgD Ornithine/acetylornithine aminotransferase [A 96.88
TIGR01264401 tyr_amTase_E tyrosine aminotransferase, eukaryotic 96.88
PLN02656409 tyrosine transaminase 96.87
PLN02450468 1-aminocyclopropane-1-carboxylate synthase 96.86
PRK04260375 acetylornithine aminotransferase; Provisional 96.86
PRK09105370 putative aminotransferase; Provisional 96.84
PRK09147396 succinyldiaminopimelate transaminase; Provisional 96.82
PLN02624474 ornithine-delta-aminotransferase 96.82
PLN00143409 tyrosine/nicotianamine aminotransferase; Provision 96.81
PLN02187462 rooty/superroot1 96.79
TIGR02407412 ectoine_ectB diaminobutyrate--2-oxoglutarate amino 96.79
PRK07482461 hypothetical protein; Provisional 96.78
PRK05093403 argD bifunctional N-succinyldiaminopimelate-aminot 96.78
TIGR01326418 OAH_OAS_sulfhy OAH/OAS sulfhydrylase. This model d 96.77
>KOG0628|consensus Back     alignment and domain information 
Probab=100.00  E-value=4e-69  Score=589.40  Aligned_cols=404  Identities=55%  Similarity=0.967  Sum_probs=366.6

Q ss_pred             hhhHhhccCCCCCCccccccCCCCCCHHHHHHHHHHHhcCCCCCccccChhHHHHHHHHHHHHHHHcCCCCCCCCCCCCC
Q psy852            4 LFHFLSHQVTHWQHPRFHAYFPSGNSYPSVLADMLSDAIGCIGFSWAASPSCTELETIVLDWLGKAIGLPEKFLMYPPQG   83 (891)
Q Consensus         4 ~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~l~~~~n~~~~~~~~~p~~~~~E~~~~~~l~~l~g~~~~~~~~~~~~   83 (891)
                      +-..|+||++||+||+||+|+|+++++|+++|+||+..+++.|++|..||++|+||..+++||++|+|+|+.|+...   
T Consensus        60 ~ekiI~PGitHw~hP~fhAyfpa~~s~~siladmLs~~i~~vGFtW~ssPa~TELE~ivmDWL~kml~LP~~Fl~~~---  136 (511)
T KOG0628|consen   60 LEKIIMPGITHWQHPHFHAYFPAGNSYPSILADMLSGGIGCVGFTWASSPACTELEVIVMDWLGKMLGLPAEFLSLG---  136 (511)
T ss_pred             HHHHccCCCcccCCCceeeEccCccchHHHHHHHHhcccccccceeecCcchHHHHHHHHHHHHHHhcCcHHHhccC---
Confidence            44679999999999999999999999999999999999999999999999999999999999999999999987522   


Q ss_pred             CCCCCCCCccccccccCCCCCCCCcccchhHHHHHHHH-----HHHHhc-----cccCCccccccccCCeEEEecCCCCh
Q psy852           84 KNATTPNDIDMNIEDYMTPANQPQSLGGGVIQSVQNII-----VLTRGQ-----KKIHPFVDEGVLLSKLMAYCSKEAHS  153 (891)
Q Consensus        84 ~g~~tp~~~~~~~~~~~t~~~~~~~~~gGt~~~~~~~~-----~~ar~~-----~~~~~~~~~g~~~~~~~v~~S~~~H~  153 (891)
                                             .+-+||++|+..+..     ..||.+     +..+|.+.+...+.++++|+|+++|.
T Consensus       137 -----------------------~g~GgGviQ~tases~lvallaaR~~~i~~~k~~~p~~~e~~~~~~lV~Y~SDqahs  193 (511)
T KOG0628|consen  137 -----------------------LGDGGGVIQGTASESVLVALLAARTEKIEEIKSRPPELHESSVLARLVAYCSDQAHS  193 (511)
T ss_pred             -----------------------CCCCcceEecCcchhHHHHHHHHHHHHHHHhhcCCCcccchhhhhhheEEecCcccc
Confidence                                   223566666544322     225655     23568888888999999999999999


Q ss_pred             HHHHHHHHcCCeEEEEecCCCCcccHHHHHHHHHhhhhcCCcceEEEeecccCccccccCHHHHHHHHHHcCCceeeecc
Q psy852          154 CVEKAAMMAFVRLKILEPDDKNSLRGATLRQVMQQDETMGYIPFFVSTTLGTTSCCSFDNLAEIGPVAKEFDVWLHVDGA  233 (891)
Q Consensus       154 Sv~kaa~~~~~~v~~V~~d~~g~id~~~L~~~l~~~~~~g~~p~~V~~t~Gtt~~GavDpl~~I~~i~~~~~~~lHvDaA  233 (891)
                      |++|||.+++++++.+++|++..|+.+.|+++|++|.++|.+|++|++|.|||.++++|+|.+|..+|+++         
T Consensus       194 sveka~~i~~VklR~l~td~n~~mr~~~L~~AIe~D~arGlIPf~v~at~GTT~~ca~D~l~elg~Vc~~~---------  264 (511)
T KOG0628|consen  194 SVEKACLIAGVKLRALPTDENFGMRGDTLRKAIEEDIARGLIPFFVCATLGTTSSCAFDELEELGPVCREE---------  264 (511)
T ss_pred             hHHHhHhhcceeEEEeecccCcCCCHHHHHHHHHHHHhCCCccEEEEEeecCccccccccHHHhcchhhhc---------
Confidence            99999999999999999999999999999999999999999999999999999999999999999999998         


Q ss_pred             ccCCccccCCCCccCCCCcccccCCCCcccccCCCCcchhHHHHhhhhHHHHHhhhcccCCccchhhHHHHhhhhhcccc
Q psy852          234 YAGSSFICPEFRPFMNGKTSFDNLHLSPIWYERPSSASECIFVCMLSARAQAISKLKKIHPFVDEGVLLSKLMAYCSKEA  313 (891)
Q Consensus       234 ~GG~~~~~~~~~~~~~g~~~~d~~~~s~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  313 (891)
                                                                                                      
T Consensus       265 --------------------------------------------------------------------------------  264 (511)
T KOG0628|consen  265 --------------------------------------------------------------------------------  264 (511)
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             ccccccccccccccccccceEEEeeccccCccccCccccccccCCCcccEEEEeCCCcCCccCCceEEEEeccccchhhc
Q psy852          314 HSCVETRGHIQSYRDAIFDVWLHVDGAYAGSSFICPEFRPFMNGIEYADSFNVNVNKWLLTAFDSSCLWVADRYKLTSAL  393 (891)
Q Consensus       314 ~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~gi~~~ds~~~~~HK~~~~p~~~g~~~~r~~~~~~~~~  393 (891)
                                        ++|||||+||||++++||+++.+++||++|||+++|+|||+.+.++|+.+|+||+..+..++
T Consensus       265 ------------------glWLHVDAAYAGsa~iCpE~r~l~rGie~aDSfn~n~hK~~~vnfDCs~lWvkd~~~~~~~~  326 (511)
T KOG0628|consen  265 ------------------GLWLHVDAAYAGSAFICPEFRYLMRGIEYADSFNFNPHKWLLVNFDCSPLWVKDGTKLSRAF  326 (511)
T ss_pred             ------------------CEEEEeehhhccccccCHHHHHHhhcchhhccccCChhheeEEeeeeecceeecCceeeeee
Confidence                              58999999999999999999999999999999999999999999999999999999998888


Q ss_pred             ccCccccCCCCCCcccccccccCCCCChhHHHHHHHHHHhcHHHHHHHHHHHHHHHHHHHHhhccCCccccccCCCCCcc
Q psy852          394 VVDPLYLQHGHEGAIDYRHWGIPLSRRFRSLKLWFVIRTYGLSGLQKYIRRHCELAKLFEGKVRRDPRFEISNDVRSSAS  473 (891)
Q Consensus       394 ~~~~~y~~~~~~~~~~~~~~~~~~sr~~~~l~~w~~l~~~g~~G~~~ii~~~lelAr~l~~~L~~~~~~eVv~~itsggs  473 (891)
                      .++|.||.+...+                                                                   
T Consensus       327 ~vdp~yL~h~~~~-------------------------------------------------------------------  339 (511)
T KOG0628|consen  327 NVDPLYLKHAYQG-------------------------------------------------------------------  339 (511)
T ss_pred             ecChHhhcchhhc-------------------------------------------------------------------
Confidence            9999999765210                                                                   


Q ss_pred             hhHHHHHHHHHHHHHHhhhccCccccccccccceEEEecccchHHHHHHHHHcCceEEEecCCCCCCcCHHHHHHHHHhh
Q psy852          474 ECIFVCMLAARAQAISKLKKIHPFVDEGVLLSKLMAYCSKEAHSCVEKAAMMAFVRLKILEPDDKNSLRGATLRQVMQQD  553 (891)
Q Consensus       474 ean~~al~aAR~~~~~~~~~~~~~~~~g~~~~~~vI~~S~~aH~Sv~Kaa~l~gv~v~~Vp~d~~G~mD~~~Le~aI~~d  553 (891)
                                                                                                      
T Consensus       340 --------------------------------------------------------------------------------  339 (511)
T KOG0628|consen  340 --------------------------------------------------------------------------------  339 (511)
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             hhcCCccEEEEecCCccchhhhhcCCCCccEEEEcCcccCCcccccEEEEEeCCccchhhhccCCCccccCCCCCccccC
Q psy852          554 ETMGYIPFFVSTTLGTTSCYRKSQGIEYADSFNVNVNKWLLTAFDSSCLWVADRYKLTSALVVDPLYLQHGHEGAIDYRH  633 (891)
Q Consensus       554 ~~~g~ip~~VvataGTT~c~~~ldGi~~aDSIs~d~HK~L~~P~g~G~llvR~~~~L~~~l~~~~~Yl~~~~e~~~~~~~  633 (891)
                                                                                               ..++++.
T Consensus       340 -------------------------------------------------------------------------~~~Dyrh  346 (511)
T KOG0628|consen  340 -------------------------------------------------------------------------SAPDYRH  346 (511)
T ss_pred             -------------------------------------------------------------------------cCCCccc
Confidence                                                                                     0124567


Q ss_pred             CcccccccccchHHHHHHHHHHHhhHHHHHHHHHHHHHHHHHHhccCCCcEEeCCCceeEEEEEecCCcchhhhhhHHHH
Q psy852          634 WGIPLSRRFRSLKLWFVIRTYGLSGLQKYIRRHCELAKLFEGKVRRDPRFEISNDVRLGLVCFRLRSENNLIADQNNRKL  713 (891)
Q Consensus       634 ~ti~~SRr~~aL~lW~~L~~lG~~G~~~~i~~~~~lA~~L~~~L~~~~~~eil~~~~~~iV~Fr~~~~~~~~~d~ln~~L  713 (891)
                      |.++++||||+||+|++++.+|.+++++.+++..+||+.|.+.+.+.+.||+.++..+++||||.++.     |++|++|
T Consensus       347 wqipl~rRfRSLKlWfv~R~~Gve~lq~~iR~h~~La~~fe~lv~~d~~FE~~~~~~lgLvcFRlk~~-----N~~ne~L  421 (511)
T KOG0628|consen  347 WQIPLGRRFRSLKLWFVLRSYGVENLQNYIREHVRLAKEFETLVRADPRFEIVNKRILGLVCFRLKGD-----NEINEAL  421 (511)
T ss_pred             cccccccchhhHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHhhcCCcceeecccccceeEEeecCC-----cHHHHHH
Confidence            88899999999999999999999999999999999999999999999999999999999999999987     8999999


Q ss_pred             HHHHHhCCcEEEeeccccCCeEE-EEec-CCCCHHHHHHHHHHHHHHHHHHHHh
Q psy852          714 LEDINASGRLHMVPASQEQNDEV-FELQ-ERKRKDDLAYKRSFFVRMLGLVCFR  765 (891)
Q Consensus       714 ~~~L~~~G~~~~s~s~~~g~~~l-~sv~-~~tT~edId~li~~L~ei~~~~~~~  765 (891)
                      +++++.+|.++++++.+.|++++ ++++ +.|+++||+..++.|.+.++.+.+.
T Consensus       422 l~~in~~g~i~l~~~~l~gk~vlRf~V~s~~t~~~di~~a~~~I~~~a~~l~~~  475 (511)
T KOG0628|consen  422 LNRLNSSGRIHLVPASLHGKFVLRFAVCSPLTNESDIDEAWKIIFEAADELFEA  475 (511)
T ss_pred             HHHHHhcCcEEEEEeeecceEEEEEEecCCCCcHHHHHHHHHHHHHHHHHHHhh
Confidence            99999999999999999999999 8865 4899999999999999998765543

>PLN02590 probable tyrosine decarboxylase Back     alignment and domain information
>PLN02880 tyrosine decarboxylase Back     alignment and domain information
>PF00282 Pyridoxal_deC: Pyridoxal-dependent decarboxylase conserved domain; InterPro: IPR002129 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal) Back     alignment and domain information
>TIGR03799 NOD_PanD_pyr putative pyridoxal-dependent aspartate 1-decarboxylase Back     alignment and domain information
>TIGR03811 tyr_de_CO2_Ent tyrosine decarboxylase, Enterococcus type Back     alignment and domain information
>KOG0629|consensus Back     alignment and domain information
>PLN02263 serine decarboxylase Back     alignment and domain information
>COG0076 GadB Glutamate decarboxylase and related PLP-dependent proteins [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01788 Glu-decarb-GAD glutamate decarboxylase Back     alignment and domain information
>PLN03032 serine decarboxylase; Provisional Back     alignment and domain information
>PRK02769 histidine decarboxylase; Provisional Back     alignment and domain information
>PF00282 Pyridoxal_deC: Pyridoxal-dependent decarboxylase conserved domain; InterPro: IPR002129 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal) Back     alignment and domain information
>KOG0629|consensus Back     alignment and domain information
>TIGR03811 tyr_de_CO2_Ent tyrosine decarboxylase, Enterococcus type Back     alignment and domain information
>PLN02263 serine decarboxylase Back     alignment and domain information
>COG0076 GadB Glutamate decarboxylase and related PLP-dependent proteins [Amino acid transport and metabolism] Back     alignment and domain information
>cd06450 DOPA_deC_like DOPA decarboxylase family Back     alignment and domain information
>COG1104 NifS Cysteine sulfinate desulfinase/cysteine desulfurase and related enzymes [Amino acid transport and metabolism] Back     alignment and domain information
>PLN03032 serine decarboxylase; Provisional Back     alignment and domain information
>KOG0628|consensus Back     alignment and domain information
>PRK02769 histidine decarboxylase; Provisional Back     alignment and domain information
>PLN02590 probable tyrosine decarboxylase Back     alignment and domain information
>PLN02880 tyrosine decarboxylase Back     alignment and domain information
>KOG1383|consensus Back     alignment and domain information
>COG0520 csdA Selenocysteine lyase/Cysteine desulfurase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05367 glycine dehydrogenase; Provisional Back     alignment and domain information
>TIGR03799 NOD_PanD_pyr putative pyridoxal-dependent aspartate 1-decarboxylase Back     alignment and domain information
>PRK13520 L-tyrosine decarboxylase; Provisional Back     alignment and domain information
>TIGR03812 tyr_de_CO2_Arch tyrosine decarboxylase MnfA Back     alignment and domain information
>TIGR00461 gcvP glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>KOG1383|consensus Back     alignment and domain information
>PLN02414 glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>TIGR03402 FeS_nifS cysteine desulfurase NifS Back     alignment and domain information
>PRK09295 bifunctional cysteine desulfurase/selenocysteine lyase; Validated Back     alignment and domain information
>PRK05367 glycine dehydrogenase; Provisional Back     alignment and domain information
>TIGR01788 Glu-decarb-GAD glutamate decarboxylase Back     alignment and domain information
>KOG1549|consensus Back     alignment and domain information
>PLN02651 cysteine desulfurase Back     alignment and domain information
>PRK10874 cysteine sulfinate desulfinase; Provisional Back     alignment and domain information
>TIGR01979 sufS cysteine desulfurases, SufS subfamily Back     alignment and domain information
>cd06453 SufS_like Cysteine desulfurase (SufS)-like Back     alignment and domain information
>TIGR03392 FeS_syn_CsdA cysteine desulfurase, catalytic subunit CsdA Back     alignment and domain information
>TIGR03403 nifS_epsilon cysteine desulfurase, NifS family, epsilon proteobacteria type Back     alignment and domain information
>TIGR03531 selenium_SpcS O-phosphoseryl-tRNA(Sec) selenium transferase Back     alignment and domain information
>PLN02855 Bifunctional selenocysteine lyase/cysteine desulfurase Back     alignment and domain information
>TIGR02006 IscS cysteine desulfurase IscS Back     alignment and domain information
>PRK04366 glycine dehydrogenase subunit 2; Validated Back     alignment and domain information
>PRK02948 cysteine desulfurase; Provisional Back     alignment and domain information
>PF00266 Aminotran_5: Aminotransferase class-V; InterPro: IPR000192 Aminotransferases share certain mechanistic features with other pyridoxal- phosphate dependent enzymes, such as the covalent binding of the pyridoxal- phosphate group to a lysine residue Back     alignment and domain information
>TIGR03235 DNA_S_dndA cysteine desulfurase DndA Back     alignment and domain information
>TIGR01814 kynureninase kynureninase Back     alignment and domain information
>PLN02724 Molybdenum cofactor sulfurase Back     alignment and domain information
>TIGR01977 am_tr_V_EF2568 cysteine desulfurase family protein Back     alignment and domain information
>TIGR01976 am_tr_V_VC1184 cysteine desulfurase family protein, VC1184 subfamily Back     alignment and domain information
>PRK14012 cysteine desulfurase; Provisional Back     alignment and domain information
>PLN02651 cysteine desulfurase Back     alignment and domain information
>cd06451 AGAT_like Alanine-glyoxylate aminotransferase (AGAT) family Back     alignment and domain information
>PLN02414 glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>TIGR01977 am_tr_V_EF2568 cysteine desulfurase family protein Back     alignment and domain information
>TIGR02006 IscS cysteine desulfurase IscS Back     alignment and domain information
>PRK04366 glycine dehydrogenase subunit 2; Validated Back     alignment and domain information
>PRK09331 Sep-tRNA:Cys-tRNA synthetase; Provisional Back     alignment and domain information
>KOG1549|consensus Back     alignment and domain information
>KOG0630|consensus Back     alignment and domain information
>PF00266 Aminotran_5: Aminotransferase class-V; InterPro: IPR000192 Aminotransferases share certain mechanistic features with other pyridoxal- phosphate dependent enzymes, such as the covalent binding of the pyridoxal- phosphate group to a lysine residue Back     alignment and domain information
>PRK00451 glycine dehydrogenase subunit 1; Validated Back     alignment and domain information
>cd00613 GDC-P Glycine cleavage system P-protein, alpha- and beta-subunits Back     alignment and domain information
>PTZ00094 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>KOG0630|consensus Back     alignment and domain information
>cd06452 SepCysS Sep-tRNA:Cys-tRNA synthase Back     alignment and domain information
>TIGR03531 selenium_SpcS O-phosphoseryl-tRNA(Sec) selenium transferase Back     alignment and domain information
>PRK12566 glycine dehydrogenase; Provisional Back     alignment and domain information
>TIGR02326 transamin_PhnW 2-aminoethylphosphonate--pyruvate transaminase Back     alignment and domain information
>PRK14012 cysteine desulfurase; Provisional Back     alignment and domain information
>PRK03080 phosphoserine aminotransferase; Provisional Back     alignment and domain information
>PLN02409 serine--glyoxylate aminotransaminase Back     alignment and domain information
>cd00613 GDC-P Glycine cleavage system P-protein, alpha- and beta-subunits Back     alignment and domain information
>COG2008 GLY1 Threonine aldolase [Amino acid transport and metabolism] Back     alignment and domain information
>PTZ00094 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>PRK12566 glycine dehydrogenase; Provisional Back     alignment and domain information
>PRK00451 glycine dehydrogenase subunit 1; Validated Back     alignment and domain information
>TIGR02326 transamin_PhnW 2-aminoethylphosphonate--pyruvate transaminase Back     alignment and domain information
>PRK07179 hypothetical protein; Provisional Back     alignment and domain information
>PRK09331 Sep-tRNA:Cys-tRNA synthetase; Provisional Back     alignment and domain information
>TIGR03301 PhnW-AepZ 2-aminoethylphosphonate aminotransferase Back     alignment and domain information
>PLN02721 threonine aldolase Back     alignment and domain information
>TIGR03235 DNA_S_dndA cysteine desulfurase DndA Back     alignment and domain information
>TIGR00461 gcvP glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>KOG1368|consensus Back     alignment and domain information
>TIGR03301 PhnW-AepZ 2-aminoethylphosphonate aminotransferase Back     alignment and domain information
>cd06450 DOPA_deC_like DOPA decarboxylase family Back     alignment and domain information
>cd00615 Orn_deC_like Ornithine decarboxylase family Back     alignment and domain information
>TIGR02539 SepCysS Sep-tRNA:Cys-tRNA synthase Back     alignment and domain information
>PRK13479 2-aminoethylphosphonate--pyruvate transaminase; Provisional Back     alignment and domain information
>cd06452 SepCysS Sep-tRNA:Cys-tRNA synthase Back     alignment and domain information
>PRK13479 2-aminoethylphosphonate--pyruvate transaminase; Provisional Back     alignment and domain information
>PLN02409 serine--glyoxylate aminotransaminase Back     alignment and domain information
>cd06502 TA_like Low-specificity threonine aldolase (TA) Back     alignment and domain information
>COG1003 GcvP Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain [Amino acid transport and metabolism] Back     alignment and domain information
>cd00609 AAT_like Aspartate aminotransferase family Back     alignment and domain information
>PRK05937 8-amino-7-oxononanoate synthase; Provisional Back     alignment and domain information
>PLN03226 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>PLN02721 threonine aldolase Back     alignment and domain information
>cd00616 AHBA_syn 3-amino-5-hydroxybenzoic acid synthase family (AHBA_syn) Back     alignment and domain information
>cd00611 PSAT_like Phosphoserine aminotransferase (PSAT) family Back     alignment and domain information
>cd06502 TA_like Low-specificity threonine aldolase (TA) Back     alignment and domain information
>cd00611 PSAT_like Phosphoserine aminotransferase (PSAT) family Back     alignment and domain information
>PRK00011 glyA serine hydroxymethyltransferase; Reviewed Back     alignment and domain information
>cd00616 AHBA_syn 3-amino-5-hydroxybenzoic acid synthase family (AHBA_syn) Back     alignment and domain information
>PRK13580 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>PLN02271 serine hydroxymethyltransferase Back     alignment and domain information
>COG0520 csdA Selenocysteine lyase/Cysteine desulfurase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1104 NifS Cysteine sulfinate desulfinase/cysteine desulfurase and related enzymes [Amino acid transport and metabolism] Back     alignment and domain information
>PF01212 Beta_elim_lyase: Beta-eliminating lyase; InterPro: IPR001597 This domain is found in many tryptophanases (tryptophan indole-lyase, TNase), tyrosine phenol-lyases (TPL) and threonine aldolases Back     alignment and domain information
>PF01276 OKR_DC_1: Orn/Lys/Arg decarboxylase, major domain; InterPro: IPR000310 Pyridoxal-dependent decarboxylases are bacterial proteins acting on ornithine, lysine, arginine and related substrates [] Back     alignment and domain information
>cd01494 AAT_I Aspartate aminotransferase (AAT) superfamily (fold type I) of pyridoxal phosphate (PLP)-dependent enzymes Back     alignment and domain information
>cd00378 SHMT Serine-glycine hydroxymethyltransferase (SHMT) Back     alignment and domain information
>TIGR02539 SepCysS Sep-tRNA:Cys-tRNA synthase Back     alignment and domain information
>TIGR01437 selA_rel uncharacterized pyridoxal phosphate-dependent enzyme Back     alignment and domain information
>COG2008 GLY1 Threonine aldolase [Amino acid transport and metabolism] Back     alignment and domain information
>COG1003 GcvP Glycine cleavage system protein P (pyridoxal-binding), C-terminal domain [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01822 2am3keto_CoA 2-amino-3-ketobutyrate coenzyme A ligase Back     alignment and domain information
>cd06454 KBL_like KBL_like; this family belongs to the pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I) Back     alignment and domain information
>PRK08134 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK13393 5-aminolevulinate synthase; Provisional Back     alignment and domain information
>TIGR01437 selA_rel uncharacterized pyridoxal phosphate-dependent enzyme Back     alignment and domain information
>TIGR01821 5aminolev_synth 5-aminolevulinic acid synthase Back     alignment and domain information
>PRK05613 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK05355 3-phosphoserine/phosphohydroxythreonine aminotransferase; Provisional Back     alignment and domain information
>TIGR02618 tyr_phenol_ly tyrosine phenol-lyase Back     alignment and domain information
>TIGR01364 serC_1 phosphoserine aminotransferase Back     alignment and domain information
>PRK13520 L-tyrosine decarboxylase; Provisional Back     alignment and domain information
>PRK15029 arginine decarboxylase; Provisional Back     alignment and domain information
>COG0075 Serine-pyruvate aminotransferase/archaeal aspartate aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13034 serine hydroxymethyltransferase; Reviewed Back     alignment and domain information
>PLN03226 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>PRK13238 tnaA tryptophanase/L-cysteine desulfhydrase, PLP-dependent; Provisional Back     alignment and domain information
>TIGR03588 PseC UDP-4-keto-6-deoxy-N-acetylglucosamine 4-aminotransferase Back     alignment and domain information
>cd00609 AAT_like Aspartate aminotransferase family Back     alignment and domain information
>PRK08133 O-succinylhomoserine sulfhydrylase; Validated Back     alignment and domain information
>PRK15399 lysine decarboxylase LdcC; Provisional Back     alignment and domain information
>PRK11658 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>TIGR01364 serC_1 phosphoserine aminotransferase Back     alignment and domain information
>PRK13578 ornithine decarboxylase; Provisional Back     alignment and domain information
>PRK13237 tyrosine phenol-lyase; Provisional Back     alignment and domain information
>TIGR01366 serC_3 phosphoserine aminotransferase, putative Back     alignment and domain information
>PRK08361 aspartate aminotransferase; Provisional Back     alignment and domain information
>TIGR01329 cysta_beta_ly_E cystathionine beta-lyase, eukaryotic Back     alignment and domain information
>PRK05355 3-phosphoserine/phosphohydroxythreonine aminotransferase; Provisional Back     alignment and domain information
>cd00614 CGS_like CGS_like: Cystathionine gamma-synthase is a PLP dependent enzyme and catalyzes the committed step of methionine biosynthesis Back     alignment and domain information
>PRK07504 O-succinylhomoserine sulfhydrylase; Reviewed Back     alignment and domain information
>PRK13580 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>COG1103 Archaea-specific pyridoxal phosphate-dependent enzymes [General function prediction only] Back     alignment and domain information
>TIGR03812 tyr_de_CO2_Arch tyrosine decarboxylase MnfA Back     alignment and domain information
>PRK05958 8-amino-7-oxononanoate synthase; Reviewed Back     alignment and domain information
>TIGR01822 2am3keto_CoA 2-amino-3-ketobutyrate coenzyme A ligase Back     alignment and domain information
>PLN02509 cystathionine beta-lyase Back     alignment and domain information
>TIGR01325 O_suc_HS_sulf O-succinylhomoserine sulfhydrylase Back     alignment and domain information
>TIGR01328 met_gam_lyase methionine gamma-lyase Back     alignment and domain information
>TIGR03402 FeS_nifS cysteine desulfurase NifS Back     alignment and domain information
>PRK15400 lysine decarboxylase CadA; Provisional Back     alignment and domain information
>TIGR01366 serC_3 phosphoserine aminotransferase, putative Back     alignment and domain information
>PRK06767 methionine gamma-lyase; Provisional Back     alignment and domain information
>PRK08776 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>TIGR03588 PseC UDP-4-keto-6-deoxy-N-acetylglucosamine 4-aminotransferase Back     alignment and domain information
>PRK08064 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK06939 2-amino-3-ketobutyrate coenzyme A ligase; Provisional Back     alignment and domain information
>cd06454 KBL_like KBL_like; this family belongs to the pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I) Back     alignment and domain information
>PRK07812 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>cd00378 SHMT Serine-glycine hydroxymethyltransferase (SHMT) Back     alignment and domain information
>PF00464 SHMT: Serine hydroxymethyltransferase; InterPro: IPR001085 Synonym(s): Serine hydroxymethyltransferase, Serine aldolase, Threonine aldolase Serine hydroxymethyltransferase (SHMT) is a pyridoxal phosphate (PLP) dependent enzyme and belongs to the aspartate aminotransferase superfamily (fold type I) [] Back     alignment and domain information
>KOG1368|consensus Back     alignment and domain information
>TIGR00474 selA seryl-tRNA(sec) selenium transferase Back     alignment and domain information
>PRK08574 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>COG0112 GlyA Glycine/serine hydroxymethyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02483 serine palmitoyltransferase Back     alignment and domain information
>PRK07811 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK13392 5-aminolevulinate synthase; Provisional Back     alignment and domain information
>PRK08861 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK05968 hypothetical protein; Provisional Back     alignment and domain information
>PRK08114 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK09064 5-aminolevulinate synthase; Validated Back     alignment and domain information
>PRK08249 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK05939 hypothetical protein; Provisional Back     alignment and domain information
>PRK07810 O-succinylhomoserine sulfhydrylase; Provisional Back     alignment and domain information
>PRK13034 serine hydroxymethyltransferase; Reviewed Back     alignment and domain information
>PRK07503 methionine gamma-lyase; Provisional Back     alignment and domain information
>TIGR03403 nifS_epsilon cysteine desulfurase, NifS family, epsilon proteobacteria type Back     alignment and domain information
>PRK09028 cystathionine beta-lyase; Provisional Back     alignment and domain information
>TIGR01324 cysta_beta_ly_B cystathionine beta-lyase, bacterial Back     alignment and domain information
>PRK07050 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK00011 glyA serine hydroxymethyltransferase; Reviewed Back     alignment and domain information
>PRK06108 aspartate aminotransferase; Provisional Back     alignment and domain information
>cd00617 Tnase_like Tryptophanase family (Tnase) Back     alignment and domain information
>PRK05764 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK08248 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK04311 selenocysteine synthase; Provisional Back     alignment and domain information
>PRK05994 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK07671 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK10534 L-threonine aldolase; Provisional Back     alignment and domain information
>PRK06176 cystathionine gamma-synthase/cystathionine beta-lyase; Validated Back     alignment and domain information
>PRK08045 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK05937 8-amino-7-oxononanoate synthase; Provisional Back     alignment and domain information
>TIGR01825 gly_Cac_T_rel pyridoxal phosphate-dependent acyltransferase, putative Back     alignment and domain information
>PRK08247 cystathionine gamma-synthase; Reviewed Back     alignment and domain information
>PF01212 Beta_elim_lyase: Beta-eliminating lyase; InterPro: IPR001597 This domain is found in many tryptophanases (tryptophan indole-lyase, TNase), tyrosine phenol-lyases (TPL) and threonine aldolases Back     alignment and domain information
>TIGR01141 hisC histidinol-phosphate aminotransferase Back     alignment and domain information
>TIGR01141 hisC histidinol-phosphate aminotransferase Back     alignment and domain information
>PLN03227 serine palmitoyltransferase-like protein; Provisional Back     alignment and domain information
>PRK05958 8-amino-7-oxononanoate synthase; Reviewed Back     alignment and domain information
>PLN02822 serine palmitoyltransferase Back     alignment and domain information
>PRK06939 2-amino-3-ketobutyrate coenzyme A ligase; Provisional Back     alignment and domain information
>PLN02271 serine hydroxymethyltransferase Back     alignment and domain information
>PRK11658 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>TIGR02617 tnaA_trp_ase tryptophanase, leader peptide-associated Back     alignment and domain information
>KOG2862|consensus Back     alignment and domain information
>TIGR02080 O_succ_thio_ly O-succinylhomoserine (thiol)-lyase Back     alignment and domain information
>PRK06234 methionine gamma-lyase; Provisional Back     alignment and domain information
>COG1103 Archaea-specific pyridoxal phosphate-dependent enzymes [General function prediction only] Back     alignment and domain information
>PLN02822 serine palmitoyltransferase Back     alignment and domain information
>PRK10534 L-threonine aldolase; Provisional Back     alignment and domain information
>PLN02242 methionine gamma-lyase Back     alignment and domain information
>PRK05957 aspartate aminotransferase; Provisional Back     alignment and domain information
>TIGR00858 bioF 8-amino-7-oxononanoate synthase Back     alignment and domain information
>KOG2040|consensus Back     alignment and domain information
>TIGR01326 OAH_OAS_sulfhy OAH/OAS sulfhydrylase Back     alignment and domain information
>PRK09064 5-aminolevulinate synthase; Validated Back     alignment and domain information
>TIGR00858 bioF 8-amino-7-oxononanoate synthase Back     alignment and domain information
>COG3844 Kynureninase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06084 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK08363 alanine aminotransferase; Validated Back     alignment and domain information
>PRK13392 5-aminolevulinate synthase; Provisional Back     alignment and domain information
>PRK07269 cystathionine gamma-synthase; Reviewed Back     alignment and domain information
>PLN02483 serine palmitoyltransferase Back     alignment and domain information
>PRK11706 TDP-4-oxo-6-deoxy-D-glucose transaminase; Provisional Back     alignment and domain information
>PRK06460 hypothetical protein; Provisional Back     alignment and domain information
>KOG2040|consensus Back     alignment and domain information
>PRK15407 lipopolysaccharide biosynthesis protein RfbH; Provisional Back     alignment and domain information
>cd00610 OAT_like Acetyl ornithine aminotransferase family Back     alignment and domain information
>cd00610 OAT_like Acetyl ornithine aminotransferase family Back     alignment and domain information
>COG0399 WecE Predicted pyridoxal phosphate-dependent enzyme apparently involved in regulation of cell wall biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK06434 cystathionine gamma-lyase; Validated Back     alignment and domain information
>PF01041 DegT_DnrJ_EryC1: DegT/DnrJ/EryC1/StrS aminotransferase family; InterPro: IPR000653 This entry represents a family that are probably all pyridoxal-phosphate-dependent aminotransferase enzymes with a variety of molecular functions Back     alignment and domain information
>PRK09295 bifunctional cysteine desulfurase/selenocysteine lyase; Validated Back     alignment and domain information
>TIGR01825 gly_Cac_T_rel pyridoxal phosphate-dependent acyltransferase, putative Back     alignment and domain information
>PRK02948 cysteine desulfurase; Provisional Back     alignment and domain information
>PRK08912 hypothetical protein; Provisional Back     alignment and domain information
>PLN02452 phosphoserine transaminase Back     alignment and domain information
>PRK07582 cystathionine gamma-lyase; Validated Back     alignment and domain information
>PF02347 GDC-P: Glycine cleavage system P-protein; InterPro: IPR020580 This family consists of glycine cleavage system P-proteins (1 Back     alignment and domain information
>PLN03227 serine palmitoyltransferase-like protein; Provisional Back     alignment and domain information
>PRK06207 aspartate aminotransferase; Provisional Back     alignment and domain information
>cd06453 SufS_like Cysteine desulfurase (SufS)-like Back     alignment and domain information
>PRK06108 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK13238 tnaA tryptophanase/L-cysteine desulfhydrase, PLP-dependent; Provisional Back     alignment and domain information
>PRK07777 aminotransferase; Validated Back     alignment and domain information
>PRK09082 methionine aminotransferase; Validated Back     alignment and domain information
>TIGR01814 kynureninase kynureninase Back     alignment and domain information
>TIGR01979 sufS cysteine desulfurases, SufS subfamily Back     alignment and domain information
>PRK05968 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03392 FeS_syn_CsdA cysteine desulfurase, catalytic subunit CsdA Back     alignment and domain information
>PLN02656 tyrosine transaminase Back     alignment and domain information
>PRK06225 aspartate aminotransferase; Provisional Back     alignment and domain information
>COG0156 BioF 7-keto-8-aminopelargonate synthetase and related enzymes [Coenzyme metabolism] Back     alignment and domain information
>PRK08134 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK08361 aspartate aminotransferase; Provisional Back     alignment and domain information
>PF01041 DegT_DnrJ_EryC1: DegT/DnrJ/EryC1/StrS aminotransferase family; InterPro: IPR000653 This entry represents a family that are probably all pyridoxal-phosphate-dependent aminotransferase enzymes with a variety of molecular functions Back     alignment and domain information
>PLN02955 8-amino-7-oxononanoate synthase Back     alignment and domain information
>PF00155 Aminotran_1_2: Aminotransferase class I and II 1-aminocyclopropane-1-carboxylate synthase signature aspartate aminotransferase signature; InterPro: IPR004839 Aminotransferases share certain mechanistic features with other pyridoxal-phosphate dependent enzymes, such as the covalent binding of the pyridoxal-phosphate group to a lysine residue Back     alignment and domain information
>PRK00950 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PLN00145 tyrosine/nicotianamine aminotransferase; Provisional Back     alignment and domain information
>PRK05764 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK06702 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK03244 argD acetylornithine aminotransferase; Provisional Back     alignment and domain information
>TIGR02379 ECA_wecE TDP-4-keto-6-deoxy-D-glucose transaminase Back     alignment and domain information
>PLN02724 Molybdenum cofactor sulfurase Back     alignment and domain information
>PF00464 SHMT: Serine hydroxymethyltransferase; InterPro: IPR001085 Synonym(s): Serine hydroxymethyltransferase, Serine aldolase, Threonine aldolase Serine hydroxymethyltransferase (SHMT) is a pyridoxal phosphate (PLP) dependent enzyme and belongs to the aspartate aminotransferase superfamily (fold type I) [] Back     alignment and domain information
>TIGR01265 tyr_nico_aTase tyrosine/nicotianamine aminotransferases Back     alignment and domain information
>PRK08960 hypothetical protein; Provisional Back     alignment and domain information
>PRK07505 hypothetical protein; Provisional Back     alignment and domain information
>cd06451 AGAT_like Alanine-glyoxylate aminotransferase (AGAT) family Back     alignment and domain information
>PRK04870 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK07582 cystathionine gamma-lyase; Validated Back     alignment and domain information
>PRK05387 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK01688 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PF02347 GDC-P: Glycine cleavage system P-protein; InterPro: IPR020580 This family consists of glycine cleavage system P-proteins (1 Back     alignment and domain information
>cd00614 CGS_like CGS_like: Cystathionine gamma-synthase is a PLP dependent enzyme and catalyzes the committed step of methionine biosynthesis Back     alignment and domain information
>COG0399 WecE Predicted pyridoxal phosphate-dependent enzyme apparently involved in regulation of cell wall biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK10874 cysteine sulfinate desulfinase; Provisional Back     alignment and domain information
>PRK07682 hypothetical protein; Validated Back     alignment and domain information
>PRK15407 lipopolysaccharide biosynthesis protein RfbH; Provisional Back     alignment and domain information
>PRK05967 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK11706 TDP-4-oxo-6-deoxy-D-glucose transaminase; Provisional Back     alignment and domain information
>PRK05964 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK07568 aspartate aminotransferase; Provisional Back     alignment and domain information
>TIGR03540 DapC_direct LL-diaminopimelate aminotransferase Back     alignment and domain information
>PLN02855 Bifunctional selenocysteine lyase/cysteine desulfurase Back     alignment and domain information
>PRK05613 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK07550 hypothetical protein; Provisional Back     alignment and domain information
>PRK14807 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>TIGR01140 L_thr_O3P_dcar L-threonine-O-3-phosphate decarboxylase Back     alignment and domain information
>PRK02731 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PRK12414 putative aminotransferase; Provisional Back     alignment and domain information
>PRK07309 aromatic amino acid aminotransferase; Validated Back     alignment and domain information
>COG0075 Serine-pyruvate aminotransferase/archaeal aspartate aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02379 ECA_wecE TDP-4-keto-6-deoxy-D-glucose transaminase Back     alignment and domain information
>PRK08064 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK07337 aminotransferase; Validated Back     alignment and domain information
>PF05889 SLA_LP_auto_ag: Soluble liver antigen/liver pancreas antigen (SLA/LP autoantigen); InterPro: IPR008829 This family consists of several eukaryotic and archaeal proteins which are related to the Homo sapiens soluble liver antigen/liver pancreas antigen (SLA/LP autoantigen) Back     alignment and domain information
>PRK00950 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PF05889 SLA_LP_auto_ag: Soluble liver antigen/liver pancreas antigen (SLA/LP autoantigen); InterPro: IPR008829 This family consists of several eukaryotic and archaeal proteins which are related to the Homo sapiens soluble liver antigen/liver pancreas antigen (SLA/LP autoantigen) Back     alignment and domain information
>PRK14807 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>TIGR01885 Orn_aminotrans ornithine aminotransferase Back     alignment and domain information
>PRK06225 aspartate aminotransferase; Provisional Back     alignment and domain information
>PLN00175 aminotransferase family protein; Provisional Back     alignment and domain information
>TIGR01365 serC_2 phosphoserine aminotransferase, Methanosarcina type Back     alignment and domain information
>PRK08861 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK00854 rocD ornithine--oxo-acid transaminase; Reviewed Back     alignment and domain information
>PLN02452 phosphoserine transaminase Back     alignment and domain information
>PRK07681 aspartate aminotransferase; Provisional Back     alignment and domain information
>PLN03026 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK07908 hypothetical protein; Provisional Back     alignment and domain information
>COG2873 MET17 O-acetylhomoserine sulfhydrylase [Amino acid transport and metabolism] Back     alignment and domain information
>PF01053 Cys_Met_Meta_PP: Cys/Met metabolism PLP-dependent enzyme; InterPro: IPR000277 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal) Back     alignment and domain information
>PRK05942 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK15399 lysine decarboxylase LdcC; Provisional Back     alignment and domain information
>PRK08056 threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>PLN02187 rooty/superroot1 Back     alignment and domain information
>PRK04635 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>cd00615 Orn_deC_like Ornithine decarboxylase family Back     alignment and domain information
>PF00155 Aminotran_1_2: Aminotransferase class I and II 1-aminocyclopropane-1-carboxylate synthase signature aspartate aminotransferase signature; InterPro: IPR004839 Aminotransferases share certain mechanistic features with other pyridoxal-phosphate dependent enzymes, such as the covalent binding of the pyridoxal-phosphate group to a lysine residue Back     alignment and domain information
>PRK08114 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK07682 hypothetical protein; Validated Back     alignment and domain information
>PRK07777 aminotransferase; Validated Back     alignment and domain information
>PRK15029 arginine decarboxylase; Provisional Back     alignment and domain information
>PRK03244 argD acetylornithine aminotransferase; Provisional Back     alignment and domain information
>PRK07324 transaminase; Validated Back     alignment and domain information
>TIGR01365 serC_2 phosphoserine aminotransferase, Methanosarcina type Back     alignment and domain information
>PTZ00377 alanine aminotransferase; Provisional Back     alignment and domain information
>PRK06836 aspartate aminotransferase; Provisional Back     alignment and domain information
>TIGR01329 cysta_beta_ly_E cystathionine beta-lyase, eukaryotic Back     alignment and domain information
>TIGR03537 DapC succinyldiaminopimelate transaminase Back     alignment and domain information
>PRK13355 bifunctional HTH-domain containing protein/aminotransferase; Provisional Back     alignment and domain information
>PTZ00433 tyrosine aminotransferase; Provisional Back     alignment and domain information
>PRK06767 methionine gamma-lyase; Provisional Back     alignment and domain information
>PRK08776 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK04073 rocD ornithine--oxo-acid transaminase; Provisional Back     alignment and domain information
>COG0403 GcvP Glycine cleavage system protein P (pyridoxal-binding), N-terminal domain [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07683 aminotransferase A; Validated Back     alignment and domain information
>PRK13578 ornithine decarboxylase; Provisional Back     alignment and domain information
>TIGR03246 arg_catab_astC succinylornithine transaminase family Back     alignment and domain information
>PRK05166 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK07504 O-succinylhomoserine sulfhydrylase; Reviewed Back     alignment and domain information
>COG1982 LdcC Arginine/lysine/ornithine decarboxylases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06107 aspartate aminotransferase; Provisional Back     alignment and domain information
>PTZ00125 ornithine aminotransferase-like protein; Provisional Back     alignment and domain information
>PRK08153 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>COG3033 TnaA Tryptophanase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08045 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>TIGR02618 tyr_phenol_ly tyrosine phenol-lyase Back     alignment and domain information
>PRK08175 aminotransferase; Validated Back     alignment and domain information
>COG0112 GlyA Glycine/serine hydroxymethyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07324 transaminase; Validated Back     alignment and domain information
>PRK04311 selenocysteine synthase; Provisional Back     alignment and domain information
>PRK06207 aspartate aminotransferase; Provisional Back     alignment and domain information
>COG0156 BioF 7-keto-8-aminopelargonate synthetase and related enzymes [Coenzyme metabolism] Back     alignment and domain information
>cd01494 AAT_I Aspartate aminotransferase (AAT) superfamily (fold type I) of pyridoxal phosphate (PLP)-dependent enzymes Back     alignment and domain information
>PRK05994 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>TIGR03576 pyridox_MJ0158 pyridoxal phosphate enzyme, MJ0158 family Back     alignment and domain information
>PRK04870 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>cd00617 Tnase_like Tryptophanase family (Tnase) Back     alignment and domain information
>TIGR01328 met_gam_lyase methionine gamma-lyase Back     alignment and domain information
>PRK03158 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK15400 lysine decarboxylase CadA; Provisional Back     alignment and domain information
>PRK07505 hypothetical protein; Provisional Back     alignment and domain information
>PRK08363 alanine aminotransferase; Validated Back     alignment and domain information
>PRK06434 cystathionine gamma-lyase; Validated Back     alignment and domain information
>TIGR00474 selA seryl-tRNA(sec) selenium transferase Back     alignment and domain information
>PRK09105 putative aminotransferase; Provisional Back     alignment and domain information
>PRK05957 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK08248 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK08133 O-succinylhomoserine sulfhydrylase; Validated Back     alignment and domain information
>PLN00175 aminotransferase family protein; Provisional Back     alignment and domain information
>PRK06348 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK09082 methionine aminotransferase; Validated Back     alignment and domain information
>COG0436 Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02368 alanine transaminase Back     alignment and domain information
>PRK07812 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK12462 phosphoserine aminotransferase; Provisional Back     alignment and domain information
>COG0436 Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08068 transaminase; Reviewed Back     alignment and domain information
>TIGR01265 tyr_nico_aTase tyrosine/nicotianamine aminotransferases Back     alignment and domain information
>PRK09265 aminotransferase AlaT; Validated Back     alignment and domain information
>PRK05387 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>COG3844 Kynureninase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02760 4-aminobutyrate:pyruvate transaminase Back     alignment and domain information
>PRK07811 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK08574 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK07050 cystathionine beta-lyase; Provisional Back     alignment and domain information
>TIGR00707 argD acetylornithine and succinylornithine aminotransferases Back     alignment and domain information
>PRK09276 LL-diaminopimelate aminotransferase; Provisional Back     alignment and domain information
>PRK01278 argD acetylornithine transaminase protein; Provisional Back     alignment and domain information
>PRK08912 hypothetical protein; Provisional Back     alignment and domain information
>PRK04073 rocD ornithine--oxo-acid transaminase; Provisional Back     alignment and domain information
>PLN00143 tyrosine/nicotianamine aminotransferase; Provisional Back     alignment and domain information
>PRK15481 transcriptional regulatory protein PtsJ; Provisional Back     alignment and domain information
>TIGR01324 cysta_beta_ly_B cystathionine beta-lyase, bacterial Back     alignment and domain information
>PRK02627 acetylornithine aminotransferase; Provisional Back     alignment and domain information
>TIGR01264 tyr_amTase_E tyrosine aminotransferase, eukaryotic Back     alignment and domain information
>TIGR01325 O_suc_HS_sulf O-succinylhomoserine sulfhydrylase Back     alignment and domain information
>TIGR02617 tnaA_trp_ase tryptophanase, leader peptide-associated Back     alignment and domain information
>PRK07568 aspartate aminotransferase; Provisional Back     alignment and domain information
>PLN02376 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>TIGR01976 am_tr_V_VC1184 cysteine desulfurase family protein, VC1184 subfamily Back     alignment and domain information
>PLN02231 alanine transaminase Back     alignment and domain information
>PRK04260 acetylornithine aminotransferase; Provisional Back     alignment and domain information
>KOG2467|consensus Back     alignment and domain information
>PRK09148 aminotransferase; Validated Back     alignment and domain information
>PRK08249 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK00854 rocD ornithine--oxo-acid transaminase; Reviewed Back     alignment and domain information
>PRK07550 hypothetical protein; Provisional Back     alignment and domain information
>PRK03715 argD acetylornithine transaminase protein; Provisional Back     alignment and domain information
>PRK03321 putative aminotransferase; Provisional Back     alignment and domain information
>PTZ00433 tyrosine aminotransferase; Provisional Back     alignment and domain information
>PRK03715 argD acetylornithine transaminase protein; Provisional Back     alignment and domain information
>TIGR03537 DapC succinyldiaminopimelate transaminase Back     alignment and domain information
>TIGR01140 L_thr_O3P_dcar L-threonine-O-3-phosphate decarboxylase Back     alignment and domain information
>PTZ00125 ornithine aminotransferase-like protein; Provisional Back     alignment and domain information
>PRK12381 bifunctional succinylornithine transaminase/acetylornithine transaminase; Provisional Back     alignment and domain information
>TIGR02080 O_succ_thio_ly O-succinylhomoserine (thiol)-lyase Back     alignment and domain information
>PRK03317 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK04635 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>TIGR01885 Orn_aminotrans ornithine aminotransferase Back     alignment and domain information
>PRK02610 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PLN00145 tyrosine/nicotianamine aminotransferase; Provisional Back     alignment and domain information
>PRK08636 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK02936 argD acetylornithine aminotransferase; Provisional Back     alignment and domain information
>PRK03967 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK02936 argD acetylornithine aminotransferase; Provisional Back     alignment and domain information
>PRK04781 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK02731 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PF01276 OKR_DC_1: Orn/Lys/Arg decarboxylase, major domain; InterPro: IPR000310 Pyridoxal-dependent decarboxylases are bacterial proteins acting on ornithine, lysine, arginine and related substrates [] Back     alignment and domain information
>PRK08056 threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>TIGR00707 argD acetylornithine and succinylornithine aminotransferases Back     alignment and domain information
>TIGR03538 DapC_gpp succinyldiaminopimelate transaminase Back     alignment and domain information
>COG0403 GcvP Glycine cleavage system protein P (pyridoxal-binding), N-terminal domain [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06176 cystathionine gamma-synthase/cystathionine beta-lyase; Validated Back     alignment and domain information
>PRK06358 threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>PRK07309 aromatic amino acid aminotransferase; Validated Back     alignment and domain information
>COG0161 BioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase [Coenzyme metabolism] Back     alignment and domain information
>PRK06084 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK06290 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK07681 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK07503 methionine gamma-lyase; Provisional Back     alignment and domain information
>PLN02509 cystathionine beta-lyase Back     alignment and domain information
>PRK07049 methionine gamma-lyase; Validated Back     alignment and domain information
>PRK06290 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK03317 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK06836 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK09265 aminotransferase AlaT; Validated Back     alignment and domain information
>PRK07908 hypothetical protein; Provisional Back     alignment and domain information
>PRK05166 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK05769 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK08247 cystathionine gamma-synthase; Reviewed Back     alignment and domain information
>PRK01688 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK06234 methionine gamma-lyase; Provisional Back     alignment and domain information
>PRK05942 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK06358 threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>PRK12414 putative aminotransferase; Provisional Back     alignment and domain information
>PRK11522 putrescine--2-oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>PRK06348 aspartate aminotransferase; Provisional Back     alignment and domain information
>TIGR03540 DapC_direct LL-diaminopimelate aminotransferase Back     alignment and domain information
>PLN02624 ornithine-delta-aminotransferase Back     alignment and domain information
>PRK03158 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK08960 hypothetical protein; Provisional Back     alignment and domain information
>PRK13355 bifunctional HTH-domain containing protein/aminotransferase; Provisional Back     alignment and domain information
>COG1168 MalY Bifunctional PLP-dependent enzyme with beta-cystathionase and maltose regulon repressor activities [Amino acid transport and metabolism] Back     alignment and domain information
>PTZ00377 alanine aminotransferase; Provisional Back     alignment and domain information
>PLN03026 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>COG0001 HemL Glutamate-1-semialdehyde aminotransferase [Coenzyme metabolism] Back     alignment and domain information
>PRK09276 LL-diaminopimelate aminotransferase; Provisional Back     alignment and domain information
>PRK08068 transaminase; Reviewed Back     alignment and domain information
>PRK07810 O-succinylhomoserine sulfhydrylase; Provisional Back     alignment and domain information
>PRK09148 aminotransferase; Validated Back     alignment and domain information
>COG2873 MET17 O-acetylhomoserine sulfhydrylase [Amino acid transport and metabolism] Back     alignment and domain information
>COG4992 ArgD Ornithine/acetylornithine aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01264 tyr_amTase_E tyrosine aminotransferase, eukaryotic Back     alignment and domain information
>PLN02656 tyrosine transaminase Back     alignment and domain information
>PLN02450 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>PRK04260 acetylornithine aminotransferase; Provisional Back     alignment and domain information
>PRK09105 putative aminotransferase; Provisional Back     alignment and domain information
>PRK09147 succinyldiaminopimelate transaminase; Provisional Back     alignment and domain information
>PLN02624 ornithine-delta-aminotransferase Back     alignment and domain information
>PLN00143 tyrosine/nicotianamine aminotransferase; Provisional Back     alignment and domain information
>PLN02187 rooty/superroot1 Back     alignment and domain information
>TIGR02407 ectoine_ectB diaminobutyrate--2-oxoglutarate aminotransferase Back     alignment and domain information
>PRK07482 hypothetical protein; Provisional Back     alignment and domain information
>PRK05093 argD bifunctional N-succinyldiaminopimelate-aminotransferase/acetylornithine transaminase protein; Reviewed Back     alignment and domain information
>TIGR01326 OAH_OAS_sulfhy OAH/OAS sulfhydrylase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query891
1js3_A486 Crystal Structure Of Dopa Decarboxylase In Complex 7e-68
3rbf_A480 Crystal Structure Of Human Aromatic L-Amino Acid De 7e-66
3rch_A480 Crystal Structure Of Human Aromatic L-Amino Acid De 3e-65
3k40_A475 Crystal Structure Of Drosophila 3,4-Dihydroxyphenyl 9e-62
4e1o_A481 Human Histidine Decarboxylase Complex With Histidin 1e-61
2jis_A515 Human Cysteine Sulfinic Acid Decarboxylase (Csad) I 5e-13
2jis_A515 Human Cysteine Sulfinic Acid Decarboxylase (Csad) I 4e-08
2jis_A515 Human Cysteine Sulfinic Acid Decarboxylase (Csad) I 7e-07
2okk_A497 The X-Ray Crystal Structure Of The 65kda Isoform Of 1e-12
2okk_A497 The X-Ray Crystal Structure Of The 65kda Isoform Of 6e-06
3vp6_A511 Structural Characterization Of Glutamic Acid Decarb 3e-12
3vp6_A511 Structural Characterization Of Glutamic Acid Decarb 5e-07
3vp6_A511 Structural Characterization Of Glutamic Acid Decarb 7e-04
2okj_A504 The X-Ray Crystal Structure Of The 67kda Isoform Of 3e-12
2okj_A504 The X-Ray Crystal Structure Of The 67kda Isoform Of 1e-06
2qma_A497 Crystal Structure Of Glutamate Decarboxylase Domain 4e-09
2qma_A497 Crystal Structure Of Glutamate Decarboxylase Domain 1e-04
2qma_A497 Crystal Structure Of Glutamate Decarboxylase Domain 2e-04
>pdb|1JS3|A Chain A, Crystal Structure Of Dopa Decarboxylase In Complex With The Inhibitor Carbidopa Length = 486 Back     alignment and structure 
Iteration: 1

 Score =  255 bits (652), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 130/299 (43%), Positives = 181/299 (60%), Gaps = 44/299 (14%)
Query: 468 VRSSASECIFVCMLAARAQAISKLKKIHPFVDEGVLLSKLMAYCSKEAHSCVEKAAMMAF 527
           ++ SASE   V +LAAR + + +L+   P + +G +L KL+AY S +AHS VE+A ++  
Sbjct: 144 IQGSASEATLVALLAARTKVVRRLQAASPGLTQGAVLEKLVAYASDQAHSSVERAGLIGG 203
Query: 528 VRLKILEPDDKNSLRGATLRQVMQQDETMGYIPFFVSTTLGTTSC--------------- 572
           V+LK +  D K ++R + L++ +++D+  G IPFFV  TLGTTSC               
Sbjct: 204 VKLKAIPSDGKFAMRASALQEALERDKAAGLIPFFVVATLGTTSCCSFDNLLEVGPICHE 263
Query: 573 ----------YRKS-----------QGIEYADSFNVNVNKWLLTAFDSSCLWVADRYKLT 611
                     Y  S            G+E+ADSFN N +KWLL  FD S +WV  R  LT
Sbjct: 264 EDIWLHVDAAYAGSAFICPEFRHLLNGVEFADSFNFNPHKWLLVNFDCSAMWVKRRTDLT 323
Query: 612 SALVVDPLYLQHGHEGA---IDYRHWGIPLSRRFRSLKLWFVIRTYGLSGLQKYIRRHCE 668
            A  +DP+YL+H H+G+    DYRHW +PL RRFRSLK+WFV R YG+ GLQ YIR+H +
Sbjct: 324 GAFKLDPVYLKHSHQGSGLITDYRHWQLPLGRRFRSLKMWFVFRMYGVKGLQAYIRKHVQ 383
Query: 669 LAKLFEGKVRRDPRFEISNDVRLGLVCFRLRSENNLIADQNNRKLLEDINASGRLHMVP 727
           L+  FE  V +DPRFE+  +V LGLVCFRL+  + L     N  LLE IN++ ++H+VP
Sbjct: 384 LSHEFEAFVLQDPRFEVCAEVTLGLVCFRLKGSDGL-----NEALLERINSARKIHLVP 437
>pdb|3RBF|A Chain A, Crystal Structure Of Human Aromatic L-Amino Acid Decarboxylase (Aadc) In The Apo Form Length = 480 Back     alignment and structure
>pdb|3RCH|A Chain A, Crystal Structure Of Human Aromatic L-Amino Acid Decarboxylase (Aadc) In The Open Conformation With Llp And Plp Bound To Chain-A And Chain- B Respectively Length = 480 Back     alignment and structure
>pdb|3K40|A Chain A, Crystal Structure Of Drosophila 3,4-Dihydroxyphenylalanine Decarboxylase Length = 475 Back     alignment and structure
>pdb|4E1O|A Chain A, Human Histidine Decarboxylase Complex With Histidine Methyl Ester (Hme) Length = 481 Back     alignment and structure
>pdb|2JIS|A Chain A, Human Cysteine Sulfinic Acid Decarboxylase (Csad) In Complex With Plp. Length = 515 Back     alignment and structure
>pdb|2JIS|A Chain A, Human Cysteine Sulfinic Acid Decarboxylase (Csad) In Complex With Plp. Length = 515 Back     alignment and structure
>pdb|2JIS|A Chain A, Human Cysteine Sulfinic Acid Decarboxylase (Csad) In Complex With Plp. Length = 515 Back     alignment and structure
>pdb|2OKK|A Chain A, The X-Ray Crystal Structure Of The 65kda Isoform Of Glutamic Acid Decarboxylase (Gad65) Length = 497 Back     alignment and structure
>pdb|2OKK|A Chain A, The X-Ray Crystal Structure Of The 65kda Isoform Of Glutamic Acid Decarboxylase (Gad65) Length = 497 Back     alignment and structure
>pdb|3VP6|A Chain A, Structural Characterization Of Glutamic Acid Decarboxylase; Insights Into The Mechanism Of Autoinactivation Length = 511 Back     alignment and structure
>pdb|3VP6|A Chain A, Structural Characterization Of Glutamic Acid Decarboxylase; Insights Into The Mechanism Of Autoinactivation Length = 511 Back     alignment and structure
>pdb|3VP6|A Chain A, Structural Characterization Of Glutamic Acid Decarboxylase; Insights Into The Mechanism Of Autoinactivation Length = 511 Back     alignment and structure
>pdb|2OKJ|A Chain A, The X-Ray Crystal Structure Of The 67kda Isoform Of Glutamic Acid Decarboxylase (Gad67) Length = 504 Back     alignment and structure
>pdb|2OKJ|A Chain A, The X-Ray Crystal Structure Of The 67kda Isoform Of Glutamic Acid Decarboxylase (Gad67) Length = 504 Back     alignment and structure
>pdb|2QMA|A Chain A, Crystal Structure Of Glutamate Decarboxylase Domain Of Diaminobutyrate-Pyruvate Transaminase And L-2,4-Diaminobutyrate Decarboxylase From Vibrio Parahaemolyticus Length = 497 Back     alignment and structure
>pdb|2QMA|A Chain A, Crystal Structure Of Glutamate Decarboxylase Domain Of Diaminobutyrate-Pyruvate Transaminase And L-2,4-Diaminobutyrate Decarboxylase From Vibrio Parahaemolyticus Length = 497 Back     alignment and structure
>pdb|2QMA|A Chain A, Crystal Structure Of Glutamate Decarboxylase Domain Of Diaminobutyrate-Pyruvate Transaminase And L-2,4-Diaminobutyrate Decarboxylase From Vibrio Parahaemolyticus Length = 497 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query891
4e1o_A481 HDC, histidine decarboxylase; lyase; HET: PLP PVH; 1e-102
4e1o_A481 HDC, histidine decarboxylase; lyase; HET: PLP PVH; 4e-88
4e1o_A481 HDC, histidine decarboxylase; lyase; HET: PLP PVH; 2e-66
4e1o_A481 HDC, histidine decarboxylase; lyase; HET: PLP PVH; 2e-10
4e1o_A481 HDC, histidine decarboxylase; lyase; HET: PLP PVH; 2e-05
1js3_A486 DDC;, DOPA decarboxylase; carbidopa, parkinson'S d 1e-100
1js3_A486 DDC;, DOPA decarboxylase; carbidopa, parkinson'S d 1e-86
1js3_A486 DDC;, DOPA decarboxylase; carbidopa, parkinson'S d 2e-65
1js3_A486 DDC;, DOPA decarboxylase; carbidopa, parkinson'S d 4e-10
1js3_A486 DDC;, DOPA decarboxylase; carbidopa, parkinson'S d 1e-05
3k40_A475 Aromatic-L-amino-acid decarboxylase; PLP dependent 1e-100
3k40_A475 Aromatic-L-amino-acid decarboxylase; PLP dependent 2e-84
3k40_A475 Aromatic-L-amino-acid decarboxylase; PLP dependent 4e-67
3k40_A475 Aromatic-L-amino-acid decarboxylase; PLP dependent 1e-09
3k40_A475 Aromatic-L-amino-acid decarboxylase; PLP dependent 3e-05
2qma_A497 Diaminobutyrate-pyruvate transaminase and L-2,4- d 2e-87
2qma_A497 Diaminobutyrate-pyruvate transaminase and L-2,4- d 1e-75
2qma_A497 Diaminobutyrate-pyruvate transaminase and L-2,4- d 4e-61
2qma_A497 Diaminobutyrate-pyruvate transaminase and L-2,4- d 2e-06
2qma_A497 Diaminobutyrate-pyruvate transaminase and L-2,4- d 3e-04
2okj_A504 Glutamate decarboxylase 1; PLP-dependent decarboxy 1e-85
2okj_A504 Glutamate decarboxylase 1; PLP-dependent decarboxy 5e-80
2okj_A504 Glutamate decarboxylase 1; PLP-dependent decarboxy 3e-64
2okj_A504 Glutamate decarboxylase 1; PLP-dependent decarboxy 5e-07
2jis_A515 Cysteine sulfinic acid decarboxylase; pyridoxal ph 2e-81
2jis_A515 Cysteine sulfinic acid decarboxylase; pyridoxal ph 3e-77
2jis_A515 Cysteine sulfinic acid decarboxylase; pyridoxal ph 3e-60
2jis_A515 Cysteine sulfinic acid decarboxylase; pyridoxal ph 2e-06
3mad_A514 Sphingosine-1-phosphate lyase; carboxy-lyase activ 3e-14
3mad_A514 Sphingosine-1-phosphate lyase; carboxy-lyase activ 3e-13
3mad_A514 Sphingosine-1-phosphate lyase; carboxy-lyase activ 2e-11
3mc6_A497 Sphingosine-1-phosphate lyase; carboxy-lyase activ 3e-14
3mc6_A497 Sphingosine-1-phosphate lyase; carboxy-lyase activ 2e-12
3mc6_A497 Sphingosine-1-phosphate lyase; carboxy-lyase activ 6e-09
2z67_A456 O-phosphoseryl-tRNA(SEC) selenium transferase; sel 2e-13
2z67_A456 O-phosphoseryl-tRNA(SEC) selenium transferase; sel 5e-11
2z67_A456 O-phosphoseryl-tRNA(SEC) selenium transferase; sel 3e-10
3f9t_A397 TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L 6e-12
3f9t_A397 TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L 5e-06
3f9t_A397 TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L 5e-06
3hbx_A502 GAD 1, glutamate decarboxylase 1; calmodulin-bindi 2e-09
3hbx_A502 GAD 1, glutamate decarboxylase 1; calmodulin-bindi 6e-09
3hbx_A502 GAD 1, glutamate decarboxylase 1; calmodulin-bindi 2e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-08
2dgk_A452 GAD-beta, GADB, glutamate decarboxylase beta; gadb 1e-07
2dgk_A452 GAD-beta, GADB, glutamate decarboxylase beta; gadb 3e-05
2dgk_A452 GAD-beta, GADB, glutamate decarboxylase beta; gadb 1e-04
>4e1o_A HDC, histidine decarboxylase; lyase; HET: PLP PVH; 1.80A {Homo sapiens} Length = 481 Back     alignment and structure
 Score =  325 bits (835), Expect = e-102
 Identities = 122/297 (41%), Positives = 171/297 (57%), Gaps = 42/297 (14%)

Query: 470 SSASECIFVCMLAARAQAISKLKKIHPFVDEGVLLSKLMAYCSKEAHSCVEKAAMMAFVR 529
           S+ SE   + +LAAR   I ++K   P  DE  L ++L+AY S +AHS VEKA +++ V+
Sbjct: 152 STVSESTLIALLAARKNKILEMKTSEPDADESSLNARLVAYASDQAHSSVEKAGLISLVK 211

Query: 530 LKILEPDDKNSLRGATLRQVMQQDETMGYIPFFVSTTLGTTSC----------------- 572
           +K L  DD  SLRG  L++ +++D+  G +P FV  TLGTT                   
Sbjct: 212 MKFLPVDDNFSLRGEALQKAIEEDKQRGLVPVFVCATLGTTGVCAFDCLSELGPICAREG 271

Query: 573 ------------------YR-KSQGIEYADSFNVNVNKWLLTAFDSSCLWVADRYKLTSA 613
                             +R   +GIEYADSF  N +KW++  FD +  WV D+YKL   
Sbjct: 272 LWLHIDAAYAGTAFLCPEFRGFLKGIEYADSFTFNPSKWMMVHFDCTGFWVKDKYKLQQT 331

Query: 614 LVVDPLYLQHGHEG-AIDYRHWGIPLSRRFRSLKLWFVIRTYGLSGLQKYIRRHCELAKL 672
             V+P+YL+H + G A D+ HW IPLSRRFRS+KLWFVIR++G+  LQ ++R   E+AK 
Sbjct: 332 FSVNPIYLRHANSGVATDFMHWQIPLSRRFRSVKLWFVIRSFGVKNLQAHVRHGTEMAKY 391

Query: 673 FEGKVRRDPRFEISNDVRLGLVCFRLRSENNLIADQNNRKLLEDINASGRLHMVPAS 729
           FE  VR DP FEI     LGLV FRL+  N+L        +L++I  +GRL ++PA+
Sbjct: 392 FESLVRNDPSFEIPAKRHLGLVVFRLKGPNSL-----TENVLKEIAKAGRLFLIPAT 443
>4e1o_A HDC, histidine decarboxylase; lyase; HET: PLP PVH; 1.80A {Homo sapiens} Length = 481 Back     alignment and structure
>4e1o_A HDC, histidine decarboxylase; lyase; HET: PLP PVH; 1.80A {Homo sapiens} Length = 481 Back     alignment and structure
>4e1o_A HDC, histidine decarboxylase; lyase; HET: PLP PVH; 1.80A {Homo sapiens} Length = 481 Back     alignment and structure
>4e1o_A HDC, histidine decarboxylase; lyase; HET: PLP PVH; 1.80A {Homo sapiens} Length = 481 Back     alignment and structure
>1js3_A DDC;, DOPA decarboxylase; carbidopa, parkinson'S disease, vitamin; HET: PLP 142; 2.25A {Sus scrofa} SCOP: c.67.1.6 PDB: 1js6_A* 3rch_A* 3rbl_A 3rbf_A* Length = 486 Back     alignment and structure
>1js3_A DDC;, DOPA decarboxylase; carbidopa, parkinson'S disease, vitamin; HET: PLP 142; 2.25A {Sus scrofa} SCOP: c.67.1.6 PDB: 1js6_A* 3rch_A* 3rbl_A 3rbf_A* Length = 486 Back     alignment and structure
>1js3_A DDC;, DOPA decarboxylase; carbidopa, parkinson'S disease, vitamin; HET: PLP 142; 2.25A {Sus scrofa} SCOP: c.67.1.6 PDB: 1js6_A* 3rch_A* 3rbl_A 3rbf_A* Length = 486 Back     alignment and structure
>1js3_A DDC;, DOPA decarboxylase; carbidopa, parkinson'S disease, vitamin; HET: PLP 142; 2.25A {Sus scrofa} SCOP: c.67.1.6 PDB: 1js6_A* 3rch_A* 3rbl_A 3rbf_A* Length = 486 Back     alignment and structure
>1js3_A DDC;, DOPA decarboxylase; carbidopa, parkinson'S disease, vitamin; HET: PLP 142; 2.25A {Sus scrofa} SCOP: c.67.1.6 PDB: 1js6_A* 3rch_A* 3rbl_A 3rbf_A* Length = 486 Back     alignment and structure
>3k40_A Aromatic-L-amino-acid decarboxylase; PLP dependent protein, alpha beta protein, alternative splicing, catecholamine biosynthesis, lyase; HET: LLP; 1.75A {Drosophila melanogaster} Length = 475 Back     alignment and structure
>3k40_A Aromatic-L-amino-acid decarboxylase; PLP dependent protein, alpha beta protein, alternative splicing, catecholamine biosynthesis, lyase; HET: LLP; 1.75A {Drosophila melanogaster} Length = 475 Back     alignment and structure
>3k40_A Aromatic-L-amino-acid decarboxylase; PLP dependent protein, alpha beta protein, alternative splicing, catecholamine biosynthesis, lyase; HET: LLP; 1.75A {Drosophila melanogaster} Length = 475 Back     alignment and structure
>3k40_A Aromatic-L-amino-acid decarboxylase; PLP dependent protein, alpha beta protein, alternative splicing, catecholamine biosynthesis, lyase; HET: LLP; 1.75A {Drosophila melanogaster} Length = 475 Back     alignment and structure
>3k40_A Aromatic-L-amino-acid decarboxylase; PLP dependent protein, alpha beta protein, alternative splicing, catecholamine biosynthesis, lyase; HET: LLP; 1.75A {Drosophila melanogaster} Length = 475 Back     alignment and structure
>2qma_A Diaminobutyrate-pyruvate transaminase and L-2,4- diaminobutyrate decarboxylase; structural genomics, APC91511.1, glutamate decarboxylase; HET: MSE; 1.81A {Vibrio parahaemolyticus} Length = 497 Back     alignment and structure
>2qma_A Diaminobutyrate-pyruvate transaminase and L-2,4- diaminobutyrate decarboxylase; structural genomics, APC91511.1, glutamate decarboxylase; HET: MSE; 1.81A {Vibrio parahaemolyticus} Length = 497 Back     alignment and structure
>2qma_A Diaminobutyrate-pyruvate transaminase and L-2,4- diaminobutyrate decarboxylase; structural genomics, APC91511.1, glutamate decarboxylase; HET: MSE; 1.81A {Vibrio parahaemolyticus} Length = 497 Back     alignment and structure
>2qma_A Diaminobutyrate-pyruvate transaminase and L-2,4- diaminobutyrate decarboxylase; structural genomics, APC91511.1, glutamate decarboxylase; HET: MSE; 1.81A {Vibrio parahaemolyticus} Length = 497 Back     alignment and structure
>2qma_A Diaminobutyrate-pyruvate transaminase and L-2,4- diaminobutyrate decarboxylase; structural genomics, APC91511.1, glutamate decarboxylase; HET: MSE; 1.81A {Vibrio parahaemolyticus} Length = 497 Back     alignment and structure
>2okj_A Glutamate decarboxylase 1; PLP-dependent decarboxylase, lyase; HET: LLP PLZ; 2.30A {Homo sapiens} PDB: 2okk_A* Length = 504 Back     alignment and structure
>2okj_A Glutamate decarboxylase 1; PLP-dependent decarboxylase, lyase; HET: LLP PLZ; 2.30A {Homo sapiens} PDB: 2okk_A* Length = 504 Back     alignment and structure
>2okj_A Glutamate decarboxylase 1; PLP-dependent decarboxylase, lyase; HET: LLP PLZ; 2.30A {Homo sapiens} PDB: 2okk_A* Length = 504 Back     alignment and structure
>2okj_A Glutamate decarboxylase 1; PLP-dependent decarboxylase, lyase; HET: LLP PLZ; 2.30A {Homo sapiens} PDB: 2okk_A* Length = 504 Back     alignment and structure
>2jis_A Cysteine sulfinic acid decarboxylase; pyridoxal phosphate, alternative splicing, pyridoxal phosphate (PLP), structural genomics consortium (SGC); HET: PLP; 1.6A {Homo sapiens} Length = 515 Back     alignment and structure
>2jis_A Cysteine sulfinic acid decarboxylase; pyridoxal phosphate, alternative splicing, pyridoxal phosphate (PLP), structural genomics consortium (SGC); HET: PLP; 1.6A {Homo sapiens} Length = 515 Back     alignment and structure
>2jis_A Cysteine sulfinic acid decarboxylase; pyridoxal phosphate, alternative splicing, pyridoxal phosphate (PLP), structural genomics consortium (SGC); HET: PLP; 1.6A {Homo sapiens} Length = 515 Back     alignment and structure
>2jis_A Cysteine sulfinic acid decarboxylase; pyridoxal phosphate, alternative splicing, pyridoxal phosphate (PLP), structural genomics consortium (SGC); HET: PLP; 1.6A {Homo sapiens} Length = 515 Back     alignment and structure
>3mad_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxal phosphate; HET: LLP; 2.00A {Symbiobacterium thermophilum} PDB: 3maf_A* 3mau_A* 3mbb_A* Length = 514 Back     alignment and structure
>3mad_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxal phosphate; HET: LLP; 2.00A {Symbiobacterium thermophilum} PDB: 3maf_A* 3mau_A* 3mbb_A* Length = 514 Back     alignment and structure
>3mad_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxal phosphate; HET: LLP; 2.00A {Symbiobacterium thermophilum} PDB: 3maf_A* 3mau_A* 3mbb_A* Length = 514 Back     alignment and structure
>3mc6_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxyl phosphate; HET: LLP; 3.15A {Saccharomyces cerevisiae} Length = 497 Back     alignment and structure
>3mc6_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxyl phosphate; HET: LLP; 3.15A {Saccharomyces cerevisiae} Length = 497 Back     alignment and structure
>3mc6_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxyl phosphate; HET: LLP; 3.15A {Saccharomyces cerevisiae} Length = 497 Back     alignment and structure
>2z67_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine biosynthesis, seven-stranded BETE-strand, PYR 5'-phosphate; HET: PLP; 2.50A {Methanococcus maripaludis} SCOP: c.67.1.9 Length = 456 Back     alignment and structure
>2z67_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine biosynthesis, seven-stranded BETE-strand, PYR 5'-phosphate; HET: PLP; 2.50A {Methanococcus maripaludis} SCOP: c.67.1.9 Length = 456 Back     alignment and structure
>2z67_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine biosynthesis, seven-stranded BETE-strand, PYR 5'-phosphate; HET: PLP; 2.50A {Methanococcus maripaludis} SCOP: c.67.1.9 Length = 456 Back     alignment and structure
>3f9t_A TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L-tyrosine decarboxylase MFNA (EC 4.1.1.25), ST genomics; HET: PLP; 2.11A {Methanocaldococcus jannaschii} Length = 397 Back     alignment and structure
>3f9t_A TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L-tyrosine decarboxylase MFNA (EC 4.1.1.25), ST genomics; HET: PLP; 2.11A {Methanocaldococcus jannaschii} Length = 397 Back     alignment and structure
>3f9t_A TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L-tyrosine decarboxylase MFNA (EC 4.1.1.25), ST genomics; HET: PLP; 2.11A {Methanocaldococcus jannaschii} Length = 397 Back     alignment and structure
>3hbx_A GAD 1, glutamate decarboxylase 1; calmodulin-binding, lyase, pyridoxal phosphate; HET: LLP; 2.67A {Arabidopsis thaliana} Length = 502 Back     alignment and structure
>3hbx_A GAD 1, glutamate decarboxylase 1; calmodulin-binding, lyase, pyridoxal phosphate; HET: LLP; 2.67A {Arabidopsis thaliana} Length = 502 Back     alignment and structure
>3hbx_A GAD 1, glutamate decarboxylase 1; calmodulin-binding, lyase, pyridoxal phosphate; HET: LLP; 2.67A {Arabidopsis thaliana} Length = 502 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2dgk_A GAD-beta, GADB, glutamate decarboxylase beta; gadbd1-14, autoinhibition, substituted aldamine, lyase; HET: PLP; 1.90A {Escherichia coli} PDB: 2dgm_A* 1pmo_A* 2dgl_A* 1pmm_A* 3fz6_A* 3fz7_A 3fz8_A* 1xey_A* Length = 452 Back     alignment and structure
>2dgk_A GAD-beta, GADB, glutamate decarboxylase beta; gadbd1-14, autoinhibition, substituted aldamine, lyase; HET: PLP; 1.90A {Escherichia coli} PDB: 2dgm_A* 1pmo_A* 2dgl_A* 1pmm_A* 3fz6_A* 3fz7_A 3fz8_A* 1xey_A* Length = 452 Back     alignment and structure
>2dgk_A GAD-beta, GADB, glutamate decarboxylase beta; gadbd1-14, autoinhibition, substituted aldamine, lyase; HET: PLP; 1.90A {Escherichia coli} PDB: 2dgm_A* 1pmo_A* 2dgl_A* 1pmm_A* 3fz6_A* 3fz7_A 3fz8_A* 1xey_A* Length = 452 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query891
3k40_A475 Aromatic-L-amino-acid decarboxylase; PLP dependent 100.0
4e1o_A481 HDC, histidine decarboxylase; lyase; HET: PLP PVH; 100.0
3vp6_A511 Glutamate decarboxylase 1; catalytic loop SWAP, ly 100.0
1js3_A486 DDC;, DOPA decarboxylase; carbidopa, parkinson'S d 100.0
2qma_A497 Diaminobutyrate-pyruvate transaminase and L-2,4- d 100.0
2okj_A504 Glutamate decarboxylase 1; PLP-dependent decarboxy 100.0
2jis_A515 Cysteine sulfinic acid decarboxylase; pyridoxal ph 100.0
2dgk_A452 GAD-beta, GADB, glutamate decarboxylase beta; gadb 100.0
3hbx_A502 GAD 1, glutamate decarboxylase 1; calmodulin-bindi 100.0
3bc8_A450 O-phosphoseryl-tRNA(SEC) selenium transferase; dis 99.96
3mc6_A497 Sphingosine-1-phosphate lyase; carboxy-lyase activ 99.94
3mad_A514 Sphingosine-1-phosphate lyase; carboxy-lyase activ 99.93
2z67_A456 O-phosphoseryl-tRNA(SEC) selenium transferase; sel 99.91
3f9t_A397 TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L 99.86
4e1o_A481 HDC, histidine decarboxylase; lyase; HET: PLP PVH; 99.82
3k40_A475 Aromatic-L-amino-acid decarboxylase; PLP dependent 99.82
3hl2_A501 O-phosphoseryl-tRNA(SEC) selenium transferase; sel 99.82
3mc6_A497 Sphingosine-1-phosphate lyase; carboxy-lyase activ 99.81
3mad_A514 Sphingosine-1-phosphate lyase; carboxy-lyase activ 99.79
4hvk_A382 Probable cysteine desulfurase 2; transferase and I 99.75
1wyu_B474 Glycine dehydrogenase subunit 2 (P-protein); alpha 99.75
3bc8_A450 O-phosphoseryl-tRNA(SEC) selenium transferase; dis 99.75
2z67_A456 O-phosphoseryl-tRNA(SEC) selenium transferase; sel 99.75
3nnk_A411 Ureidoglycine-glyoxylate aminotransferase; PLP-dep 99.74
3f9t_A397 TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L 99.73
2dr1_A386 PH1308 protein, 386AA long hypothetical serine ami 99.71
3ffr_A362 Phosphoserine aminotransferase SERC; structural ge 99.7
3vp6_A511 Glutamate decarboxylase 1; catalytic loop SWAP, ly 99.68
3zrp_A384 Serine-pyruvate aminotransferase (AGXT); HET: PLP; 99.67
1t3i_A420 Probable cysteine desulfurase; PLP-binding enzyme, 99.67
3isl_A416 Purine catabolism protein PUCG; pyridoxalphosphate 99.65
1kmj_A406 Selenocysteine lyase; persulfide perselenide NIFS 99.64
1js3_A486 DDC;, DOPA decarboxylase; carbidopa, parkinson'S d 99.64
4eb5_A382 Probable cysteine desulfurase 2; scaffold, transfe 99.62
3qm2_A386 Phosphoserine aminotransferase; structural genomic 99.62
1iug_A352 Putative aspartate aminotransferase; wild type, py 99.62
3lvm_A423 Cysteine desulfurase; structural genomics, montrea 99.62
2z9v_A392 Aspartate aminotransferase; pyridoxamine, pyruvate 99.6
2okj_A504 Glutamate decarboxylase 1; PLP-dependent decarboxy 99.6
3vax_A400 Putative uncharacterized protein DNDA; desulfurase 99.59
3e9k_A465 Kynureninase; kynurenine-L-hydrolase, kynurenine h 99.58
2yrr_A353 Aminotransferase, class V; structural genomics, NP 99.58
3a9z_A432 Selenocysteine lyase; PLP, cytoplasm, pyridoxal ph 99.57
2qma_A497 Diaminobutyrate-pyruvate transaminase and L-2,4- d 99.57
1wyu_B474 Glycine dehydrogenase subunit 2 (P-protein); alpha 99.56
3kgw_A393 Alanine-glyoxylate aminotransferase; AAH25799.1, p 99.56
1eg5_A384 Aminotransferase; PLP-dependent enzymes, iron-sulf 99.56
1vjo_A393 Alanine--glyoxylate aminotransferase; 17130350, AL 99.56
2jis_A515 Cysteine sulfinic acid decarboxylase; pyridoxal ph 99.55
3cai_A406 Possible aminotransferase; RV3778C; 1.80A {Mycobac 99.54
3m5u_A361 Phosphoserine aminotransferase; alpha-beta half sa 99.54
2huf_A393 Alanine glyoxylate aminotransferase; alpha and bet 99.54
2bkw_A385 Alanine-glyoxylate aminotransferase 1; analine-gly 99.53
3e77_A377 Phosphoserine aminotransferase; SERC, PLP, structu 99.51
1wyu_A438 Glycine dehydrogenase (decarboxylating) subunit 1; 99.51
3isl_A416 Purine catabolism protein PUCG; pyridoxalphosphate 99.51
3hl2_A501 O-phosphoseryl-tRNA(SEC) selenium transferase; sel 99.5
4eb5_A382 Probable cysteine desulfurase 2; scaffold, transfe 99.49
3kgw_A393 Alanine-glyoxylate aminotransferase; AAH25799.1, p 99.48
1elu_A390 L-cysteine/L-cystine C-S lyase; FES cluster biosyn 99.47
2ch1_A396 3-hydroxykynurenine transaminase; PLP-enzyme, kynu 99.47
2e7j_A371 SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-st 99.46
2yrr_A353 Aminotransferase, class V; structural genomics, NP 99.46
3ke3_A379 Putative serine-pyruvate aminotransferase; structu 99.45
3f0h_A376 Aminotransferase; RER070207000802, structural geno 99.45
3e77_A377 Phosphoserine aminotransferase; SERC, PLP, structu 99.45
3e9k_A465 Kynureninase; kynurenine-L-hydrolase, kynurenine h 99.44
1vjo_A393 Alanine--glyoxylate aminotransferase; 17130350, AL 99.43
2vyc_A755 Biodegradative arginine decarboxylase; pyridoxal p 99.43
1svv_A359 Threonine aldolase; structural genomics, structura 99.42
2huf_A393 Alanine glyoxylate aminotransferase; alpha and bet 99.42
2z9v_A392 Aspartate aminotransferase; pyridoxamine, pyruvate 99.42
1m32_A366 2-aminoethylphosphonate-pyruvate aminotransferase; 99.41
3lvm_A423 Cysteine desulfurase; structural genomics, montrea 99.41
3hbx_A502 GAD 1, glutamate decarboxylase 1; calmodulin-bindi 99.4
1qz9_A416 Kynureninase; kynurenine, tryptophan, PLP, vitamin 99.4
3tqx_A399 2-amino-3-ketobutyrate coenzyme A ligase; energy m 99.4
2ch1_A396 3-hydroxykynurenine transaminase; PLP-enzyme, kynu 99.4
1m32_A366 2-aminoethylphosphonate-pyruvate aminotransferase; 99.39
1v72_A356 Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2 99.38
3m5u_A361 Phosphoserine aminotransferase; alpha-beta half sa 99.37
1elu_A390 L-cysteine/L-cystine C-S lyase; FES cluster biosyn 99.37
2fnu_A375 Aminotransferase; protein-product complex, structu 99.37
1rv3_A483 Serine hydroxymethyltransferase, cytosolic; one-ca 99.37
2dgk_A452 GAD-beta, GADB, glutamate decarboxylase beta; gadb 99.37
3vax_A400 Putative uncharacterized protein DNDA; desulfurase 99.34
2fnu_A375 Aminotransferase; protein-product complex, structu 99.33
1wyu_A438 Glycine dehydrogenase (decarboxylating) subunit 1; 99.32
1eg5_A384 Aminotransferase; PLP-dependent enzymes, iron-sulf 99.32
2bkw_A385 Alanine-glyoxylate aminotransferase 1; analine-gly 99.32
3f0h_A376 Aminotransferase; RER070207000802, structural geno 99.3
1v72_A356 Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2 99.29
1j32_A388 Aspartate aminotransferase; HET: PLP; 2.10A {Phorm 99.29
2w8t_A427 SPT, serine palmitoyltransferase; HET: LLP; 1.25A 99.29
3cai_A406 Possible aminotransferase; RV3778C; 1.80A {Mycobac 99.28
3dzz_A391 Putative pyridoxal 5'-phosphate-dependent C-S LYA; 99.28
1b9h_A388 AHBA synthase, protein (3-amino-5-hydroxybenzoic a 99.27
2a7v_A490 Serine hydroxymethyltransferase; structural genomi 99.26
2c81_A418 Glutamine-2-deoxy-scyllo-inosose aminotransferase; 99.25
3uwc_A374 Nucleotide-sugar aminotransferase; lipopolysacchar 99.24
2cb1_A412 O-acetyl homoserine sulfhydrylase; PLP enzyme, lya 99.24
3n0l_A417 Serine hydroxymethyltransferase; alpha beta class, 99.23
3ke3_A379 Putative serine-pyruvate aminotransferase; structu 99.22
3frk_A373 QDTB; aminotransferase, sugar-modification, natura 99.22
3b8x_A390 WBDK, pyridoxamine 5-phosphate-dependent dehydrase 99.22
2e7j_A371 SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-st 99.22
3dr4_A391 Putative perosamine synthetase; deoxysugar, pyrido 99.21
1b9h_A388 AHBA synthase, protein (3-amino-5-hydroxybenzoic a 99.2
2x3l_A446 ORN/Lys/Arg decarboxylase family protein; lyase; H 99.2
1qz9_A416 Kynureninase; kynurenine, tryptophan, PLP, vitamin 99.19
3dr4_A391 Putative perosamine synthetase; deoxysugar, pyrido 99.19
3qhx_A392 Cystathionine gamma-synthase METB (CGS); structura 99.18
1c4k_A730 Protein (ornithine decarboxylase); lyase; HET: PLP 99.18
1svv_A359 Threonine aldolase; structural genomics, structura 99.18
2vi8_A405 Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, 99.18
3frk_A373 QDTB; aminotransferase, sugar-modification, natura 99.17
1gd9_A389 Aspartate aminotransferase; pyridoxal enzyme, temp 99.17
1o69_A394 Aminotransferase; structural genomics, unknown fun 99.17
3l8a_A421 METC, putative aminotransferase, probable beta-cys 99.16
2c81_A418 Glutamine-2-deoxy-scyllo-inosose aminotransferase; 99.16
3nra_A407 Aspartate aminotransferase; structural genomics, j 99.16
3a9z_A432 Selenocysteine lyase; PLP, cytoplasm, pyridoxal ph 99.15
3nyt_A367 Aminotransferase WBPE; PLP binding, nucleotide-sug 99.15
3uwc_A374 Nucleotide-sugar aminotransferase; lipopolysacchar 99.15
2dkj_A407 Serine hydroxymethyltransferase; PLP dependent enz 99.15
1xi9_A406 Putative transaminase; alanine aminotransferase, s 99.14
2gb3_A409 Aspartate aminotransferase; TM1698, structural gen 99.14
2rfv_A398 Methionine gamma-lyase; pyridoxal-5'-phosphate, PL 99.13
1o69_A394 Aminotransferase; structural genomics, unknown fun 99.13
1mdo_A393 ARNB aminotransferase; type 1 aminotransferase fol 99.12
2oga_A399 Transaminase; PLP-dependent enzyme, desosamine, de 99.11
2c0r_A362 PSAT, phosphoserine aminotransferase; pyridoxal-5' 99.11
1o4s_A389 Aspartate aminotransferase; TM1255, structural gen 99.11
2ctz_A421 O-acetyl-L-homoserine sulfhydrylase; crystal, O-ac 99.1
3b8x_A390 WBDK, pyridoxamine 5-phosphate-dependent dehydrase 99.09
4dq6_A391 Putative pyridoxal phosphate-dependent transferas; 99.09
2po3_A424 4-dehydrase; external aldimine, PLP, aminotransfer 99.08
1gc0_A398 Methionine gamma-lyase; pyridoxal-5'-phosphate; HE 99.08
2vyc_A755 Biodegradative arginine decarboxylase; pyridoxal p 99.08
3g0t_A437 Putative aminotransferase; NP_905498.1, putative a 99.08
1u08_A386 Hypothetical aminotransferase YBDL; alpha beta pro 99.08
2o0r_A411 RV0858C (N-succinyldiaminopimelate aminotransfera; 99.06
1c7n_A399 Cystalysin; transferase, aminotransferase, pyridox 99.06
3euc_A367 Histidinol-phosphate aminotransferase 2; YP_297314 99.06
3ri6_A430 O-acetylhomoserine sulfhydrylase; PYR 5'-phosphate 99.06
2zc0_A407 Alanine glyoxylate transaminase; alanine:glyoxylat 99.05
1fc4_A401 2-amino-3-ketobutyrate conenzyme A ligase; 2-amino 99.05
2oga_A399 Transaminase; PLP-dependent enzyme, desosamine, de 99.04
3kax_A383 Aminotransferase, classes I and II; PLP, C-S lyase 99.03
1qgn_A445 Protein (cystathionine gamma-synthase); methionine 99.03
3cq5_A369 Histidinol-phosphate aminotransferase; PLP, PMP, a 99.03
3dzz_A391 Putative pyridoxal 5'-phosphate-dependent C-S LYA; 99.03
2bwn_A401 5-aminolevulinate synthase; tetrapyrrole biosynthe 99.02
3kki_A409 CAI-1 autoinducer synthase; quorum sensing, CQSA, 99.02
3gbx_A420 Serine hydroxymethyltransferase; structural genomi 99.02
1bw0_A416 TAT, protein (tyrosine aminotransferase); tyrosine 99.02
1w23_A360 Phosphoserine aminotransferase; pyridoxal-5'-phosp 99.02
1jg8_A347 L-ALLO-threonine aldolase; glycine biosynthesis, p 99.01
1v2d_A381 Glutamine aminotransferase; PLP, riken structural 99.01
3ly1_A354 Putative histidinol-phosphate aminotransferase; st 99.01
2c0r_A362 PSAT, phosphoserine aminotransferase; pyridoxal-5' 99.01
3ju7_A377 Putative PLP-dependent aminotransferase; NP_978343 99.0
3dyd_A427 Tyrosine aminotransferase; PLP, SGC, structural ge 99.0
2fyf_A398 PSAT, phosphoserine aminotransferase; PLP-dependen 99.0
1d2f_A390 MALY protein; aminotransferase fold, large PLP-bin 99.0
3aow_A448 Putative uncharacterized protein PH0207; protein-P 98.99
2fq6_A415 Cystathionine beta-lyase; protein-inhibitor comple 98.99
1mdo_A393 ARNB aminotransferase; type 1 aminotransferase fol 98.98
3n75_A715 LDC, lysine decarboxylase, inducible; pyridoxal-5' 98.98
2fyf_A398 PSAT, phosphoserine aminotransferase; PLP-dependen 98.98
3ecd_A425 Serine hydroxymethyltransferase 2; ssgcid, decode, 98.98
3a2b_A398 Serine palmitoyltransferase; vitamin B6-dependent 98.97
3euc_A367 Histidinol-phosphate aminotransferase 2; YP_297314 98.97
2z61_A370 Probable aspartate aminotransferase 2; amino acid 98.97
2po3_A424 4-dehydrase; external aldimine, PLP, aminotransfer 98.97
3acz_A389 Methionine gamma-lyase; L-methionine; HET: LLP; 1. 98.95
3ffh_A363 Histidinol-phosphate aminotransferase; APC88260, l 98.95
3tcm_A500 Alanine aminotransferase 2; pyridoxal phosphate (P 98.95
3a2b_A398 Serine palmitoyltransferase; vitamin B6-dependent 98.95
1e5e_A404 MGL, methionine gamma-lyase; methionine biosynthes 98.95
3ftb_A361 Histidinol-phosphate aminotransferase; structural 98.94
3h14_A391 Aminotransferase, classes I and II; YP_167802.1, S 98.94
1w23_A360 Phosphoserine aminotransferase; pyridoxal-5'-phosp 98.94
1j32_A388 Aspartate aminotransferase; HET: PLP; 2.10A {Phorm 98.94
3ffh_A363 Histidinol-phosphate aminotransferase; APC88260, l 98.93
3lws_A357 Aromatic amino acid beta-eliminating lyase/threoni 98.93
2vi8_A405 Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, 98.93
2cb1_A412 O-acetyl homoserine sulfhydrylase; PLP enzyme, lya 98.93
3h7f_A447 Serine hydroxymethyltransferase 1; cytoplasm, one- 98.92
1ax4_A467 Tryptophanase; tryptophan biosynthesis, tryptophan 98.92
1bs0_A384 Protein (8-amino-7-oxonanoate synthase); PLP-depen 98.92
3fdb_A377 Beta C-S lyase, putative PLP-dependent beta-cystat 98.92
3piu_A435 1-aminocyclopropane-1-carboxylate synthase; fruit 98.91
3i16_A427 Aluminum resistance protein; YP_878183.1, carbon-s 98.91
1rv3_A483 Serine hydroxymethyltransferase, cytosolic; one-ca 98.91
1ax4_A467 Tryptophanase; tryptophan biosynthesis, tryptophan 98.91
1cs1_A386 CGS, protein (cystathionine gamma-synthase); lyase 98.9
2zyj_A397 Alpha-aminodipate aminotransferase; alpha-aminoadi 98.9
1iay_A428 ACC synthase 2, 1-aminocyclopropane-1-carboxylate 98.9
1jg8_A347 L-ALLO-threonine aldolase; glycine biosynthesis, p 98.9
3ndn_A414 O-succinylhomoserine sulfhydrylase; seattle struct 98.89
2x3l_A446 ORN/Lys/Arg decarboxylase family protein; lyase; H 98.89
3bb8_A437 CDP-4-keto-6-deoxy-D-glucose-3-dehydrase; aspartat 98.89
2x5d_A412 Probable aminotransferase; HET: LLP PLP; 2.25A {Ps 98.89
1yiz_A429 Kynurenine aminotransferase; glutamine transaminas 98.89
3bb8_A437 CDP-4-keto-6-deoxy-D-glucose-3-dehydrase; aspartat 98.88
3ly1_A354 Putative histidinol-phosphate aminotransferase; st 98.88
3nyt_A367 Aminotransferase WBPE; PLP binding, nucleotide-sug 98.87
1fc4_A401 2-amino-3-ketobutyrate conenzyme A ligase; 2-amino 98.87
4dq6_A391 Putative pyridoxal phosphate-dependent transferas; 98.86
2dkj_A407 Serine hydroxymethyltransferase; PLP dependent enz 98.85
2gb3_A409 Aspartate aminotransferase; TM1698, structural gen 98.85
3ftb_A361 Histidinol-phosphate aminotransferase; structural 98.85
3nmy_A400 Xometc, cystathionine gamma-lyase-like protein; Cy 98.85
3jzl_A409 Putative cystathionine beta-lyase involved in ALU 98.85
1bs0_A384 Protein (8-amino-7-oxonanoate synthase); PLP-depen 98.85
3get_A365 Histidinol-phosphate aminotransferase; NP_281508.1 98.85
1v2d_A381 Glutamine aminotransferase; PLP, riken structural 98.84
1c4k_A730 Protein (ornithine decarboxylase); lyase; HET: PLP 98.84
3l8a_A421 METC, putative aminotransferase, probable beta-cys 98.83
1vp4_A425 Aminotransferase, putative; structural genomics, j 98.83
3ju7_A377 Putative PLP-dependent aminotransferase; NP_978343 98.83
3kki_A409 CAI-1 autoinducer synthase; quorum sensing, CQSA, 98.83
1gd9_A389 Aspartate aminotransferase; pyridoxal enzyme, temp 98.82
3piu_A435 1-aminocyclopropane-1-carboxylate synthase; fruit 98.82
2zc0_A407 Alanine glyoxylate transaminase; alanine:glyoxylat 98.82
2ez2_A456 Beta-tyrosinase, tyrosine phenol-lyase; PLP-depend 98.82
1pff_A331 Methionine gamma-lyase; homocysteine; 2.50A {Trich 98.81
3nra_A407 Aspartate aminotransferase; structural genomics, j 98.81
3pj0_A359 LMO0305 protein; structural genomics, joint center 98.8
1b5p_A385 Protein (aspartate aminotransferase); pyridoxal en 98.79
3e2y_A410 Kynurenine-oxoglutarate transaminase 3; alpha beta 98.79
2o1b_A404 Aminotransferase, class I; aminotrasferase; HET: P 98.79
2oqx_A467 Tryptophanase; lyase, pyridoxal phosphate, tryptop 98.79
3fsl_A397 Aromatic-amino-acid aminotransferase; tyrosine ami 98.79
3if2_A444 Aminotransferase; YP_265399.1, structura genomics, 98.78
1o4s_A389 Aspartate aminotransferase; TM1255, structural gen 98.77
2dou_A376 Probable N-succinyldiaminopimelate aminotransfera; 98.77
1xi9_A406 Putative transaminase; alanine aminotransferase, s 98.77
3lws_A357 Aromatic amino acid beta-eliminating lyase/threoni 98.77
3op7_A375 Aminotransferase class I and II; PLP-dependent tra 98.77
3kax_A383 Aminotransferase, classes I and II; PLP, C-S lyase 98.77
1vef_A395 Acetylornithine/acetyl-lysine aminotransferase; PL 98.76
3cq5_A369 Histidinol-phosphate aminotransferase; PLP, PMP, a 98.76
2ez2_A456 Beta-tyrosinase, tyrosine phenol-lyase; PLP-depend 98.76
3pj0_A359 LMO0305 protein; structural genomics, joint center 98.76
3get_A365 Histidinol-phosphate aminotransferase; NP_281508.1 98.76
3qhx_A392 Cystathionine gamma-synthase METB (CGS); structura 98.76
1n8p_A393 Cystathionine gamma-lyase; three open alpha/beta s 98.75
3n0l_A417 Serine hydroxymethyltransferase; alpha beta class, 98.75
1iay_A428 ACC synthase 2, 1-aminocyclopropane-1-carboxylate 98.75
3g0t_A437 Putative aminotransferase; NP_905498.1, putative a 98.74
3fvs_A422 Kynurenine--oxoglutarate transaminase 1; alpha bet 98.74
3ht4_A431 Aluminum resistance protein; lyase, putative cysta 98.74
2a7v_A490 Serine hydroxymethyltransferase; structural genomi 98.74
1fg7_A356 Histidinol phosphate aminotransferase; HISC, histi 98.73
3gbx_A420 Serine hydroxymethyltransferase; structural genomi 98.73
1vp4_A425 Aminotransferase, putative; structural genomics, j 98.73
3b46_A447 Aminotransferase BNA3; kynurenine aminotransferase 98.72
2oqx_A467 Tryptophanase; lyase, pyridoxal phosphate, tryptop 98.72
1lc5_A364 COBD, L-threonine-O-3-phosphate decarboxylase; PLP 98.72
1bw0_A416 TAT, protein (tyrosine aminotransferase); tyrosine 98.71
3ecd_A425 Serine hydroxymethyltransferase 2; ssgcid, decode, 98.71
3hvy_A427 Cystathionine beta-lyase family protein, YNBB B.S 98.71
4f4e_A420 Aromatic-amino-acid aminotransferase; ssgcid, stru 98.71
3ele_A398 Amino transferase; RER070207001803, structural gen 98.7
1gc0_A398 Methionine gamma-lyase; pyridoxal-5'-phosphate; HE 98.7
2zyj_A397 Alpha-aminodipate aminotransferase; alpha-aminoadi 98.7
3ihj_A498 Alanine aminotransferase 2; helix, structural geno 98.7
3fdb_A377 Beta C-S lyase, putative PLP-dependent beta-cystat 98.7
1yaa_A412 Aspartate aminotransferase; HET: PLP; 2.05A {Sacch 98.69
2rfv_A398 Methionine gamma-lyase; pyridoxal-5'-phosphate, PL 98.69
1ibj_A464 CBL, cystathionine beta-lyase; PLP-dependent enzym 98.68
1cs1_A386 CGS, protein (cystathionine gamma-synthase); lyase 98.68
1c7n_A399 Cystalysin; transferase, aminotransferase, pyridox 98.67
3cog_A403 Cystathionine gamma-lyase; CTH, PLP, propargylglyc 98.66
3meb_A448 Aspartate aminotransferase; pyridoxal PHOS transfe 98.66
2bwn_A401 5-aminolevulinate synthase; tetrapyrrole biosynthe 98.66
3jtx_A396 Aminotransferase; NP_283882.1, structural genomics 98.64
3h14_A391 Aminotransferase, classes I and II; YP_167802.1, S 98.64
3p1t_A337 Putative histidinol-phosphate aminotransferase; PL 98.63
1fg7_A356 Histidinol phosphate aminotransferase; HISC, histi 98.63
3dyd_A427 Tyrosine aminotransferase; PLP, SGC, structural ge 98.63
2o0r_A411 RV0858C (N-succinyldiaminopimelate aminotransfera; 98.62
1u08_A386 Hypothetical aminotransferase YBDL; alpha beta pro 98.62
3ezs_A376 Aminotransferase ASPB; NP_207418.1, structural gen 98.62
1d2f_A390 MALY protein; aminotransferase fold, large PLP-bin 98.61
3p1t_A337 Putative histidinol-phosphate aminotransferase; PL 98.61
3op7_A375 Aminotransferase class I and II; PLP-dependent tra 98.61
1ajs_A412 Aspartate aminotransferase; PIG, in the presence o 98.6
2z61_A370 Probable aspartate aminotransferase 2; amino acid 98.57
1s0a_A429 Adenosylmethionine-8-amino-7-oxononanoate aminotra 98.57
2eh6_A375 Acoat, acetylornithine aminotransferase; ARGD, str 98.56
3ele_A398 Amino transferase; RER070207001803, structural gen 98.56
1pff_A331 Methionine gamma-lyase; homocysteine; 2.50A {Trich 98.56
2ctz_A421 O-acetyl-L-homoserine sulfhydrylase; crystal, O-ac 98.55
3hdo_A360 Histidinol-phosphate aminotransferase; PSI-II, his 98.54
1b5p_A385 Protein (aspartate aminotransferase); pyridoxal en 98.53
3ruy_A392 Ornithine aminotransferase; structural genomics, c 98.52
2ord_A397 Acoat, acetylornithine aminotransferase; TM1785, a 98.51
3h7f_A447 Serine hydroxymethyltransferase 1; cytoplasm, one- 98.5
3ez1_A423 Aminotransferase MOCR family; YP_604413.1, struct 98.49
2x5f_A430 Aspartate_tyrosine_phenylalanine pyridoxal-5' phos 98.48
3hdo_A360 Histidinol-phosphate aminotransferase; PSI-II, his 98.48
2q7w_A396 Aspartate aminotransferase; mechanism-based inhibi 98.48
3g7q_A417 Valine-pyruvate aminotransferase; NP_462565.1, str 98.48
1yiz_A429 Kynurenine aminotransferase; glutamine transaminas 98.47
1sff_A426 4-aminobutyrate aminotransferase; enzyme complexes 98.47
2dou_A376 Probable N-succinyldiaminopimelate aminotransfera; 98.46
7aat_A401 Aspartate aminotransferase; transferase(aminotrans 98.46
1qgn_A445 Protein (cystathionine gamma-synthase); methionine 98.45
2x5d_A412 Probable aminotransferase; HET: LLP PLP; 2.25A {Ps 98.45
1s0a_A429 Adenosylmethionine-8-amino-7-oxononanoate aminotra 98.44
2ord_A397 Acoat, acetylornithine aminotransferase; TM1785, a 98.44
1vef_A395 Acetylornithine/acetyl-lysine aminotransferase; PL 98.44
2x5f_A430 Aspartate_tyrosine_phenylalanine pyridoxal-5' phos 98.44
3fkd_A350 L-threonine-O-3-phosphate decarboxylase; structura 98.44
1sff_A426 4-aminobutyrate aminotransferase; enzyme complexes 98.43
3dxv_A439 Alpha-amino-epsilon-caprolactam racemase; fold-TYP 98.43
3fkd_A350 L-threonine-O-3-phosphate decarboxylase; structura 98.43
1lc5_A364 COBD, L-threonine-O-3-phosphate decarboxylase; PLP 98.42
3qgu_A449 LL-diaminopimelate aminotransferase; L-lysine, pyr 98.42
2o1b_A404 Aminotransferase, class I; aminotrasferase; HET: P 98.41
2aeu_A374 Hypothetical protein MJ0158; selenocysteine syntha 98.41
3tcm_A500 Alanine aminotransferase 2; pyridoxal phosphate (P 98.41
2r2n_A425 Kynurenine/alpha-aminoadipate aminotransferase mit 98.4
4adb_A406 Succinylornithine transaminase; transferase, PLP e 98.4
4adb_A406 Succinylornithine transaminase; transferase, PLP e 98.39
3ez1_A423 Aminotransferase MOCR family; YP_604413.1, struct 98.38
1e5e_A404 MGL, methionine gamma-lyase; methionine biosynthes 98.38
2eo5_A419 419AA long hypothetical aminotransferase; PLP enzy 98.37
3fvs_A422 Kynurenine--oxoglutarate transaminase 1; alpha bet 98.37
2eh6_A375 Acoat, acetylornithine aminotransferase; ARGD, str 98.37
3hmu_A472 Aminotransferase, class III; structural genomics, 98.37
3ppl_A427 Aspartate aminotransferase; dimer, PLP-dependent t 98.37
3t18_A413 Aminotransferase class I and II; PSI-biology, MCSG 98.36
2pb2_A420 Acetylornithine/succinyldiaminopimelate aminotran; 98.36
1z7d_A433 Ornithine aminotransferase; structural genomics co 98.35
3rq1_A418 Aminotransferase class I and II; structural genomi 98.34
3ezs_A376 Aminotransferase ASPB; NP_207418.1, structural gen 98.34
2pb2_A420 Acetylornithine/succinyldiaminopimelate aminotran; 98.34
3acz_A389 Methionine gamma-lyase; L-methionine; HET: LLP; 1. 98.33
2eo5_A419 419AA long hypothetical aminotransferase; PLP enzy 98.32
2r2n_A425 Kynurenine/alpha-aminoadipate aminotransferase mit 98.32
1n8p_A393 Cystathionine gamma-lyase; three open alpha/beta s 98.32
3ruy_A392 Ornithine aminotransferase; structural genomics, c 98.32
3jtx_A396 Aminotransferase; NP_283882.1, structural genomics 98.32
3ou5_A490 Serine hydroxymethyltransferase, mitochondrial; st 98.31
3nx3_A395 Acoat, acetylornithine aminotransferase; csgid, st 98.3
3ppl_A427 Aspartate aminotransferase; dimer, PLP-dependent t 98.29
3nx3_A395 Acoat, acetylornithine aminotransferase; csgid, st 98.29
2ay1_A394 Aroat, aromatic amino acid aminotransferase; HET: 98.29
3i4j_A430 Aminotransferase, class III; structural GENOMICS,N 98.29
2fq6_A415 Cystathionine beta-lyase; protein-inhibitor comple 98.27
2oat_A439 Ornithine aminotransferase; 5-fluoromethylornithin 98.27
3rq1_A418 Aminotransferase class I and II; structural genomi 98.26
2oat_A439 Ornithine aminotransferase; 5-fluoromethylornithin 98.26
1uu1_A335 Histidinol-phosphate aminotransferase; histidine b 98.26
3nnk_A411 Ureidoglycine-glyoxylate aminotransferase; PLP-dep 98.26
3n75_A715 LDC, lysine decarboxylase, inducible; pyridoxal-5' 98.25
3b1d_A392 Betac-S lyase; HET: PLP PLS EPE; 1.66A {Streptococ 97.55
3dxv_A439 Alpha-amino-epsilon-caprolactam racemase; fold-TYP 98.22
3i4j_A430 Aminotransferase, class III; structural GENOMICS,N 98.21
3d6k_A422 Putative aminotransferase; APC82464, corynebacteri 98.21
3a8u_X449 Omega-amino acid--pyruvate aminotransferase; large 98.21
3cog_A403 Cystathionine gamma-lyase; CTH, PLP, propargylglyc 98.21
3e2y_A410 Kynurenine-oxoglutarate transaminase 3; alpha beta 98.2
3ri6_A430 O-acetylhomoserine sulfhydrylase; PYR 5'-phosphate 98.19
3ei9_A432 LL-diaminopimelate aminotransferase; lysine biosyn 98.19
3b46_A447 Aminotransferase BNA3; kynurenine aminotransferase 98.18
3a8u_X449 Omega-amino acid--pyruvate aminotransferase; large 98.16
1z7d_A433 Ornithine aminotransferase; structural genomics co 98.16
3ndn_A414 O-succinylhomoserine sulfhydrylase; seattle struct 98.15
4hvk_A382 Probable cysteine desulfurase 2; transferase and I 98.14
1ibj_A464 CBL, cystathionine beta-lyase; PLP-dependent enzym 98.13
3gju_A460 Putative aminotransferase; pyridoxal phosphate, PL 98.13
3dod_A448 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 98.12
3f6t_A533 Aspartate aminotransferase; YP_194538.1, STRU geno 98.12
1uu1_A335 Histidinol-phosphate aminotransferase; histidine b 98.09
3tfu_A457 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 98.08
3i5t_A476 Aminotransferase; pyridoxal 5'-phosphate, PSI-2, N 98.08
1zod_A433 DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, 98.07
3ihj_A498 Alanine aminotransferase 2; helix, structural geno 98.06
4eu1_A409 Mitochondrial aspartate aminotransferase; ssgcid, 98.06
3zrp_A384 Serine-pyruvate aminotransferase (AGXT); HET: PLP; 98.05
3l44_A434 Glutamate-1-semialdehyde 2,1-aminomutase 1; alpha 98.04
2dr1_A386 PH1308 protein, 386AA long hypothetical serine ami 98.04
4e77_A429 Glutamate-1-semialdehyde 2,1-aminomutase; structur 98.04
3fq8_A427 Glutamate-1-semialdehyde 2,1-aminomutase; drug res 98.03
3d6k_A422 Putative aminotransferase; APC82464, corynebacteri 98.02
3k28_A429 Glutamate-1-semialdehyde 2,1-aminomutase 2; biosyn 98.02
2cjg_A449 L-lysine-epsilon aminotransferase; internal aldimi 98.02
3n5m_A452 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 98.01
3n5m_A452 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 98.01
3oks_A451 4-aminobutyrate transaminase; ssgcid, transferase, 98.0
3nmy_A400 Xometc, cystathionine gamma-lyase-like protein; Cy 98.0
4a6r_A459 Omega transaminase; transferase, PLP-binding enzym 97.99
2cy8_A453 D-phgat, D-phenylglycine aminotransferase; structu 97.96
3dod_A448 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 97.96
3oks_A451 4-aminobutyrate transaminase; ssgcid, transferase, 97.95
3tfu_A457 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 97.93
3qgu_A449 LL-diaminopimelate aminotransferase; L-lysine, pyr 97.93
3fsl_A397 Aromatic-amino-acid aminotransferase; tyrosine ami 97.93
3asa_A400 LL-diaminopimelate aminotransferase; PLP dependent 97.91
7aat_A401 Aspartate aminotransferase; transferase(aminotrans 97.89
4ffc_A453 4-aminobutyrate aminotransferase (GABT); structura 97.89
3l44_A434 Glutamate-1-semialdehyde 2,1-aminomutase 1; alpha 97.89
2ay1_A394 Aroat, aromatic amino acid aminotransferase; HET: 97.89
3b1d_A392 Betac-S lyase; HET: PLP PLS EPE; 1.66A {Streptococ 97.1
1zod_A433 DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, 97.88
3t18_A413 Aminotransferase class I and II; PSI-biology, MCSG 97.87
2epj_A434 Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzy 97.87
4ffc_A453 4-aminobutyrate aminotransferase (GABT); structura 97.85
2cjg_A449 L-lysine-epsilon aminotransferase; internal aldimi 97.84
3k28_A429 Glutamate-1-semialdehyde 2,1-aminomutase 2; biosyn 97.82
3qm2_A386 Phosphoserine aminotransferase; structural genomic 97.82
4f4e_A420 Aromatic-amino-acid aminotransferase; ssgcid, stru 97.81
3i16_A427 Aluminum resistance protein; YP_878183.1, carbon-s 97.77
3f6t_A533 Aspartate aminotransferase; YP_194538.1, STRU geno 97.7
3ei9_A432 LL-diaminopimelate aminotransferase; lysine biosyn 97.67
4e77_A429 Glutamate-1-semialdehyde 2,1-aminomutase; structur 97.65
1ajs_A412 Aspartate aminotransferase; PIG, in the presence o 97.65
3hmu_A472 Aminotransferase, class III; structural genomics, 97.64
1iug_A352 Putative aspartate aminotransferase; wild type, py 97.64
3fq8_A427 Glutamate-1-semialdehyde 2,1-aminomutase; drug res 97.61
2q7w_A396 Aspartate aminotransferase; mechanism-based inhibi 97.6
1t3i_A420 Probable cysteine desulfurase; PLP-binding enzyme, 97.6
3jzl_A409 Putative cystathionine beta-lyase involved in ALU 97.58
2e7u_A424 Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzy 97.58
1ohv_A472 4-aminobutyrate aminotransferase; PLP-dependent en 97.51
3ht4_A431 Aluminum resistance protein; lyase, putative cysta 97.51
3meb_A448 Aspartate aminotransferase; pyridoxal PHOS transfe 97.49
3ou5_A490 Serine hydroxymethyltransferase, mitochondrial; st 97.48
3i5t_A476 Aminotransferase; pyridoxal 5'-phosphate, PSI-2, N 97.47
2epj_A434 Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzy 97.46
3asa_A400 LL-diaminopimelate aminotransferase; PLP dependent 97.43
3gju_A460 Putative aminotransferase; pyridoxal phosphate, PL 97.42
2cy8_A453 D-phgat, D-phenylglycine aminotransferase; structu 97.42
3hvy_A427 Cystathionine beta-lyase family protein, YNBB B.S 97.41
4a6r_A459 Omega transaminase; transferase, PLP-binding enzym 97.4
1kmj_A406 Selenocysteine lyase; persulfide perselenide NIFS 97.37
3ffr_A362 Phosphoserine aminotransferase SERC; structural ge 97.34
1yaa_A412 Aspartate aminotransferase; HET: PLP; 2.05A {Sacch 97.34
2aeu_A374 Hypothetical protein MJ0158; selenocysteine syntha 97.06
4ao9_A454 Beta-phenylalanine aminotransferase; HET: PLP; 1.5 97.03
4eu1_A409 Mitochondrial aspartate aminotransferase; ssgcid, 97.02
2e7u_A424 Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzy 96.86
1ohv_A472 4-aminobutyrate aminotransferase; PLP-dependent en 96.81
2hox_A427 ALLIIN lyase 1; cysteine sulphoxide lyase, ALLIINA 96.65
3bwn_A391 AT1G70560, L-tryptophan aminotransferase; auxin sy 96.61
4atq_A456 4-aminobutyrate transaminase; transferase; HET: PL 96.17
4ao9_A454 Beta-phenylalanine aminotransferase; HET: PLP; 1.5 96.12
4e3q_A473 Pyruvate transaminase; aminotransferase, transfera 95.97
3k7y_A405 Aspartate aminotransferase; aminotrans pyridoxal p 95.93
2yky_A465 Beta-transaminase; transferase; HET: PLP SFE; 1.69 94.83
3tqx_A399 2-amino-3-ketobutyrate coenzyme A ligase; energy m 95.63
2w8t_A427 SPT, serine palmitoyltransferase; HET: LLP; 1.25A 95.49
2zy4_A546 L-aspartate beta-decarboxylase; pyridoxal 5'-phosp 95.44
3bwn_A391 AT1G70560, L-tryptophan aminotransferase; auxin sy 95.35
3aow_A448 Putative uncharacterized protein PH0207; protein-P 94.1
2zy4_A546 L-aspartate beta-decarboxylase; pyridoxal 5'-phosp 93.94
4atq_A456 4-aminobutyrate transaminase; transferase; HET: PL 93.09
2yky_A465 Beta-transaminase; transferase; HET: PLP SFE; 1.69 91.26
4h51_A420 Aspartate aminotransferase; ssgcid, structural gen 89.36
2hox_A427 ALLIIN lyase 1; cysteine sulphoxide lyase, ALLIINA 88.37
4e3q_A473 Pyruvate transaminase; aminotransferase, transfera 87.99
4a0g_A831 Adenosylmethionine-8-amino-7-oxononanoate aminotra 86.14
3if2_A444 Aminotransferase; YP_265399.1, structura genomics, 82.75
>3k40_A Aromatic-L-amino-acid decarboxylase; PLP dependent protein, alpha beta protein, alternative splicing, catecholamine biosynthesis, lyase; HET: LLP; 1.75A {Drosophila melanogaster} SCOP: c.67.1.6 Back     alignment and structure
Probab=100.00  E-value=8.3e-52  Score=479.57  Aligned_cols=402  Identities=46%  Similarity=0.887  Sum_probs=322.4

Q ss_pred             hhhHhhccCCCCCCccccccCCCCCCHHHHHHHHHHHhcCCCCCccccChhHHHHHHHHHHHHHHHcCCCCCCCCCC-CC
Q psy852            4 LFHFLSHQVTHWQHPRFHAYFPSGNSYPSVLADMLSDAIGCIGFSWAASPSCTELETIVLDWLGKAIGLPEKFLMYP-PQ   82 (891)
Q Consensus         4 ~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~l~~~~n~~~~~~~~~p~~~~~E~~~~~~l~~l~g~~~~~~~~~-~~   82 (891)
                      +.+.++|++++|+||+|++|++++.++|+++++++++.+|+|+..|..+|.+++||+++++|+++++|+|..+.... +.
T Consensus        60 ~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~l~~~~n~~~~~~~~~p~~~~lE~~v~~~l~~~~g~~~~~~~~~~~~  139 (475)
T 3k40_A           60 IERVIMPGVTHWHSPKFHAYFPTANSYPAIVADMLSGAIACIGFTWIASPACTELEVVMMDWLGKMLELPAEFLACSGGK  139 (475)
T ss_dssp             HHHHTGGGCCCTTCTTBCCSSCCCCCHHHHHHHHHHHHHCCCSSSCCCCHHHHHHHHHHHHHHHHHTTCCGGGCGGGTSS
T ss_pred             HHHHHhccCCCCCCcCceeeCCCCCcHHHHHHHHHHHHhCccccCccCCcHHHHHHHHHHHHHHHHhCCCchhccccCCC
Confidence            55678999999999999999999999999999999999999999999999999999999999999999997642100 00


Q ss_pred             CCCCCCCCCccccccccCCCCCCCCcccchhHHHHHHHHHHHHhccc-----cCCccccccccCCeEEEecCCCChHHHH
Q psy852           83 GKNATTPNDIDMNIEDYMTPANQPQSLGGGVIQSVQNIIVLTRGQKK-----IHPFVDEGVLLSKLMAYCSKEAHSCVEK  157 (891)
Q Consensus        83 ~~g~~tp~~~~~~~~~~~t~~~~~~~~~gGt~~~~~~~~~~ar~~~~-----~~~~~~~g~~~~~~~v~~S~~~H~Sv~k  157 (891)
                      ++|                     .+++|||.+ |+..+..+|.+..     ..|.+.++...++++|++|..+|+|+.+
T Consensus       140 ~~g---------------------v~t~ggt~a-nl~al~~ar~~~~~~~~~~~~~~~~~~~~~~~~vi~s~~~H~s~~~  197 (475)
T 3k40_A          140 GGG---------------------VIQGTASES-TLVALLGAKAKKLKEVKELHPEWDEHTILGKLVGYCSDQAHSSVER  197 (475)
T ss_dssp             CEE---------------------EEESCHHHH-HHHHHHHHHHHHHHHHHHHCTTSCHHHHHHHEEEEEETTSCHHHHH
T ss_pred             CCe---------------------EEcCchHHH-HHHHHHHHHHHHHHHhhccCcccccccccCCeEEEECCCchHHHHH
Confidence            112                     346788864 6666666776531     1333333334567899999999999999


Q ss_pred             HHHHcCCeEEEEecCCCCcccHHHHHHHHHhhhhcCCcceEEEeecccCccccccCHHHHHHHHHHcCCceeeeccccCC
Q psy852          158 AAMMAFVRLKILEPDDKNSLRGATLRQVMQQDETMGYIPFFVSTTLGTTSCCSFDNLAEIGPVAKEFDVWLHVDGAYAGS  237 (891)
Q Consensus       158 aa~~~~~~v~~V~~d~~g~id~~~L~~~l~~~~~~g~~p~~V~~t~Gtt~~GavDpl~~I~~i~~~~~~~lHvDaA~GG~  237 (891)
                      ++.+.|.+++.||+|++| ||+++|+++|+++.++|..|++|++|+|||.+|++||+++|+++|++||+|+||||||||.
T Consensus       198 ~~~~~g~~~~~v~~d~~~-~d~~~L~~~i~~~~~~~~~~~~v~~~~~~t~~G~~~~l~~I~~la~~~~~~lhvD~A~~~~  276 (475)
T 3k40_A          198 AGLLGGVKLRSVQSENHR-MRGAALEKAIEQDVAEGLIPFYAVVTLGTTNSCAFDYLDECGPVGNKHNLWIHVDAAYAGS  276 (475)
T ss_dssp             HHHHHTCEEEEECCBTTB-CCHHHHHHHHHHHHHTTCEEEEEEEEBSCTTTCCBCCHHHHHHHHHHTTCEEEEECTTGGG
T ss_pred             HHHHcCCceEEEECCCCC-cCHHHHHHHHHHHHHCCCccEEEEEEecCCCCcCcCCHHHHHHHHHHhCCeEEEeHHhHHH
Confidence            998888899999999999 9999999999999888888999999999999999999999999999997777777777654


Q ss_pred             ccccCCCCccCCCCcccccCCCCcccccCCCCcchhHHHHhhhhHHHHHhhhcccCCccchhhHHHHhhhhhcccccccc
Q psy852          238 SFICPEFRPFMNGKTSFDNLHLSPIWYERPSSASECIFVCMLSARAQAISKLKKIHPFVDEGVLLSKLMAYCSKEAHSCV  317 (891)
Q Consensus       238 ~~~~~~~~~~~~g~~~~d~~~~s~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  317 (891)
                      .+                                                                              
T Consensus       277 ~~------------------------------------------------------------------------------  278 (475)
T 3k40_A          277 AF------------------------------------------------------------------------------  278 (475)
T ss_dssp             GG------------------------------------------------------------------------------
T ss_pred             HH------------------------------------------------------------------------------
Confidence            43                                                                              


Q ss_pred             ccccccccccccccceEEEeeccccCccccCccccccccCCCcccEEEEeCCCcCCccCCceEEEEeccccchhhcccCc
Q psy852          318 ETRGHIQSYRDAIFDVWLHVDGAYAGSSFICPEFRPFMNGIEYADSFNVNVNKWLLTAFDSSCLWVADRYKLTSALVVDP  397 (891)
Q Consensus       318 ~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~gi~~~ds~~~~~HK~~~~p~~~g~~~~r~~~~~~~~~~~~~  397 (891)
                                                   ++++++..+.|++.+||+++|+|||+++|++||++++|++..+...+...+
T Consensus       279 -----------------------------~~~~~~~~~~gi~~~Ds~~~~~hK~l~~p~g~g~l~~~~~~~l~~~~~~~~  329 (475)
T 3k40_A          279 -----------------------------ICPEYRHLMKGIESADSFNFNPHKWMLVNFDCSAMWLKDPSWVVNAFNVDP  329 (475)
T ss_dssp             -----------------------------GSGGGGGGGTTGGGCSEEEECHHHHSSCCSSCEEEEESSGGGC--------
T ss_pred             -----------------------------hCHhhHHHhcCcccCCEEEECchhccCCCCceEEEEEeCHHHHHHHhcCCc
Confidence                                         334444556677789999999999999999999999998765543333333


Q ss_pred             cccCCCCCCcccccccccCCCCChhHHHHHHHHHHhcHHHHHHHHHHHHHHHHHHHHhhccCCccccccCCCCCcchhHH
Q psy852          398 LYLQHGHEGAIDYRHWGIPLSRRFRSLKLWFVIRTYGLSGLQKYIRRHCELAKLFEGKVRRDPRFEISNDVRSSASECIF  477 (891)
Q Consensus       398 ~y~~~~~~~~~~~~~~~~~~sr~~~~l~~w~~l~~~g~~G~~~ii~~~lelAr~l~~~L~~~~~~eVv~~itsggsean~  477 (891)
                      .|+.....                                                                        
T Consensus       330 ~yl~~~~~------------------------------------------------------------------------  337 (475)
T 3k40_A          330 LYLKHDMQ------------------------------------------------------------------------  337 (475)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             cccCCCcC------------------------------------------------------------------------
Confidence            33311000                                                                        


Q ss_pred             HHHHHHHHHHHHhhhccCccccccccccceEEEecccchHHHHHHHHHcCceEEEecCCCCCCcCHHHHHHHHHhhhhcC
Q psy852          478 VCMLAARAQAISKLKKIHPFVDEGVLLSKLMAYCSKEAHSCVEKAAMMAFVRLKILEPDDKNSLRGATLRQVMQQDETMG  557 (891)
Q Consensus       478 ~al~aAR~~~~~~~~~~~~~~~~g~~~~~~vI~~S~~aH~Sv~Kaa~l~gv~v~~Vp~d~~G~mD~~~Le~aI~~d~~~g  557 (891)
                                                                                                      
T Consensus       338 --------------------------------------------------------------------------------  337 (475)
T 3k40_A          338 --------------------------------------------------------------------------------  337 (475)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             CccEEEEecCCccchhhhhcCCCCccEEEEcCcccCCcccccEEEEEeCCccchhhhccCCCccccCCCCCccccCCccc
Q psy852          558 YIPFFVSTTLGTTSCYRKSQGIEYADSFNVNVNKWLLTAFDSSCLWVADRYKLTSALVVDPLYLQHGHEGAIDYRHWGIP  637 (891)
Q Consensus       558 ~ip~~VvataGTT~c~~~ldGi~~aDSIs~d~HK~L~~P~g~G~llvR~~~~L~~~l~~~~~Yl~~~~e~~~~~~~~ti~  637 (891)
                                                                +                          ..+++.+++++
T Consensus       338 ------------------------------------------~--------------------------~~~~~~~~~~~  349 (475)
T 3k40_A          338 ------------------------------------------G--------------------------SAPDYRHWQIP  349 (475)
T ss_dssp             -------------------------------------------------------------------------------C
T ss_pred             ------------------------------------------C--------------------------CCCCccccccc
Confidence                                                      0                          00122356778


Q ss_pred             ccccccchHHHHHHHHHHHhhHHHHHHHHHHHHHHHHHHhccCCCcEEeCCCceeEEEEEecCCcchhhhhhHHHHHHHH
Q psy852          638 LSRRFRSLKLWFVIRTYGLSGLQKYIRRHCELAKLFEGKVRRDPRFEISNDVRLGLVCFRLRSENNLIADQNNRKLLEDI  717 (891)
Q Consensus       638 ~SRr~~aL~lW~~L~~lG~~G~~~~i~~~~~lA~~L~~~L~~~~~~eil~~~~~~iV~Fr~~~~~~~~~d~ln~~L~~~L  717 (891)
                      ++|+++++++|++|+.+|.+|+++++++..++++++.+.|+++++|+++.++.+++|+|++.+.     +..+.++.++|
T Consensus       350 ~sr~~~~l~l~~al~~~g~~g~~~~~~~~~~~a~~l~~~L~~~~g~~l~~~~~~~iv~f~~~~~-----~~~~~~l~~~L  424 (475)
T 3k40_A          350 LGRRFRALKLWFVLRLYGVENLQAHIRRHCNFAKQFGDLCVADSRFELAAEINMGLVCFRLKGS-----NERNEALLKRI  424 (475)
T ss_dssp             CCGGGTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSTTEEESSCCBTTEEEEEESSC-----HHHHHHHHHHH
T ss_pred             CCCcccHHHHHHHHHHHhHHHHHHHHHHHHHHHHHHHHHHhcCCCEEEecCCceEEEEEEeCCc-----hHHHHHHHHHH
Confidence            8999999999999999999999999999999999999999999999999999999999999765     55788999999


Q ss_pred             HhCCcEEEeeccccCCeEE-EEec-CCCCHHHHHHHHHHHHHHHH
Q psy852          718 NASGRLHMVPASQEQNDEV-FELQ-ERKRKDDLAYKRSFFVRMLG  760 (891)
Q Consensus       718 ~~~G~~~~s~s~~~g~~~l-~sv~-~~tT~edId~li~~L~ei~~  760 (891)
                      +++|.++++++...+...+ +++. +++|++||+++++.|+++..
T Consensus       425 ~~~g~~~~~~~~~~g~~~lR~~~~~~~tt~~di~~~~~~i~~~~~  469 (475)
T 3k40_A          425 NGRGHIHLVPAKIKDVYFLRMAICSRFTQSEDMEYSWKEVSAAAD  469 (475)
T ss_dssp             HHHTSCBCEEEEETTEEEEEEECCCTTCCHHHHHHHHHHHHHHHH
T ss_pred             HhCCcEEEEeeEECCEEEEEEEeCCCCCCHHHHHHHHHHHHHHHH
Confidence            9999988888888888888 9865 57899999999999998874
>4e1o_A HDC, histidine decarboxylase; lyase; HET: PLP PVH; 1.80A {Homo sapiens} Back     alignment and structure
>3vp6_A Glutamate decarboxylase 1; catalytic loop SWAP, lyase; HET: LLP HLD; 2.10A {Homo sapiens} PDB: 2okj_A* 2okk_A* Back     alignment and structure
>1js3_A DDC;, DOPA decarboxylase; carbidopa, parkinson'S disease, vitamin; HET: PLP 142; 2.25A {Sus scrofa} SCOP: c.67.1.6 PDB: 1js6_A* 3rch_A* 3rbl_A 3rbf_A* Back     alignment and structure
>2qma_A Diaminobutyrate-pyruvate transaminase and L-2,4- diaminobutyrate decarboxylase; structural genomics, APC91511.1, glutamate decarboxylase; HET: MSE; 1.81A {Vibrio parahaemolyticus} Back     alignment and structure
>2okj_A Glutamate decarboxylase 1; PLP-dependent decarboxylase, lyase; HET: LLP PLZ; 2.30A {Homo sapiens} PDB: 2okk_A* Back     alignment and structure
>2jis_A Cysteine sulfinic acid decarboxylase; pyridoxal phosphate, alternative splicing, pyridoxal phosphate (PLP), structural genomics consortium (SGC); HET: PLP; 1.6A {Homo sapiens} Back     alignment and structure
>2dgk_A GAD-beta, GADB, glutamate decarboxylase beta; gadbd1-14, autoinhibition, substituted aldamine, lyase; HET: PLP; 1.90A {Escherichia coli} PDB: 2dgm_A* 1pmo_A* 2dgl_A* 1pmm_A* 3fz6_A* 3fz7_A 3fz8_A* 1xey_A* Back     alignment and structure
>3hbx_A GAD 1, glutamate decarboxylase 1; calmodulin-binding, lyase, pyridoxal phosphate; HET: LLP; 2.67A {Arabidopsis thaliana} Back     alignment and structure
>3bc8_A O-phosphoseryl-tRNA(SEC) selenium transferase; disorder-order transition, phosphate-loop, pyridoxal phospha selenocysteine synthase (SECS, sepsecs); HET: LLP; 1.65A {Mus musculus} SCOP: c.67.1.9 PDB: 3bca_A* 3bcb_A* Back     alignment and structure
>3mc6_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxyl phosphate; HET: LLP; 3.15A {Saccharomyces cerevisiae} Back     alignment and structure
>3mad_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxal phosphate; HET: LLP; 2.00A {Symbiobacterium thermophilum} PDB: 3maf_A* 3mau_A* 3mbb_A* Back     alignment and structure
>2z67_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine biosynthesis, seven-stranded BETE-strand, PYR 5'-phosphate; HET: PLP; 2.50A {Methanococcus maripaludis} SCOP: c.67.1.9 Back     alignment and structure
>3f9t_A TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L-tyrosine decarboxylase MFNA (EC 4.1.1.25), ST genomics; HET: PLP; 2.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>4e1o_A HDC, histidine decarboxylase; lyase; HET: PLP PVH; 1.80A {Homo sapiens} Back     alignment and structure
>3k40_A Aromatic-L-amino-acid decarboxylase; PLP dependent protein, alpha beta protein, alternative splicing, catecholamine biosynthesis, lyase; HET: LLP; 1.75A {Drosophila melanogaster} SCOP: c.67.1.6 Back     alignment and structure
>3hl2_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine, sepsecs, protein-RNA complex, alternative splicing, cytoplasm, protein biosynthesis, pyridoxal phosphate, selenium; HET: PLR SEP; 2.81A {Homo sapiens} Back     alignment and structure
>3mc6_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxyl phosphate; HET: LLP; 3.15A {Saccharomyces cerevisiae} Back     alignment and structure
>3mad_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxal phosphate; HET: LLP; 2.00A {Symbiobacterium thermophilum} PDB: 3maf_A* 3mau_A* 3mbb_A* Back     alignment and structure
>4hvk_A Probable cysteine desulfurase 2; transferase and ISCS, transferase; HET: PMP PG4; 1.43A {Archaeoglobus fulgidus} PDB: 4eb7_A* 4eb5_A* Back     alignment and structure
>1wyu_B Glycine dehydrogenase subunit 2 (P-protein); alpha(2)beta(2) tetramer, riken structural genomics/proteomi initiative, RSGI; HET: PLP; 2.10A {Thermus thermophilus} SCOP: c.67.1.7 PDB: 1wyt_B* 1wyv_B* Back     alignment and structure
>3bc8_A O-phosphoseryl-tRNA(SEC) selenium transferase; disorder-order transition, phosphate-loop, pyridoxal phospha selenocysteine synthase (SECS, sepsecs); HET: LLP; 1.65A {Mus musculus} SCOP: c.67.1.9 PDB: 3bca_A* 3bcb_A* Back     alignment and structure
>2z67_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine biosynthesis, seven-stranded BETE-strand, PYR 5'-phosphate; HET: PLP; 2.50A {Methanococcus maripaludis} SCOP: c.67.1.9 Back     alignment and structure
>3nnk_A Ureidoglycine-glyoxylate aminotransferase; PLP-dependent; HET: LLP; 2.58A {Klebsiella pneumoniae} Back     alignment and structure
>3f9t_A TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L-tyrosine decarboxylase MFNA (EC 4.1.1.25), ST genomics; HET: PLP; 2.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>2dr1_A PH1308 protein, 386AA long hypothetical serine aminotransferase; PLP, structural genomics, NPPSFA; HET: PLP; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>3ffr_A Phosphoserine aminotransferase SERC; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: LLP MSE P33; 1.75A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3vp6_A Glutamate decarboxylase 1; catalytic loop SWAP, lyase; HET: LLP HLD; 2.10A {Homo sapiens} PDB: 2okj_A* 2okk_A* Back     alignment and structure
>3zrp_A Serine-pyruvate aminotransferase (AGXT); HET: PLP; 1.75A {Sulfolobus solfataricus} PDB: 3zrq_A* 3zrr_A* Back     alignment and structure
>1t3i_A Probable cysteine desulfurase; PLP-binding enzyme, transferase; HET: 2OS PLP; 1.80A {Synechocystis SP} SCOP: c.67.1.3 Back     alignment and structure
>3isl_A Purine catabolism protein PUCG; pyridoxalphosphate, PLP dependent enzymes, purine metabolism transaminases, aminotransferases; HET: PLP; 2.06A {Bacillus subtilis} Back     alignment and structure
>1kmj_A Selenocysteine lyase; persulfide perselenide NIFS pyridoxal phosphate, structural PSI, protein structure initiative; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.3 PDB: 1i29_A* 1jf9_A* 1kmk_A* 1c0n_A* Back     alignment and structure
>1js3_A DDC;, DOPA decarboxylase; carbidopa, parkinson'S disease, vitamin; HET: PLP 142; 2.25A {Sus scrofa} SCOP: c.67.1.6 PDB: 1js6_A* 3rch_A* 3rbl_A 3rbf_A* Back     alignment and structure
>4eb5_A Probable cysteine desulfurase 2; scaffold, transferase-metal binding protein complex; HET: PLP EPE; 2.53A {Archaeoglobus fulgidus} PDB: 4eb7_A* Back     alignment and structure
>3qm2_A Phosphoserine aminotransferase; structural genomics, center for structural genomics of infec diseases, csgid; 2.25A {Salmonella enterica subsp} PDB: 1bjn_A* 1bjo_A* 3qbo_A* Back     alignment and structure
>1iug_A Putative aspartate aminotransferase; wild type, pyridoxal-5'-phosphate form, riken structural genomics/proteomics initiative, RSGI; HET: LLP; 2.20A {Thermus thermophilus} SCOP: c.67.1.3 Back     alignment and structure
>3lvm_A Cysteine desulfurase; structural genomics, montreal-kingston bacterial structural genomics initiative, BSGI, transferase; HET: PLP; 2.05A {Escherichia coli} PDB: 3lvk_A* 3lvl_B* 3lvj_A* 1p3w_B* Back     alignment and structure
>2z9v_A Aspartate aminotransferase; pyridoxamine, pyruvate; HET: PXM; 1.70A {Mesorhizobium loti} PDB: 2z9u_A* 2z9w_A* 2z9x_A* Back     alignment and structure
>2okj_A Glutamate decarboxylase 1; PLP-dependent decarboxylase, lyase; HET: LLP PLZ; 2.30A {Homo sapiens} PDB: 2okk_A* Back     alignment and structure
>3vax_A Putative uncharacterized protein DNDA; desulfurase, transferase; HET: PLP; 2.40A {Streptomyces lividans} Back     alignment and structure
>3e9k_A Kynureninase; kynurenine-L-hydrolase, kynurenine hydrolase, pyridoxal-5'-phosphate, inhibitor complex, 3-hydroxy hippur hydroxyhippuric acid, PLP; HET: PLP 3XH; 1.70A {Homo sapiens} PDB: 2hzp_A* Back     alignment and structure
>2yrr_A Aminotransferase, class V; structural genomics, NPPSFA, national PROJ protein structural and functional analyses; HET: PLP; 1.86A {Thermus thermophilus} PDB: 2yri_A* Back     alignment and structure
>3a9z_A Selenocysteine lyase; PLP, cytoplasm, pyridoxal phosphate, transferase; HET: PLP SLP; 1.55A {Rattus norvegicus} PDB: 3a9x_A* 3a9y_A* 3gzd_A* 3gzc_A* 2hdy_A* Back     alignment and structure
>2qma_A Diaminobutyrate-pyruvate transaminase and L-2,4- diaminobutyrate decarboxylase; structural genomics, APC91511.1, glutamate decarboxylase; HET: MSE; 1.81A {Vibrio parahaemolyticus} Back     alignment and structure
>1wyu_B Glycine dehydrogenase subunit 2 (P-protein); alpha(2)beta(2) tetramer, riken structural genomics/proteomi initiative, RSGI; HET: PLP; 2.10A {Thermus thermophilus} SCOP: c.67.1.7 PDB: 1wyt_B* 1wyv_B* Back     alignment and structure
>3kgw_A Alanine-glyoxylate aminotransferase; AAH25799.1, putative aminotransferase, structural genomics, center for structural genomics, JCSG; HET: PLP; 1.65A {Mus musculus} SCOP: c.67.1.3 PDB: 3kgx_A 3imz_A* 3r9a_A* 1h0c_A* 1j04_A* Back     alignment and structure
>1eg5_A Aminotransferase; PLP-dependent enzymes, iron-sulfur-cluster synthesis, C-S BE transferase; HET: PLP; 2.00A {Thermotoga maritima} SCOP: c.67.1.3 PDB: 1ecx_A* Back     alignment and structure
>1vjo_A Alanine--glyoxylate aminotransferase; 17130350, ALR1004, STR genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: PLP; 1.70A {Nostoc SP} SCOP: c.67.1.3 Back     alignment and structure
>2jis_A Cysteine sulfinic acid decarboxylase; pyridoxal phosphate, alternative splicing, pyridoxal phosphate (PLP), structural genomics consortium (SGC); HET: PLP; 1.6A {Homo sapiens} Back     alignment and structure
>3cai_A Possible aminotransferase; RV3778C; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3m5u_A Phosphoserine aminotransferase; alpha-beta half sandwich, csgid, amino-acid biosynthesis, cytoplasm, pyridoxal phosphate; HET: MES; 2.15A {Campylobacter jejuni} SCOP: c.67.1.0 Back     alignment and structure
>2huf_A Alanine glyoxylate aminotransferase; alpha and beta protein, PLP-dependent transferase; HET: LLP; 1.75A {Aedes aegypti} PDB: 2hui_A* 2huu_A* Back     alignment and structure
>2bkw_A Alanine-glyoxylate aminotransferase 1; analine-glyoxylate aminotransferase, pyridoxal-5-phosphate, SAD, glycolate pathway; HET: LLP; 2.57A {Saccharomyces cerevisiae} SCOP: c.67.1.3 Back     alignment and structure
>3e77_A Phosphoserine aminotransferase; SERC, PLP, structural genomi structural genomics consortium, SGC, amino-acid biosynthesi aminotransferase; HET: PLP; 2.50A {Homo sapiens} Back     alignment and structure
>1wyu_A Glycine dehydrogenase (decarboxylating) subunit 1; alpha(2)beta(2) tetramer, riken structural genomics/proteomi initiative, RSGI; HET: PLP; 2.10A {Thermus thermophilus} SCOP: c.67.1.7 PDB: 1wyt_A* 1wyv_A* Back     alignment and structure
>3isl_A Purine catabolism protein PUCG; pyridoxalphosphate, PLP dependent enzymes, purine metabolism transaminases, aminotransferases; HET: PLP; 2.06A {Bacillus subtilis} Back     alignment and structure
>3hl2_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine, sepsecs, protein-RNA complex, alternative splicing, cytoplasm, protein biosynthesis, pyridoxal phosphate, selenium; HET: PLR SEP; 2.81A {Homo sapiens} Back     alignment and structure
>4eb5_A Probable cysteine desulfurase 2; scaffold, transferase-metal binding protein complex; HET: PLP EPE; 2.53A {Archaeoglobus fulgidus} PDB: 4eb7_A* Back     alignment and structure
>3kgw_A Alanine-glyoxylate aminotransferase; AAH25799.1, putative aminotransferase, structural genomics, center for structural genomics, JCSG; HET: PLP; 1.65A {Mus musculus} SCOP: c.67.1.3 PDB: 3kgx_A 3imz_A* 3r9a_A* 1h0c_A* 1j04_A* Back     alignment and structure
>1elu_A L-cysteine/L-cystine C-S lyase; FES cluster biosynthesis, pyridoxal 5'-phosphate, thiocystei aminoacrylate, enzyme-product complex; HET: PDA; 1.55A {Synechocystis SP} SCOP: c.67.1.3 PDB: 1elq_A* 1n2t_A* 1n31_A* Back     alignment and structure
>2ch1_A 3-hydroxykynurenine transaminase; PLP-enzyme, kynurenine pathway, transferase; HET: LLP; 2.4A {Anopheles gambiae} SCOP: c.67.1.3 PDB: 2ch2_A* Back     alignment and structure
>2e7j_A SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-strand, lyase, structural genomics; HET: PLP; 2.40A {Archaeoglobus fulgidus} SCOP: c.67.1.9 PDB: 2e7i_A* Back     alignment and structure
>2yrr_A Aminotransferase, class V; structural genomics, NPPSFA, national PROJ protein structural and functional analyses; HET: PLP; 1.86A {Thermus thermophilus} PDB: 2yri_A* Back     alignment and structure
>3ke3_A Putative serine-pyruvate aminotransferase; structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: LLP; 2.20A {Psychrobacter arcticus 273-4} Back     alignment and structure
>3f0h_A Aminotransferase; RER070207000802, structural genomics, JOIN for structural genomics, JCSG; HET: MSE LLP; 1.70A {Eubacterium rectale} Back     alignment and structure
>3e77_A Phosphoserine aminotransferase; SERC, PLP, structural genomi structural genomics consortium, SGC, amino-acid biosynthesi aminotransferase; HET: PLP; 2.50A {Homo sapiens} Back     alignment and structure
>3e9k_A Kynureninase; kynurenine-L-hydrolase, kynurenine hydrolase, pyridoxal-5'-phosphate, inhibitor complex, 3-hydroxy hippur hydroxyhippuric acid, PLP; HET: PLP 3XH; 1.70A {Homo sapiens} PDB: 2hzp_A* Back     alignment and structure
>1vjo_A Alanine--glyoxylate aminotransferase; 17130350, ALR1004, STR genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: PLP; 1.70A {Nostoc SP} SCOP: c.67.1.3 Back     alignment and structure
>2vyc_A Biodegradative arginine decarboxylase; pyridoxal phosphate, PLP-dependent E lyase, acid resistance; HET: LLP; 2.4A {Escherichia coli} Back     alignment and structure
>1svv_A Threonine aldolase; structural genomics, structural genomics of pathogenic proto SGPP, protein structure initiative, PSI; 2.10A {Leishmania major} SCOP: c.67.1.1 Back     alignment and structure
>2huf_A Alanine glyoxylate aminotransferase; alpha and beta protein, PLP-dependent transferase; HET: LLP; 1.75A {Aedes aegypti} PDB: 2hui_A* 2huu_A* Back     alignment and structure
>2z9v_A Aspartate aminotransferase; pyridoxamine, pyruvate; HET: PXM; 1.70A {Mesorhizobium loti} PDB: 2z9u_A* 2z9w_A* 2z9x_A* Back     alignment and structure
>1m32_A 2-aminoethylphosphonate-pyruvate aminotransferase; PLP-dependent aminotransferase fold; HET: PLP; 2.20A {Salmonella typhimurium} SCOP: c.67.1.3 Back     alignment and structure
>3lvm_A Cysteine desulfurase; structural genomics, montreal-kingston bacterial structural genomics initiative, BSGI, transferase; HET: PLP; 2.05A {Escherichia coli} PDB: 3lvk_A* 3lvl_B* 3lvj_A* 1p3w_B* Back     alignment and structure
>3hbx_A GAD 1, glutamate decarboxylase 1; calmodulin-binding, lyase, pyridoxal phosphate; HET: LLP; 2.67A {Arabidopsis thaliana} Back     alignment and structure
>1qz9_A Kynureninase; kynurenine, tryptophan, PLP, vitamin B6, pyridoxal-5'-phosph hydrolase; HET: PLP P3G; 1.85A {Pseudomonas fluorescens} SCOP: c.67.1.3 Back     alignment and structure
>3tqx_A 2-amino-3-ketobutyrate coenzyme A ligase; energy metabolism, transferase; HET: PLP; 2.30A {Coxiella burnetii} Back     alignment and structure
>2ch1_A 3-hydroxykynurenine transaminase; PLP-enzyme, kynurenine pathway, transferase; HET: LLP; 2.4A {Anopheles gambiae} SCOP: c.67.1.3 PDB: 2ch2_A* Back     alignment and structure
>1m32_A 2-aminoethylphosphonate-pyruvate aminotransferase; PLP-dependent aminotransferase fold; HET: PLP; 2.20A {Salmonella typhimurium} SCOP: c.67.1.3 Back     alignment and structure
>1v72_A Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2.05A {Pseudomonas putida} SCOP: c.67.1.1 Back     alignment and structure
>3m5u_A Phosphoserine aminotransferase; alpha-beta half sandwich, csgid, amino-acid biosynthesis, cytoplasm, pyridoxal phosphate; HET: MES; 2.15A {Campylobacter jejuni} SCOP: c.67.1.0 Back     alignment and structure
>1elu_A L-cysteine/L-cystine C-S lyase; FES cluster biosynthesis, pyridoxal 5'-phosphate, thiocystei aminoacrylate, enzyme-product complex; HET: PDA; 1.55A {Synechocystis SP} SCOP: c.67.1.3 PDB: 1elq_A* 1n2t_A* 1n31_A* Back     alignment and structure
>2fnu_A Aminotransferase; protein-product complex, structural genomics, montreal-kings bacterial structural genomics initiative, BSGI; HET: PMP UD1; 1.50A {Helicobacter pylori} SCOP: c.67.1.4 PDB: 2fni_A* 2fn6_A* Back     alignment and structure
>1rv3_A Serine hydroxymethyltransferase, cytosolic; one-carbon metabolism; HET: GLY PLP; 2.40A {Oryctolagus cuniculus} SCOP: c.67.1.4 PDB: 1rv4_A* 1rvu_A* 1rvy_A* 1ls3_A* 1cj0_A* 1bj4_A* 1eji_A* Back     alignment and structure
>2dgk_A GAD-beta, GADB, glutamate decarboxylase beta; gadbd1-14, autoinhibition, substituted aldamine, lyase; HET: PLP; 1.90A {Escherichia coli} PDB: 2dgm_A* 1pmo_A* 2dgl_A* 1pmm_A* 3fz6_A* 3fz7_A 3fz8_A* 1xey_A* Back     alignment and structure
>3vax_A Putative uncharacterized protein DNDA; desulfurase, transferase; HET: PLP; 2.40A {Streptomyces lividans} Back     alignment and structure
>2fnu_A Aminotransferase; protein-product complex, structural genomics, montreal-kings bacterial structural genomics initiative, BSGI; HET: PMP UD1; 1.50A {Helicobacter pylori} SCOP: c.67.1.4 PDB: 2fni_A* 2fn6_A* Back     alignment and structure
>1wyu_A Glycine dehydrogenase (decarboxylating) subunit 1; alpha(2)beta(2) tetramer, riken structural genomics/proteomi initiative, RSGI; HET: PLP; 2.10A {Thermus thermophilus} SCOP: c.67.1.7 PDB: 1wyt_A* 1wyv_A* Back     alignment and structure
>1eg5_A Aminotransferase; PLP-dependent enzymes, iron-sulfur-cluster synthesis, C-S BE transferase; HET: PLP; 2.00A {Thermotoga maritima} SCOP: c.67.1.3 PDB: 1ecx_A* Back     alignment and structure
>2bkw_A Alanine-glyoxylate aminotransferase 1; analine-glyoxylate aminotransferase, pyridoxal-5-phosphate, SAD, glycolate pathway; HET: LLP; 2.57A {Saccharomyces cerevisiae} SCOP: c.67.1.3 Back     alignment and structure
>3f0h_A Aminotransferase; RER070207000802, structural genomics, JOIN for structural genomics, JCSG; HET: MSE LLP; 1.70A {Eubacterium rectale} Back     alignment and structure
>1v72_A Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2.05A {Pseudomonas putida} SCOP: c.67.1.1 Back     alignment and structure
>1j32_A Aspartate aminotransferase; HET: PLP; 2.10A {Phormidium lapideum} SCOP: c.67.1.1 Back     alignment and structure
>2w8t_A SPT, serine palmitoyltransferase; HET: LLP; 1.25A {Sphingomonas paucimobilis} PDB: 2w8u_A* 2w8w_A* 2xbn_A* 2w8j_A* 2w8v_A* 2jg2_A* 2jgt_A 2x8u_A* Back     alignment and structure
>3cai_A Possible aminotransferase; RV3778C; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure
>3dzz_A Putative pyridoxal 5'-phosphate-dependent C-S LYA; putative PLP-dependent aminotransferase; HET: MSE LLP PG4; 1.61A {Lactobacillus delbrueckii subsp} SCOP: c.67.1.0 Back     alignment and structure
>1b9h_A AHBA synthase, protein (3-amino-5-hydroxybenzoic acid synthase); rifamycin biosynthesis (RIFD gene); HET: PLP; 2.00A {Amycolatopsis mediterranei} SCOP: c.67.1.4 PDB: 1b9i_A* Back     alignment and structure
>2a7v_A Serine hydroxymethyltransferase; structural genomics, structural genomics consortium, SGC; 2.04A {Homo sapiens} PDB: 3ou5_A Back     alignment and structure
>2c81_A Glutamine-2-deoxy-scyllo-inosose aminotransferase; SMAT, butirosin, aminoglycoside antibiotics; HET: PMP; 1.7A {Bacillus circulans} PDB: 2c7t_A* Back     alignment and structure
>3uwc_A Nucleotide-sugar aminotransferase; lipopolysaccharide biosynthesis; HET: MSE PMP; 1.80A {Coxiella burnetii} Back     alignment and structure
>2cb1_A O-acetyl homoserine sulfhydrylase; PLP enzyme, lyase, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: LLP; 2.0A {Thermus thermophilus} Back     alignment and structure
>3n0l_A Serine hydroxymethyltransferase; alpha beta class, 3-layer(ABA) sandwich, CSGI transferase, structural genomics; HET: MSE; 1.80A {Campylobacter jejuni} SCOP: c.67.1.0 Back     alignment and structure
>3ke3_A Putative serine-pyruvate aminotransferase; structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: LLP; 2.20A {Psychrobacter arcticus 273-4} Back     alignment and structure
>3frk_A QDTB; aminotransferase, sugar-modification, natural porduct; HET: TQP; 2.15A {Thermoanaerobacteriumthermosaccharolyticum} Back     alignment and structure
>3b8x_A WBDK, pyridoxamine 5-phosphate-dependent dehydrase; aspartate aminotransferase, colitose, perosamine, O-antigen, pyridoxal phosphate,; HET: G4M; 1.70A {Escherichia coli} PDB: 2gms_A* 2gmu_A* 2r0t_A* 3gr9_A* Back     alignment and structure
>2e7j_A SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-strand, lyase, structural genomics; HET: PLP; 2.40A {Archaeoglobus fulgidus} SCOP: c.67.1.9 PDB: 2e7i_A* Back     alignment and structure
>3dr4_A Putative perosamine synthetase; deoxysugar, pyridoxal phosphate, aspartate aminotransferase, O-antigen; HET: G4M; 1.60A {Caulobacter crescentus} PDB: 3dr7_A* 3bn1_A* Back     alignment and structure
>1b9h_A AHBA synthase, protein (3-amino-5-hydroxybenzoic acid synthase); rifamycin biosynthesis (RIFD gene); HET: PLP; 2.00A {Amycolatopsis mediterranei} SCOP: c.67.1.4 PDB: 1b9i_A* Back     alignment and structure
>2x3l_A ORN/Lys/Arg decarboxylase family protein; lyase; HET: LLP; 2.00A {Staphylococcus aureus} Back     alignment and structure
>1qz9_A Kynureninase; kynurenine, tryptophan, PLP, vitamin B6, pyridoxal-5'-phosph hydrolase; HET: PLP P3G; 1.85A {Pseudomonas fluorescens} SCOP: c.67.1.3 Back     alignment and structure
>3dr4_A Putative perosamine synthetase; deoxysugar, pyridoxal phosphate, aspartate aminotransferase, O-antigen; HET: G4M; 1.60A {Caulobacter crescentus} PDB: 3dr7_A* 3bn1_A* Back     alignment and structure
>3qhx_A Cystathionine gamma-synthase METB (CGS); structural genomics, seattle structural genomics center for infectious disease, ssgcid, CGS_LIKE; HET: LLP EPE; 1.65A {Mycobacterium ulcerans} SCOP: c.67.1.0 PDB: 3qi6_A* Back     alignment and structure
>1c4k_A Protein (ornithine decarboxylase); lyase; HET: PLP GTP; 2.70A {Lactobacillus SP} SCOP: c.23.1.4 c.67.1.5 d.125.1.1 PDB: 1ord_A* Back     alignment and structure
>1svv_A Threonine aldolase; structural genomics, structural genomics of pathogenic proto SGPP, protein structure initiative, PSI; 2.10A {Leishmania major} SCOP: c.67.1.1 Back     alignment and structure
>2vi8_A Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, enzyme memory, pyridoxal phosphate, one-carbon metabolism, PLP-dependent enzymes; HET: PLP; 1.67A {Bacillus stearothermophilus} PDB: 2vi9_A* 2via_A* 2vib_A* 1kkj_A* 1kkp_A* 1kl1_A* 1kl2_A* 1yjs_A* 2w7f_A* 2w7d_A* 2w7e_A* 2w7g_A* 2w7h_A* 1yjz_A* 1yjy_A* 2vgu_A* 2vgs_A* 2vgt_A* 2vgv_A* 2vgw_A* ... Back     alignment and structure
>3frk_A QDTB; aminotransferase, sugar-modification, natural porduct; HET: TQP; 2.15A {Thermoanaerobacteriumthermosaccharolyticum} Back     alignment and structure
>1gd9_A Aspartate aminotransferase; pyridoxal enzyme, temperature dependence O substrate recognition; HET: PLP; 1.80A {Pyrococcus horikoshii} SCOP: c.67.1.1 PDB: 1gde_A* 1dju_A* Back     alignment and structure
>1o69_A Aminotransferase; structural genomics, unknown function; HET: X04; 1.84A {Campylobacter jejuni} SCOP: c.67.1.4 PDB: 1o62_A 1o61_A* Back     alignment and structure
>3l8a_A METC, putative aminotransferase, probable beta-cystathi; beta-cystathionase, lyase; HET: PLP; 1.54A {Streptococcus mutans} Back     alignment and structure
>2c81_A Glutamine-2-deoxy-scyllo-inosose aminotransferase; SMAT, butirosin, aminoglycoside antibiotics; HET: PMP; 1.7A {Bacillus circulans} PDB: 2c7t_A* Back     alignment and structure
>3nra_A Aspartate aminotransferase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: LLP; 2.15A {Rhodobacter sphaeroides} Back     alignment and structure
>3a9z_A Selenocysteine lyase; PLP, cytoplasm, pyridoxal phosphate, transferase; HET: PLP SLP; 1.55A {Rattus norvegicus} PDB: 3a9x_A* 3a9y_A* 3gzd_A* 3gzc_A* 2hdy_A* Back     alignment and structure
>3nyt_A Aminotransferase WBPE; PLP binding, nucleotide-sugar binding; HET: ULP; 1.30A {Pseudomonas aeruginosa} PDB: 3nys_A* 3nyu_A* 3nu8_A* 3nu7_A* 3nub_A* Back     alignment and structure
>3uwc_A Nucleotide-sugar aminotransferase; lipopolysaccharide biosynthesis; HET: MSE PMP; 1.80A {Coxiella burnetii} Back     alignment and structure
>2dkj_A Serine hydroxymethyltransferase; PLP dependent enzyme, structural genomics; HET: PLP; 1.15A {Thermus thermophilus} Back     alignment and structure
>1xi9_A Putative transaminase; alanine aminotransferase, southeast collaboratory for structural genomics, secsg; HET: PLP; 2.33A {Pyrococcus furiosus} SCOP: c.67.1.1 Back     alignment and structure
>2gb3_A Aspartate aminotransferase; TM1698, structural genomics, PSI structure initiative, joint center for structural genomics; HET: LLP; 2.50A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>2rfv_A Methionine gamma-lyase; pyridoxal-5'-phosphate, PLP-dependent enzyme; HET: LLP; 1.35A {Citrobacter freundii} PDB: 1y4i_A* 3jwa_A* 3jw9_A* 3jwb_A* 3mkj_A* Back     alignment and structure
>1o69_A Aminotransferase; structural genomics, unknown function; HET: X04; 1.84A {Campylobacter jejuni} SCOP: c.67.1.4 PDB: 1o62_A 1o61_A* Back     alignment and structure
>1mdo_A ARNB aminotransferase; type 1 aminotransferase fold; HET: MSE PMP; 1.70A {Salmonella typhimurium} SCOP: c.67.1.4 PDB: 1mdx_A* 1mdz_A* Back     alignment and structure
>2oga_A Transaminase; PLP-dependent enzyme, desosamine, deoxysugars, antibiotics, hydrolase; HET: PGU; 2.05A {Streptomyces venezuelae} PDB: 2oge_A* Back     alignment and structure
>2c0r_A PSAT, phosphoserine aminotransferase; pyridoxal-5'-phosphate, pyridine serine biosynthesis, amino-acid biosynthesis, pyridoxal phosphate; HET: PLP; 1.2A {Bacillus circulans} SCOP: c.67.1.4 PDB: 1bt4_A* 1w3u_A* Back     alignment and structure
>1o4s_A Aspartate aminotransferase; TM1255, structural genomics, JCS protein structure initiative, joint center for structural G transferase; HET: PLP; 1.90A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>2ctz_A O-acetyl-L-homoserine sulfhydrylase; crystal, O-acetyl homoserine sulfhydrase, structural genomic structural genomics/proteomics initiative; HET: PLP; 2.60A {Thermus thermophilus} SCOP: c.67.1.3 Back     alignment and structure
>3b8x_A WBDK, pyridoxamine 5-phosphate-dependent dehydrase; aspartate aminotransferase, colitose, perosamine, O-antigen, pyridoxal phosphate,; HET: G4M; 1.70A {Escherichia coli} PDB: 2gms_A* 2gmu_A* 2r0t_A* 3gr9_A* Back     alignment and structure
>4dq6_A Putative pyridoxal phosphate-dependent transferas; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: PLP; 1.50A {Clostridium difficile} PDB: 4dgt_A* Back     alignment and structure
>2po3_A 4-dehydrase; external aldimine, PLP, aminotransferase, TDP-sugar; HET: T4K; 2.10A {Streptomyces venezuelae} Back     alignment and structure
>1gc0_A Methionine gamma-lyase; pyridoxal-5'-phosphate; HET: LLP; 1.70A {Pseudomonas putida} SCOP: c.67.1.3 PDB: 1gc2_A* 1pg8_A* 1ukj_A* 2o7c_A* Back     alignment and structure
>2vyc_A Biodegradative arginine decarboxylase; pyridoxal phosphate, PLP-dependent E lyase, acid resistance; HET: LLP; 2.4A {Escherichia coli} Back     alignment and structure
>3g0t_A Putative aminotransferase; NP_905498.1, putative aspartate aminotransferase, structural genomics, joint center for structural genomics; HET: MSE LLP PE4; 1.75A {Porphyromonas gingivalis} Back     alignment and structure
>1u08_A Hypothetical aminotransferase YBDL; alpha beta protein; HET: PLP; 2.35A {Escherichia coli} SCOP: c.67.1.1 Back     alignment and structure
>2o0r_A RV0858C (N-succinyldiaminopimelate aminotransfera; PLP-binding enzyme, lysine biosynthesis, aminotransferase, S genomics; HET: LLP; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1c7n_A Cystalysin; transferase, aminotransferase, pyridoxal phosphate; HET: PLP; 1.90A {Treponema denticola} SCOP: c.67.1.3 PDB: 1c7o_A* Back     alignment and structure
>3euc_A Histidinol-phosphate aminotransferase 2; YP_297314.1, structur genomics, joint center for structural genomics, JCSG; HET: MSE; 2.05A {Ralstonia eutropha JMP134} SCOP: c.67.1.0 Back     alignment and structure
>3ri6_A O-acetylhomoserine sulfhydrylase; PYR 5'-phosphate, gamma-elimination, direct sulfhydrylation, CY metabolism, protein thiocarboxylate, TR; 2.20A {Wolinella succinogenes} Back     alignment and structure
>2zc0_A Alanine glyoxylate transaminase; alanine:glyoxylate aminotransferase, archaea, thermococcus L transferase; HET: PMP; 2.30A {Thermococcus litoralis} Back     alignment and structure
>1fc4_A 2-amino-3-ketobutyrate conenzyme A ligase; 2-amino-3-ketobutyrate COA ligase, pyridoxal phosphate, COEN transferase, structural genomics; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.4 Back     alignment and structure
>2oga_A Transaminase; PLP-dependent enzyme, desosamine, deoxysugars, antibiotics, hydrolase; HET: PGU; 2.05A {Streptomyces venezuelae} PDB: 2oge_A* Back     alignment and structure
>1qgn_A Protein (cystathionine gamma-synthase); methionine biosynthesis, pyridoxal 5'-phosphate, gamma-famil; HET: PLP; 2.90A {Nicotiana tabacum} SCOP: c.67.1.3 PDB: 1i41_A* 1i48_A* 1i43_A* Back     alignment and structure
>3cq5_A Histidinol-phosphate aminotransferase; PLP, PMP, amino-acid biosynthesis, histidine biosynthesis, pyridoxal phosphate; HET: PMP; 1.80A {Corynebacterium glutamicum} PDB: 3cq6_A* 3cq4_A Back     alignment and structure
>3dzz_A Putative pyridoxal 5'-phosphate-dependent C-S LYA; putative PLP-dependent aminotransferase; HET: MSE LLP PG4; 1.61A {Lactobacillus delbrueckii subsp} SCOP: c.67.1.0 Back     alignment and structure
>2bwn_A 5-aminolevulinate synthase; tetrapyrrole biosynthesis, heme biosynthesis, pyridoxal PHOS dependent, transferase, acyltransferase; HET: LLP; 2.1A {Rhodobacter capsulatus} SCOP: c.67.1.4 PDB: 2bwo_A* 2bwp_A* Back     alignment and structure
>3kki_A CAI-1 autoinducer synthase; quorum sensing, CQSA, P virulence, acyltransferase, aminotransferase, pyridoxal PHO transferase; HET: PLP; 1.80A {Vibrio cholerae} PDB: 3hqt_A* 2wk9_A* 2wk8_A* 2wka_A* 2wk7_A Back     alignment and structure
>3gbx_A Serine hydroxymethyltransferase; structural genomics, IDP01011, serine hydroxymethyltransfera salmonella typhimurium.; HET: MSE; 1.80A {Salmonella typhimurium} SCOP: c.67.1.4 PDB: 1dfo_A* 3g8m_A* 1eqb_A* Back     alignment and structure
>1bw0_A TAT, protein (tyrosine aminotransferase); tyrosine catabolism, pyridoxal-5'-phosphate, PLP; HET: LLP; 2.50A {Trypanosoma cruzi} SCOP: c.67.1.1 Back     alignment and structure
>1w23_A Phosphoserine aminotransferase; pyridoxal-5'-phosphate; HET: PGE PLP EPE; 1.08A {Bacillus alcalophilus} SCOP: c.67.1.4 PDB: 2bhx_A* 2bi1_A* 2bi2_A* 2bi3_A* 2bi5_A* 2bi9_A* 2bia_A* 2bie_A* 2big_A* Back     alignment and structure
>1jg8_A L-ALLO-threonine aldolase; glycine biosynthesis, pyridoxal-5'- phosphate, calcium binding site, structural genomics, PSI; HET: LLP; 1.80A {Thermotoga maritima} SCOP: c.67.1.1 PDB: 1lw4_A* 1lw5_A* 1m6s_A* 2fm1_A* Back     alignment and structure
>1v2d_A Glutamine aminotransferase; PLP, riken structural genomics/proteomics initi RSGI, structural genomics; HET: PLP; 1.90A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1v2e_A* 1v2f_A* Back     alignment and structure
>3ly1_A Putative histidinol-phosphate aminotransferase; structural G joint center for structural genomics, JCSG; HET: MSE PLP CIT; 1.80A {Erwinia carotovora atroseptica} Back     alignment and structure
>2c0r_A PSAT, phosphoserine aminotransferase; pyridoxal-5'-phosphate, pyridine serine biosynthesis, amino-acid biosynthesis, pyridoxal phosphate; HET: PLP; 1.2A {Bacillus circulans} SCOP: c.67.1.4 PDB: 1bt4_A* 1w3u_A* Back     alignment and structure
>3ju7_A Putative PLP-dependent aminotransferase; NP_978343.1, struct genomics, joint center for structural genomics, JCSG; HET: LLP PGE; 2.19A {Bacillus cereus atcc 10987} Back     alignment and structure
>3dyd_A Tyrosine aminotransferase; PLP, SGC, structural genomics, structural genomics consortium, disease mutation, phenylalani catabolism; HET: PLP; 2.30A {Homo sapiens} PDB: 3pdx_A* Back     alignment and structure
>2fyf_A PSAT, phosphoserine aminotransferase; PLP-dependent enzyme, dimer, structural genomics; HET: PLP; 1.50A {Mycobacterium tuberculosis} PDB: 3vom_A* Back     alignment and structure
>1d2f_A MALY protein; aminotransferase fold, large PLP-binding domain, small C-TER domain, open alpha-beta structure., transferase; HET: PLP; 2.50A {Escherichia coli} SCOP: c.67.1.3 Back     alignment and structure
>3aow_A Putative uncharacterized protein PH0207; protein-PLP-AKG triple complex, schiff-base linkage, kynuren aminotransferase; HET: PLP AKG; 1.56A {Pyrococcus horikoshii} PDB: 3aov_A* 3ath_A* 3av7_A* 1x0m_A 1wst_A* Back     alignment and structure
>2fq6_A Cystathionine beta-lyase; protein-inhibitor complex, PLP cofactor covalently bound to inhibitor; HET: P3F; 1.78A {Escherichia coli} SCOP: c.67.1.3 PDB: 2gqn_A* 1cl1_A* 1cl2_A* Back     alignment and structure
>1mdo_A ARNB aminotransferase; type 1 aminotransferase fold; HET: MSE PMP; 1.70A {Salmonella typhimurium} SCOP: c.67.1.4 PDB: 1mdx_A* 1mdz_A* Back     alignment and structure
>3n75_A LDC, lysine decarboxylase, inducible; pyridoxal-5'-phosphate dependent decarboxylase, acid stress stringent response; HET: LLP G4P P6G; 2.00A {Escherichia coli} PDB: 3q16_A* Back     alignment and structure
>2fyf_A PSAT, phosphoserine aminotransferase; PLP-dependent enzyme, dimer, structural genomics; HET: PLP; 1.50A {Mycobacterium tuberculosis} PDB: 3vom_A* Back     alignment and structure
>3ecd_A Serine hydroxymethyltransferase 2; ssgcid, decode, bupsa00008A, one-carbon metabolism, pyridoxa phosphate, structural genomics; 1.60A {Burkholderia pseudomallei} Back     alignment and structure
>3a2b_A Serine palmitoyltransferase; vitamin B6-dependent enzyme fold type I, acyltransferase, PY phosphate; HET: PLP; 2.30A {Sphingobacterium multivorum} Back     alignment and structure
>3euc_A Histidinol-phosphate aminotransferase 2; YP_297314.1, structur genomics, joint center for structural genomics, JCSG; HET: MSE; 2.05A {Ralstonia eutropha JMP134} SCOP: c.67.1.0 Back     alignment and structure
>2z61_A Probable aspartate aminotransferase 2; amino acid aminotransferase, kynurenine aminotransferase, MJ0684, cytoplasm; HET: LLP; 2.20A {Methanococcus jannaschii} Back     alignment and structure
>2po3_A 4-dehydrase; external aldimine, PLP, aminotransferase, TDP-sugar; HET: T4K; 2.10A {Streptomyces venezuelae} Back     alignment and structure
>3acz_A Methionine gamma-lyase; L-methionine; HET: LLP; 1.97A {Entamoeba histolytica} PDB: 3aej_A* 3ael_A* 3aem_A* 3aen_A* 3aeo_A* 3aep_A* Back     alignment and structure
>3ffh_A Histidinol-phosphate aminotransferase; APC88260, listeria in CLIP11262, structural genomics, PSI-2; 2.31A {Listeria innocua} SCOP: c.67.1.0 Back     alignment and structure
>3tcm_A Alanine aminotransferase 2; pyridoxal phosphate (PLP)-binding; HET: DCS; 2.71A {Hordeum vulgare} Back     alignment and structure
>3a2b_A Serine palmitoyltransferase; vitamin B6-dependent enzyme fold type I, acyltransferase, PY phosphate; HET: PLP; 2.30A {Sphingobacterium multivorum} Back     alignment and structure
>1e5e_A MGL, methionine gamma-lyase; methionine biosynthesis, PLP-dependent enzymes, C-S gamma lyase; HET: PPJ; 2.18A {Trichomonas vaginalis} SCOP: c.67.1.3 PDB: 1e5f_A* Back     alignment and structure
>3ftb_A Histidinol-phosphate aminotransferase; structural genomics, PSI, MCSG, protein structure initiative; 2.00A {Clostridium acetobutylicum} SCOP: c.67.1.0 Back     alignment and structure
>3h14_A Aminotransferase, classes I and II; YP_167802.1, SPO258 structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.90A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>1w23_A Phosphoserine aminotransferase; pyridoxal-5'-phosphate; HET: PGE PLP EPE; 1.08A {Bacillus alcalophilus} SCOP: c.67.1.4 PDB: 2bhx_A* 2bi1_A* 2bi2_A* 2bi3_A* 2bi5_A* 2bi9_A* 2bia_A* 2bie_A* 2big_A* Back     alignment and structure
>1j32_A Aspartate aminotransferase; HET: PLP; 2.10A {Phormidium lapideum} SCOP: c.67.1.1 Back     alignment and structure
>3ffh_A Histidinol-phosphate aminotransferase; APC88260, listeria in CLIP11262, structural genomics, PSI-2; 2.31A {Listeria innocua} SCOP: c.67.1.0 Back     alignment and structure
>3lws_A Aromatic amino acid beta-eliminating lyase/threonine aldolase; structural genomics, joint center for structural genomics, JCSG; HET: LLP MSE; 2.00A {Exiguobacterium sibiricum} Back     alignment and structure
>2vi8_A Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, enzyme memory, pyridoxal phosphate, one-carbon metabolism, PLP-dependent enzymes; HET: PLP; 1.67A {Bacillus stearothermophilus} PDB: 2vi9_A* 2via_A* 2vib_A* 1kkj_A* 1kkp_A* 1kl1_A* 1kl2_A* 1yjs_A* 2w7f_A* 2w7d_A* 2w7e_A* 2w7g_A* 2w7h_A* 1yjz_A* 1yjy_A* 2vgu_A* 2vgs_A* 2vgt_A* 2vgv_A* 2vgw_A* ... Back     alignment and structure
>2cb1_A O-acetyl homoserine sulfhydrylase; PLP enzyme, lyase, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: LLP; 2.0A {Thermus thermophilus} Back     alignment and structure
>3h7f_A Serine hydroxymethyltransferase 1; cytoplasm, one-carbon metabolism, pyridoxal phosphate, structural genomics; HET: LLP; 1.50A {Mycobacterium tuberculosis} Back     alignment and structure
>1ax4_A Tryptophanase; tryptophan biosynthesis, tryptophan indole-lyase, pyridoxal 5'-phosphate, monovalent cation binding site; HET: LLP; 2.10A {Proteus vulgaris} SCOP: c.67.1.2 Back     alignment and structure
>1bs0_A Protein (8-amino-7-oxonanoate synthase); PLP-dependent acyl-COA synthase, biotin biosynthesis, 8-AMIN oxonanoate synthase; 1.65A {Escherichia coli} SCOP: c.67.1.4 PDB: 2g6w_A* 1dje_A* 1dj9_A* Back     alignment and structure
>3fdb_A Beta C-S lyase, putative PLP-dependent beta-cystathionase; PLP-dependent transferase-like fold, structural genomics; HET: LLP; 1.99A {Corynebacterium diphtheriae} Back     alignment and structure
>3piu_A 1-aminocyclopropane-1-carboxylate synthase; fruit ripening, ethylene biosynthesis, lyase, pyridoxal 5'-P binding; HET: LLP PLR; 1.35A {Malus domestica} SCOP: c.67.1.4 PDB: 1m4n_A* 1m7y_A* 1ynu_A* 1b8g_A* Back     alignment and structure
>3i16_A Aluminum resistance protein; YP_878183.1, carbon-sulfur lyase involved in aluminum resist structural genomics; HET: MSE TLA PLP; 2.00A {Clostridium novyi} PDB: 3gwp_A* Back     alignment and structure
>1rv3_A Serine hydroxymethyltransferase, cytosolic; one-carbon metabolism; HET: GLY PLP; 2.40A {Oryctolagus cuniculus} SCOP: c.67.1.4 PDB: 1rv4_A* 1rvu_A* 1rvy_A* 1ls3_A* 1cj0_A* 1bj4_A* 1eji_A* Back     alignment and structure
>1ax4_A Tryptophanase; tryptophan biosynthesis, tryptophan indole-lyase, pyridoxal 5'-phosphate, monovalent cation binding site; HET: LLP; 2.10A {Proteus vulgaris} SCOP: c.67.1.2 Back     alignment and structure
>1cs1_A CGS, protein (cystathionine gamma-synthase); lyase, LLP-dependent enzymes, methionine biosynthesis; HET: LLP DHD; 1.50A {Escherichia coli} SCOP: c.67.1.3 Back     alignment and structure
>2zyj_A Alpha-aminodipate aminotransferase; alpha-aminoadipate aminotransferase; HET: PGU; 1.67A {Thermus thermophilus} PDB: 2egy_A* 2dtv_A* 2zg5_A* 2zp7_A* 2z1y_A* 3cbf_A* Back     alignment and structure
>1iay_A ACC synthase 2, 1-aminocyclopropane-1-carboxylate synthase 2; protein-cofactor-inhibitor complex, V6-dependent enzyme, LYA; HET: PLP AVG; 2.70A {Solanum lycopersicum} SCOP: c.67.1.4 PDB: 1iax_A* Back     alignment and structure
>1jg8_A L-ALLO-threonine aldolase; glycine biosynthesis, pyridoxal-5'- phosphate, calcium binding site, structural genomics, PSI; HET: LLP; 1.80A {Thermotoga maritima} SCOP: c.67.1.1 PDB: 1lw4_A* 1lw5_A* 1m6s_A* 2fm1_A* Back     alignment and structure
>3ndn_A O-succinylhomoserine sulfhydrylase; seattle structural genomics center for infectious disease, S mycobacterium, PLP, schiff base; HET: LLP; 1.85A {Mycobacterium tuberculosis} Back     alignment and structure
>2x3l_A ORN/Lys/Arg decarboxylase family protein; lyase; HET: LLP; 2.00A {Staphylococcus aureus} Back     alignment and structure
>2x5d_A Probable aminotransferase; HET: LLP PLP; 2.25A {Pseudomonas aeruginosa} Back     alignment and structure
>1yiz_A Kynurenine aminotransferase; glutamine transaminase; kynurenic acid, mosquito, PLP-enzyme, pyridoxal phosphate, PLP; HET: LLP; 1.55A {Aedes aegypti} SCOP: c.67.1.1 PDB: 1yiy_A* 2r5c_A* 2r5e_A* Back     alignment and structure
>3ly1_A Putative histidinol-phosphate aminotransferase; structural G joint center for structural genomics, JCSG; HET: MSE PLP CIT; 1.80A {Erwinia carotovora atroseptica} Back     alignment and structure
>3nyt_A Aminotransferase WBPE; PLP binding, nucleotide-sugar binding; HET: ULP; 1.30A {Pseudomonas aeruginosa} PDB: 3nys_A* 3nyu_A* 3nu8_A* 3nu7_A* 3nub_A* Back     alignment and structure
>1fc4_A 2-amino-3-ketobutyrate conenzyme A ligase; 2-amino-3-ketobutyrate COA ligase, pyridoxal phosphate, COEN transferase, structural genomics; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.4 Back     alignment and structure
>4dq6_A Putative pyridoxal phosphate-dependent transferas; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: PLP; 1.50A {Clostridium difficile} PDB: 4dgt_A* Back     alignment and structure
>2dkj_A Serine hydroxymethyltransferase; PLP dependent enzyme, structural genomics; HET: PLP; 1.15A {Thermus thermophilus} Back     alignment and structure
>2gb3_A Aspartate aminotransferase; TM1698, structural genomics, PSI structure initiative, joint center for structural genomics; HET: LLP; 2.50A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>3ftb_A Histidinol-phosphate aminotransferase; structural genomics, PSI, MCSG, protein structure initiative; 2.00A {Clostridium acetobutylicum} SCOP: c.67.1.0 Back     alignment and structure
>3nmy_A Xometc, cystathionine gamma-lyase-like protein; Cys-Met metabolism PLP-dependent enzyme family, CYST gamma lyase, pyridoxal-phosphate; HET: PLP; 2.07A {Xanthomonas oryzae PV} SCOP: c.67.1.0 PDB: 3e6g_A* 3nnp_A* Back     alignment and structure
>3jzl_A Putative cystathionine beta-lyase involved in ALU resistance; putative cystathionine beta-lyase involved in aluminum resis structural genomics; HET: LLP; 1.91A {Listeria monocytogenes str} PDB: 3fd0_A* Back     alignment and structure
>1bs0_A Protein (8-amino-7-oxonanoate synthase); PLP-dependent acyl-COA synthase, biotin biosynthesis, 8-AMIN oxonanoate synthase; 1.65A {Escherichia coli} SCOP: c.67.1.4 PDB: 2g6w_A* 1dje_A* 1dj9_A* Back     alignment and structure
>3get_A Histidinol-phosphate aminotransferase; NP_281508.1, structural genomics, joint center for structural genomics; HET: LLP MSE; 2.01A {Campylobacter jejuni subsp} Back     alignment and structure
>1v2d_A Glutamine aminotransferase; PLP, riken structural genomics/proteomics initi RSGI, structural genomics; HET: PLP; 1.90A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1v2e_A* 1v2f_A* Back     alignment and structure
>1c4k_A Protein (ornithine decarboxylase); lyase; HET: PLP GTP; 2.70A {Lactobacillus SP} SCOP: c.23.1.4 c.67.1.5 d.125.1.1 PDB: 1ord_A* Back     alignment and structure
>3l8a_A METC, putative aminotransferase, probable beta-cystathi; beta-cystathionase, lyase; HET: PLP; 1.54A {Streptococcus mutans} Back     alignment and structure
>1vp4_A Aminotransferase, putative; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE PLP; 1.82A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>3ju7_A Putative PLP-dependent aminotransferase; NP_978343.1, struct genomics, joint center for structural genomics, JCSG; HET: LLP PGE; 2.19A {Bacillus cereus atcc 10987} Back     alignment and structure
>3kki_A CAI-1 autoinducer synthase; quorum sensing, CQSA, P virulence, acyltransferase, aminotransferase, pyridoxal PHO transferase; HET: PLP; 1.80A {Vibrio cholerae} PDB: 3hqt_A* 2wk9_A* 2wk8_A* 2wka_A* 2wk7_A Back     alignment and structure
>1gd9_A Aspartate aminotransferase; pyridoxal enzyme, temperature dependence O substrate recognition; HET: PLP; 1.80A {Pyrococcus horikoshii} SCOP: c.67.1.1 PDB: 1gde_A* 1dju_A* Back     alignment and structure
>3piu_A 1-aminocyclopropane-1-carboxylate synthase; fruit ripening, ethylene biosynthesis, lyase, pyridoxal 5'-P binding; HET: LLP PLR; 1.35A {Malus domestica} SCOP: c.67.1.4 PDB: 1m4n_A* 1m7y_A* 1ynu_A* 1b8g_A* Back     alignment and structure
>2zc0_A Alanine glyoxylate transaminase; alanine:glyoxylate aminotransferase, archaea, thermococcus L transferase; HET: PMP; 2.30A {Thermococcus litoralis} Back     alignment and structure
>2ez2_A Beta-tyrosinase, tyrosine phenol-lyase; PLP-dependent enzyme, pyridoxal-5'-phosphate, domain lyase; 1.85A {Citrobacter freundii} PDB: 2ez1_A 2vlf_A* 2vlh_A* 2yct_A* 1tpl_A 2tpl_A* 2ycn_A* 2yhk_A* 2ycp_A* 1c7g_A* Back     alignment and structure
>1pff_A Methionine gamma-lyase; homocysteine; 2.50A {Trichomonas vaginalis} SCOP: c.67.1.3 Back     alignment and structure
>3nra_A Aspartate aminotransferase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: LLP; 2.15A {Rhodobacter sphaeroides} Back     alignment and structure
>3pj0_A LMO0305 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology, lyase; HET: LLP MSE; 1.80A {Listeria monocytogenes} Back     alignment and structure
>1b5p_A Protein (aspartate aminotransferase); pyridoxal enzyme; HET: PLP; 1.80A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1gck_A* 1b5o_A* 5bj4_A* 1gc4_A* 1gc3_A* 1bkg_A* 5bj3_A* 1bjw_A* Back     alignment and structure
>3e2y_A Kynurenine-oxoglutarate transaminase 3; alpha beta protein, PLP dependent protein, aminotransferase, pyridoxal phosphate, transferase; HET: GLN PMP; 2.26A {Mus musculus} SCOP: c.67.1.0 PDB: 2zjg_A* 3e2f_A* 3e2z_A* Back     alignment and structure
>2o1b_A Aminotransferase, class I; aminotrasferase; HET: PLP; 1.95A {Staphylococcus aureus} Back     alignment and structure
>2oqx_A Tryptophanase; lyase, pyridoxal phosphate, tryptophan catabolism; HET: CME EPE; 1.90A {Escherichia coli} SCOP: c.67.1.2 PDB: 2c44_A 2v1p_A* 2v0y_A* Back     alignment and structure
>3fsl_A Aromatic-amino-acid aminotransferase; tyrosine aminotransferase, pyridoxal phosphate, internal ALD schiff base, amino-acid biosynthesis; HET: PLR; 2.35A {Escherichia coli k-12} SCOP: c.67.1.1 PDB: 3tat_A* Back     alignment and structure
>3if2_A Aminotransferase; YP_265399.1, structura genomics, joint center for structural genomics, JCSG, prote structure initiative, PSI-2; HET: PLP; 2.50A {Psychrobacter arcticus 273-4} Back     alignment and structure
>1o4s_A Aspartate aminotransferase; TM1255, structural genomics, JCS protein structure initiative, joint center for structural G transferase; HET: PLP; 1.90A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>2dou_A Probable N-succinyldiaminopimelate aminotransfera; PLP-dependent enzyme, structural genomics, NPPSFA; HET: EPE; 2.30A {Thermus thermophilus} Back     alignment and structure
>1xi9_A Putative transaminase; alanine aminotransferase, southeast collaboratory for structural genomics, secsg; HET: PLP; 2.33A {Pyrococcus furiosus} SCOP: c.67.1.1 Back     alignment and structure
>3lws_A Aromatic amino acid beta-eliminating lyase/threonine aldolase; structural genomics, joint center for structural genomics, JCSG; HET: LLP MSE; 2.00A {Exiguobacterium sibiricum} Back     alignment and structure
>3op7_A Aminotransferase class I and II; PLP-dependent transferase, structural genomics, joint center structural genomics, JCSG; HET: LLP UNL; 1.70A {Streptococcus suis 89} PDB: 3p6k_A* Back     alignment and structure
>1vef_A Acetylornithine/acetyl-lysine aminotransferase; PLP, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: PLP; 1.35A {Thermus thermophilus} SCOP: c.67.1.4 PDB: 1wkg_A* 1wkh_A* Back     alignment and structure
>3cq5_A Histidinol-phosphate aminotransferase; PLP, PMP, amino-acid biosynthesis, histidine biosynthesis, pyridoxal phosphate; HET: PMP; 1.80A {Corynebacterium glutamicum} PDB: 3cq6_A* 3cq4_A Back     alignment and structure
>2ez2_A Beta-tyrosinase, tyrosine phenol-lyase; PLP-dependent enzyme, pyridoxal-5'-phosphate, domain lyase; 1.85A {Citrobacter freundii} PDB: 2ez1_A 2vlf_A* 2vlh_A* 2yct_A* 1tpl_A 2tpl_A* 2ycn_A* 2yhk_A* 2ycp_A* 1c7g_A* Back     alignment and structure
>3pj0_A LMO0305 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology, lyase; HET: LLP MSE; 1.80A {Listeria monocytogenes} Back     alignment and structure
>3get_A Histidinol-phosphate aminotransferase; NP_281508.1, structural genomics, joint center for structural genomics; HET: LLP MSE; 2.01A {Campylobacter jejuni subsp} Back     alignment and structure
>3qhx_A Cystathionine gamma-synthase METB (CGS); structural genomics, seattle structural genomics center for infectious disease, ssgcid, CGS_LIKE; HET: LLP EPE; 1.65A {Mycobacterium ulcerans} SCOP: c.67.1.0 PDB: 3qi6_A* Back     alignment and structure
>1n8p_A Cystathionine gamma-lyase; three open alpha/beta structures; HET: PLP; 2.60A {Saccharomyces cerevisiae} SCOP: c.67.1.3 Back     alignment and structure
>3n0l_A Serine hydroxymethyltransferase; alpha beta class, 3-layer(ABA) sandwich, CSGI transferase, structural genomics; HET: MSE; 1.80A {Campylobacter jejuni} SCOP: c.67.1.0 Back     alignment and structure
>1iay_A ACC synthase 2, 1-aminocyclopropane-1-carboxylate synthase 2; protein-cofactor-inhibitor complex, V6-dependent enzyme, LYA; HET: PLP AVG; 2.70A {Solanum lycopersicum} SCOP: c.67.1.4 PDB: 1iax_A* Back     alignment and structure
>3g0t_A Putative aminotransferase; NP_905498.1, putative aspartate aminotransferase, structural genomics, joint center for structural genomics; HET: MSE LLP PE4; 1.75A {Porphyromonas gingivalis} Back     alignment and structure
>3fvs_A Kynurenine--oxoglutarate transaminase 1; alpha beta protein, PLP dependent protein, aminotransferase, pyridoxal phosphate, transferase; HET: LLP; 1.50A {Homo sapiens} SCOP: c.67.1.1 PDB: 3fvu_A* 3fvx_A* 1w7l_A* 1w7m_A* 1w7n_A* Back     alignment and structure
>3ht4_A Aluminum resistance protein; lyase, putative cystathionine BEAT-lyase, aluminium resistance protein, Q81A77_baccr, NESG, BCR213; 2.90A {Bacillus cereus atcc 14579} Back     alignment and structure
>2a7v_A Serine hydroxymethyltransferase; structural genomics, structural genomics consortium, SGC; 2.04A {Homo sapiens} PDB: 3ou5_A Back     alignment and structure
>1fg7_A Histidinol phosphate aminotransferase; HISC, histidine biosynthesis, pyridoxal PH montreal-kingston bacterial structural genomics initiative; HET: PMP; 1.50A {Escherichia coli} SCOP: c.67.1.1 PDB: 1fg3_A* 1gew_A* 1gex_A* 1gey_A* 1iji_A* Back     alignment and structure
>3gbx_A Serine hydroxymethyltransferase; structural genomics, IDP01011, serine hydroxymethyltransfera salmonella typhimurium.; HET: MSE; 1.80A {Salmonella typhimurium} SCOP: c.67.1.4 PDB: 1dfo_A* 3g8m_A* 1eqb_A* Back     alignment and structure
>1vp4_A Aminotransferase, putative; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE PLP; 1.82A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>3b46_A Aminotransferase BNA3; kynurenine aminotransferase, LLP, PLP, cytoplasm, mitochondrion, pyridoxal phosphate; HET: LLP; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2oqx_A Tryptophanase; lyase, pyridoxal phosphate, tryptophan catabolism; HET: CME EPE; 1.90A {Escherichia coli} SCOP: c.67.1.2 PDB: 2c44_A 2v1p_A* 2v0y_A* Back     alignment and structure
>1lc5_A COBD, L-threonine-O-3-phosphate decarboxylase; PLP-dependent decarboxylase cobalamin, lyase; 1.46A {Salmonella enterica} SCOP: c.67.1.1 PDB: 1lc7_A* 1lc8_A* 1lkc_A* Back     alignment and structure
>1bw0_A TAT, protein (tyrosine aminotransferase); tyrosine catabolism, pyridoxal-5'-phosphate, PLP; HET: LLP; 2.50A {Trypanosoma cruzi} SCOP: c.67.1.1 Back     alignment and structure
>3ecd_A Serine hydroxymethyltransferase 2; ssgcid, decode, bupsa00008A, one-carbon metabolism, pyridoxa phosphate, structural genomics; 1.60A {Burkholderia pseudomallei} Back     alignment and structure
>3hvy_A Cystathionine beta-lyase family protein, YNBB B.S ortholog; NP_348457.1, putative cystathionine beta-lyase involved in A resistance; HET: LLP MSE; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>4f4e_A Aromatic-amino-acid aminotransferase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: LLP; 1.80A {Burkholderia pseudomallei} PDB: 4eff_A* Back     alignment and structure
>3ele_A Amino transferase; RER070207001803, structural genomics, JOI for structural genomics, JCSG; HET: MSE PLP; 2.10A {Eubacterium rectale} Back     alignment and structure
>1gc0_A Methionine gamma-lyase; pyridoxal-5'-phosphate; HET: LLP; 1.70A {Pseudomonas putida} SCOP: c.67.1.3 PDB: 1gc2_A* 1pg8_A* 1ukj_A* 2o7c_A* Back     alignment and structure
>2zyj_A Alpha-aminodipate aminotransferase; alpha-aminoadipate aminotransferase; HET: PGU; 1.67A {Thermus thermophilus} PDB: 2egy_A* 2dtv_A* 2zg5_A* 2zp7_A* 2z1y_A* 3cbf_A* Back     alignment and structure
>3ihj_A Alanine aminotransferase 2; helix, structural genomics, structural genomics consortium, pyridoxal phosphate; HET: PLP; 2.30A {Homo sapiens} Back     alignment and structure
>3fdb_A Beta C-S lyase, putative PLP-dependent beta-cystathionase; PLP-dependent transferase-like fold, structural genomics; HET: LLP; 1.99A {Corynebacterium diphtheriae} Back     alignment and structure
>1yaa_A Aspartate aminotransferase; HET: PLP; 2.05A {Saccharomyces cerevisiae} SCOP: c.67.1.1 Back     alignment and structure
>2rfv_A Methionine gamma-lyase; pyridoxal-5'-phosphate, PLP-dependent enzyme; HET: LLP; 1.35A {Citrobacter freundii} PDB: 1y4i_A* 3jwa_A* 3jw9_A* 3jwb_A* 3mkj_A* Back     alignment and structure
>1ibj_A CBL, cystathionine beta-lyase; PLP-dependent enzyme, methionine biosynthesis, transsulfurat lyase; HET: PLP; 2.30A {Arabidopsis thaliana} SCOP: c.67.1.3 Back     alignment and structure
>1cs1_A CGS, protein (cystathionine gamma-synthase); lyase, LLP-dependent enzymes, methionine biosynthesis; HET: LLP DHD; 1.50A {Escherichia coli} SCOP: c.67.1.3 Back     alignment and structure
>1c7n_A Cystalysin; transferase, aminotransferase, pyridoxal phosphate; HET: PLP; 1.90A {Treponema denticola} SCOP: c.67.1.3 PDB: 1c7o_A* Back     alignment and structure
>3cog_A Cystathionine gamma-lyase; CTH, PLP, propargylglycine, SGC, inhibitor, structural genom stockholm, structural genomics consortium; HET: PLP; 2.00A {Homo sapiens} PDB: 2nmp_A* 3elp_B Back     alignment and structure
>3meb_A Aspartate aminotransferase; pyridoxal PHOS transferase, structural genomics, seattle structural genomi for infectious disease, ssgcid; HET: PLP; 1.90A {Giardia lamblia} Back     alignment and structure
>2bwn_A 5-aminolevulinate synthase; tetrapyrrole biosynthesis, heme biosynthesis, pyridoxal PHOS dependent, transferase, acyltransferase; HET: LLP; 2.1A {Rhodobacter capsulatus} SCOP: c.67.1.4 PDB: 2bwo_A* 2bwp_A* Back     alignment and structure
>3jtx_A Aminotransferase; NP_283882.1, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; HET: LLP MES; 1.91A {Neisseria meningitidis Z2491} Back     alignment and structure
>3h14_A Aminotransferase, classes I and II; YP_167802.1, SPO258 structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.90A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>3p1t_A Putative histidinol-phosphate aminotransferase; PLP-dependent transferase-like, structural genomics, joint C structural genomics, JCSG; HET: TLA; 2.60A {Burkholderia pseudomallei} Back     alignment and structure
>1fg7_A Histidinol phosphate aminotransferase; HISC, histidine biosynthesis, pyridoxal PH montreal-kingston bacterial structural genomics initiative; HET: PMP; 1.50A {Escherichia coli} SCOP: c.67.1.1 PDB: 1fg3_A* 1gew_A* 1gex_A* 1gey_A* 1iji_A* Back     alignment and structure
>3dyd_A Tyrosine aminotransferase; PLP, SGC, structural genomics, structural genomics consortium, disease mutation, phenylalani catabolism; HET: PLP; 2.30A {Homo sapiens} PDB: 3pdx_A* Back     alignment and structure
>2o0r_A RV0858C (N-succinyldiaminopimelate aminotransfera; PLP-binding enzyme, lysine biosynthesis, aminotransferase, S genomics; HET: LLP; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1u08_A Hypothetical aminotransferase YBDL; alpha beta protein; HET: PLP; 2.35A {Escherichia coli} SCOP: c.67.1.1 Back     alignment and structure
>3ezs_A Aminotransferase ASPB; NP_207418.1, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 2.19A {Helicobacter pylori 26695} SCOP: c.67.1.0 Back     alignment and structure
>1d2f_A MALY protein; aminotransferase fold, large PLP-binding domain, small C-TER domain, open alpha-beta structure., transferase; HET: PLP; 2.50A {Escherichia coli} SCOP: c.67.1.3 Back     alignment and structure
>3p1t_A Putative histidinol-phosphate aminotransferase; PLP-dependent transferase-like, structural genomics, joint C structural genomics, JCSG; HET: TLA; 2.60A {Burkholderia pseudomallei} Back     alignment and structure
>3op7_A Aminotransferase class I and II; PLP-dependent transferase, structural genomics, joint center structural genomics, JCSG; HET: LLP UNL; 1.70A {Streptococcus suis 89} PDB: 3p6k_A* Back     alignment and structure
>1ajs_A Aspartate aminotransferase; PIG, in the presence of ligand 2-methylaspartate; HET: LLP PLA; 1.60A {Sus scrofa} SCOP: c.67.1.1 PDB: 1ajr_A* 3ii0_A* 1aat_A 2cst_A* Back     alignment and structure
>2z61_A Probable aspartate aminotransferase 2; amino acid aminotransferase, kynurenine aminotransferase, MJ0684, cytoplasm; HET: LLP; 2.20A {Methanococcus jannaschii} Back     alignment and structure
>1s0a_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; fold type I, subclass II, homodimer; HET: LLP; 1.71A {Escherichia coli} SCOP: c.67.1.4 PDB: 1qj5_A* 1mlz_A* 1qj3_A* 1mly_A* 1s06_A* 1s08_A* 1s09_A* 1s07_A* 1mgv_A* 1dty_A* Back     alignment and structure
>2eh6_A Acoat, acetylornithine aminotransferase; ARGD, structural genomics, NPPSFA, national project on prote structural and functional analyses; HET: PLP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>3ele_A Amino transferase; RER070207001803, structural genomics, JOI for structural genomics, JCSG; HET: MSE PLP; 2.10A {Eubacterium rectale} Back     alignment and structure
>1pff_A Methionine gamma-lyase; homocysteine; 2.50A {Trichomonas vaginalis} SCOP: c.67.1.3 Back     alignment and structure
>2ctz_A O-acetyl-L-homoserine sulfhydrylase; crystal, O-acetyl homoserine sulfhydrase, structural genomic structural genomics/proteomics initiative; HET: PLP; 2.60A {Thermus thermophilus} SCOP: c.67.1.3 Back     alignment and structure
>3hdo_A Histidinol-phosphate aminotransferase; PSI-II, histidinol-phosphate aminotrans structural genomics, protein structure initiative; 1.61A {Geobacter metallireducens gs-15} Back     alignment and structure
>1b5p_A Protein (aspartate aminotransferase); pyridoxal enzyme; HET: PLP; 1.80A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1gck_A* 1b5o_A* 5bj4_A* 1gc4_A* 1gc3_A* 1bkg_A* 5bj3_A* 1bjw_A* Back     alignment and structure
>3ruy_A Ornithine aminotransferase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha and beta protein; HET: LLP; 2.65A {Bacillus anthracis} SCOP: c.67.1.0 Back     alignment and structure
>2ord_A Acoat, acetylornithine aminotransferase; TM1785, acetylornithine aminotransferase (EC 2.6.1.11) (ACOA structural genomics; HET: MSE PLP; 1.40A {Thermotoga maritima MSB8} PDB: 2e54_A* Back     alignment and structure
>3h7f_A Serine hydroxymethyltransferase 1; cytoplasm, one-carbon metabolism, pyridoxal phosphate, structural genomics; HET: LLP; 1.50A {Mycobacterium tuberculosis} Back     alignment and structure
>3ez1_A Aminotransferase MOCR family; YP_604413.1, struct genomics, joint center for structural genomics, JCSG; 2.60A {Deinococcus geothermalis dsm 11300} Back     alignment and structure
>2x5f_A Aspartate_tyrosine_phenylalanine pyridoxal-5' phosphate-dependent aminotransferase...; HET: PLP EPE; 1.80A {Staphylococcus aureus} Back     alignment and structure
>3hdo_A Histidinol-phosphate aminotransferase; PSI-II, histidinol-phosphate aminotrans structural genomics, protein structure initiative; 1.61A {Geobacter metallireducens gs-15} Back     alignment and structure
>2q7w_A Aspartate aminotransferase; mechanism-based inhibitor, PLP, sadta, PH dependence; HET: KST PSZ PMP GOL; 1.40A {Escherichia coli} SCOP: c.67.1.1 PDB: 2qa3_A* 2qb2_A* 2qb3_A* 2qbt_A* 3qn6_A* 3pa9_A* 1aaw_A* 1amq_A* 1ams_A* 1arg_A* 1amr_A* 1art_A* 1asa_A* 1asd_A* 1ase_A* 1asl_A* 1asm_A* 1asn_A* 1c9c_A* 1cq6_A* ... Back     alignment and structure
>3g7q_A Valine-pyruvate aminotransferase; NP_462565.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 1.80A {Salmonella typhimurium} Back     alignment and structure
>1yiz_A Kynurenine aminotransferase; glutamine transaminase; kynurenic acid, mosquito, PLP-enzyme, pyridoxal phosphate, PLP; HET: LLP; 1.55A {Aedes aegypti} SCOP: c.67.1.1 PDB: 1yiy_A* 2r5c_A* 2r5e_A* Back     alignment and structure
>1sff_A 4-aminobutyrate aminotransferase; enzyme complexes; HET: IK2; 1.90A {Escherichia coli} SCOP: c.67.1.4 PDB: 1sf2_A* 1szk_A* 1szu_A* 1szs_A* Back     alignment and structure
>2dou_A Probable N-succinyldiaminopimelate aminotransfera; PLP-dependent enzyme, structural genomics, NPPSFA; HET: EPE; 2.30A {Thermus thermophilus} Back     alignment and structure
>7aat_A Aspartate aminotransferase; transferase(aminotransferase); HET: PLP; 1.90A {Gallus gallus} SCOP: c.67.1.1 PDB: 1ivr_A* 1map_A* 1maq_A* 1oxo_A* 1oxp_A* 1ama_A* 1tas_A* 1tat_A* 1tar_A* 8aat_A* 9aat_A* 1aka_A* 1akb_A* 1akc_A* 3pd6_A* 3hlm_A* 3pdb_A* Back     alignment and structure
>1qgn_A Protein (cystathionine gamma-synthase); methionine biosynthesis, pyridoxal 5'-phosphate, gamma-famil; HET: PLP; 2.90A {Nicotiana tabacum} SCOP: c.67.1.3 PDB: 1i41_A* 1i48_A* 1i43_A* Back     alignment and structure
>2x5d_A Probable aminotransferase; HET: LLP PLP; 2.25A {Pseudomonas aeruginosa} Back     alignment and structure
>1s0a_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; fold type I, subclass II, homodimer; HET: LLP; 1.71A {Escherichia coli} SCOP: c.67.1.4 PDB: 1qj5_A* 1mlz_A* 1qj3_A* 1mly_A* 1s06_A* 1s08_A* 1s09_A* 1s07_A* 1mgv_A* 1dty_A* Back     alignment and structure
>2ord_A Acoat, acetylornithine aminotransferase; TM1785, acetylornithine aminotransferase (EC 2.6.1.11) (ACOA structural genomics; HET: MSE PLP; 1.40A {Thermotoga maritima MSB8} PDB: 2e54_A* Back     alignment and structure
>1vef_A Acetylornithine/acetyl-lysine aminotransferase; PLP, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: PLP; 1.35A {Thermus thermophilus} SCOP: c.67.1.4 PDB: 1wkg_A* 1wkh_A* Back     alignment and structure
>2x5f_A Aspartate_tyrosine_phenylalanine pyridoxal-5' phosphate-dependent aminotransferase...; HET: PLP EPE; 1.80A {Staphylococcus aureus} Back     alignment and structure
>3fkd_A L-threonine-O-3-phosphate decarboxylase; structural genomic, , structural genomics, PSI-2, protein structure initiative; 2.50A {Porphyromonas gingivalis} Back     alignment and structure
>1sff_A 4-aminobutyrate aminotransferase; enzyme complexes; HET: IK2; 1.90A {Escherichia coli} SCOP: c.67.1.4 PDB: 1sf2_A* 1szk_A* 1szu_A* 1szs_A* Back     alignment and structure
>3dxv_A Alpha-amino-epsilon-caprolactam racemase; fold-TYPE1, pyridoxal-5'-phosphate dependent racemase, pyrid phosphate, isomerase; HET: PLP; 2.21A {Achromobacter obae} PDB: 2zuk_A* 3dxw_A* Back     alignment and structure
>3fkd_A L-threonine-O-3-phosphate decarboxylase; structural genomic, , structural genomics, PSI-2, protein structure initiative; 2.50A {Porphyromonas gingivalis} Back     alignment and structure
>1lc5_A COBD, L-threonine-O-3-phosphate decarboxylase; PLP-dependent decarboxylase cobalamin, lyase; 1.46A {Salmonella enterica} SCOP: c.67.1.1 PDB: 1lc7_A* 1lc8_A* 1lkc_A* Back     alignment and structure
>3qgu_A LL-diaminopimelate aminotransferase; L-lysine, pyridoxal-5' phosphate, chamydomonas reinhardtii; HET: GOL; 1.55A {Chlamydomonas reinhardtii} Back     alignment and structure
>2o1b_A Aminotransferase, class I; aminotrasferase; HET: PLP; 1.95A {Staphylococcus aureus} Back     alignment and structure
>2aeu_A Hypothetical protein MJ0158; selenocysteine synthase, PLP, pyridoxal phosphate, HOMO- oligomerization, unknown function; 1.70A {Methanocaldococcus jannaschii} SCOP: c.67.1.8 PDB: 2aev_A* Back     alignment and structure
>3tcm_A Alanine aminotransferase 2; pyridoxal phosphate (PLP)-binding; HET: DCS; 2.71A {Hordeum vulgare} Back     alignment and structure
>2r2n_A Kynurenine/alpha-aminoadipate aminotransferase mitochondrial; alpha & beta protein, PLP-dependent transferase, aminotransf mitochondrion; HET: PMP KYN; 1.95A {Homo sapiens} PDB: 2qlr_A* 3dc1_A* 3ue8_A* 2vgz_A* 2xh1_A* Back     alignment and structure
>4adb_A Succinylornithine transaminase; transferase, PLP enzymes, aminotransferase; HET: PLP; 2.20A {Escherichia coli} PDB: 4adc_A* 4add_A* 4ade_A Back     alignment and structure
>4adb_A Succinylornithine transaminase; transferase, PLP enzymes, aminotransferase; HET: PLP; 2.20A {Escherichia coli} PDB: 4adc_A* 4add_A* 4ade_A Back     alignment and structure
>3ez1_A Aminotransferase MOCR family; YP_604413.1, struct genomics, joint center for structural genomics, JCSG; 2.60A {Deinococcus geothermalis dsm 11300} Back     alignment and structure
>1e5e_A MGL, methionine gamma-lyase; methionine biosynthesis, PLP-dependent enzymes, C-S gamma lyase; HET: PPJ; 2.18A {Trichomonas vaginalis} SCOP: c.67.1.3 PDB: 1e5f_A* Back     alignment and structure
>2eo5_A 419AA long hypothetical aminotransferase; PLP enzyme, structural genomics, NPPSFA, N project on protein structural and functional analyses; HET: PLP; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3fvs_A Kynurenine--oxoglutarate transaminase 1; alpha beta protein, PLP dependent protein, aminotransferase, pyridoxal phosphate, transferase; HET: LLP; 1.50A {Homo sapiens} SCOP: c.67.1.1 PDB: 3fvu_A* 3fvx_A* 1w7l_A* 1w7m_A* 1w7n_A* Back     alignment and structure
>2eh6_A Acoat, acetylornithine aminotransferase; ARGD, structural genomics, NPPSFA, national project on prote structural and functional analyses; HET: PLP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>3hmu_A Aminotransferase, class III; structural genomics, pyridoxal phosphate, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi} Back     alignment and structure
>3ppl_A Aspartate aminotransferase; dimer, PLP-dependent transferase-like fold structural genomics, joint center for structural genomics; HET: MSE PLP UNL; 1.25A {Corynebacterium glutamicum} Back     alignment and structure
>2pb2_A Acetylornithine/succinyldiaminopimelate aminotran; ARGD, pyridoxal 5'-phosphate, arginine metabolism, lysine biosynthesis, gabaculine; HET: PLP; 1.91A {Salmonella typhimurium} PDB: 2pb0_A* Back     alignment and structure
>1z7d_A Ornithine aminotransferase; structural genomics consortium, SGC, malaria; 2.10A {Plasmodium yoelii yoelii} SCOP: c.67.1.4 PDB: 3lg0_A 3ntj_A Back     alignment and structure
>3rq1_A Aminotransferase class I and II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta structure, cytosol; HET: AKG GOL; 2.20A {Veillonella parvula} Back     alignment and structure
>3ezs_A Aminotransferase ASPB; NP_207418.1, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 2.19A {Helicobacter pylori 26695} SCOP: c.67.1.0 Back     alignment and structure
>2pb2_A Acetylornithine/succinyldiaminopimelate aminotran; ARGD, pyridoxal 5'-phosphate, arginine metabolism, lysine biosynthesis, gabaculine; HET: PLP; 1.91A {Salmonella typhimurium} PDB: 2pb0_A* Back     alignment and structure
>3acz_A Methionine gamma-lyase; L-methionine; HET: LLP; 1.97A {Entamoeba histolytica} PDB: 3aej_A* 3ael_A* 3aem_A* 3aen_A* 3aeo_A* 3aep_A* Back     alignment and structure
>2eo5_A 419AA long hypothetical aminotransferase; PLP enzyme, structural genomics, NPPSFA, N project on protein structural and functional analyses; HET: PLP; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2r2n_A Kynurenine/alpha-aminoadipate aminotransferase mitochondrial; alpha & beta protein, PLP-dependent transferase, aminotransf mitochondrion; HET: PMP KYN; 1.95A {Homo sapiens} PDB: 2qlr_A* 3dc1_A* 3ue8_A* 2vgz_A* 2xh1_A* Back     alignment and structure
>1n8p_A Cystathionine gamma-lyase; three open alpha/beta structures; HET: PLP; 2.60A {Saccharomyces cerevisiae} SCOP: c.67.1.3 Back     alignment and structure
>3ruy_A Ornithine aminotransferase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha and beta protein; HET: LLP; 2.65A {Bacillus anthracis} SCOP: c.67.1.0 Back     alignment and structure
>3jtx_A Aminotransferase; NP_283882.1, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; HET: LLP MES; 1.91A {Neisseria meningitidis Z2491} Back     alignment and structure
>3ou5_A Serine hydroxymethyltransferase, mitochondrial; structural genomics, STRU genomics consortium, SGC; 2.04A {Homo sapiens} Back     alignment and structure
>3nx3_A Acoat, acetylornithine aminotransferase; csgid, structural genomics, center for structural genomics O infectious diseases; 1.80A {Campylobacter jejuni subsp} Back     alignment and structure
>3ppl_A Aspartate aminotransferase; dimer, PLP-dependent transferase-like fold structural genomics, joint center for structural genomics; HET: MSE PLP UNL; 1.25A {Corynebacterium glutamicum} Back     alignment and structure
>3nx3_A Acoat, acetylornithine aminotransferase; csgid, structural genomics, center for structural genomics O infectious diseases; 1.80A {Campylobacter jejuni subsp} Back     alignment and structure
>2ay1_A Aroat, aromatic amino acid aminotransferase; HET: PLP AHC; 2.20A {Paracoccus denitrificans} SCOP: c.67.1.1 PDB: 1ay5_A* 1ay4_A* 1ay8_A* 2ay2_A* 2ay3_A* 2ay4_A* 2ay5_A* 2ay6_A* 2ay7_A* 2ay8_A* 2ay9_A* Back     alignment and structure
>3i4j_A Aminotransferase, class III; structural GENOMICS,NYSGXRC, target 11246C, deino radiodurans, pyridoxal phosphate, transfe PSI-2; 1.70A {Deinococcus radiodurans} Back     alignment and structure
>2fq6_A Cystathionine beta-lyase; protein-inhibitor complex, PLP cofactor covalently bound to inhibitor; HET: P3F; 1.78A {Escherichia coli} SCOP: c.67.1.3 PDB: 2gqn_A* 1cl1_A* 1cl2_A* Back     alignment and structure
>2oat_A Ornithine aminotransferase; 5-fluoromethylornithine, PLP-dependent ENZ pyridoxal phosphate; HET: PFM; 1.95A {Homo sapiens} SCOP: c.67.1.4 PDB: 1oat_A* 2byj_A* 2byl_A* 1gbn_A* 2can_A* Back     alignment and structure
>3rq1_A Aminotransferase class I and II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta structure, cytosol; HET: AKG GOL; 2.20A {Veillonella parvula} Back     alignment and structure
>2oat_A Ornithine aminotransferase; 5-fluoromethylornithine, PLP-dependent ENZ pyridoxal phosphate; HET: PFM; 1.95A {Homo sapiens} SCOP: c.67.1.4 PDB: 1oat_A* 2byj_A* 2byl_A* 1gbn_A* 2can_A* Back     alignment and structure
>1uu1_A Histidinol-phosphate aminotransferase; histidine biosynthesis, pyridoxal phosphate, complete proteome; HET: PMP HSA; 2.38A {Thermotoga maritima} SCOP: c.67.1.1 PDB: 1uu0_A 1h1c_A* 1uu2_A* 2f8j_A* Back     alignment and structure
>3nnk_A Ureidoglycine-glyoxylate aminotransferase; PLP-dependent; HET: LLP; 2.58A {Klebsiella pneumoniae} Back     alignment and structure
>3n75_A LDC, lysine decarboxylase, inducible; pyridoxal-5'-phosphate dependent decarboxylase, acid stress stringent response; HET: LLP G4P P6G; 2.00A {Escherichia coli} PDB: 3q16_A* Back     alignment and structure
>3b1d_A Betac-S lyase; HET: PLP PLS EPE; 1.66A {Streptococcus anginosus} PDB: 3b1c_A* 3b1e_A* Back     alignment and structure
>3dxv_A Alpha-amino-epsilon-caprolactam racemase; fold-TYPE1, pyridoxal-5'-phosphate dependent racemase, pyrid phosphate, isomerase; HET: PLP; 2.21A {Achromobacter obae} PDB: 2zuk_A* 3dxw_A* Back     alignment and structure
>3i4j_A Aminotransferase, class III; structural GENOMICS,NYSGXRC, target 11246C, deino radiodurans, pyridoxal phosphate, transfe PSI-2; 1.70A {Deinococcus radiodurans} Back     alignment and structure
>3d6k_A Putative aminotransferase; APC82464, corynebacterium diphthe structural genomics, PSI-2, protein structure initiative; 2.00A {Corynebacterium diphtheriae} Back     alignment and structure
>3a8u_X Omega-amino acid--pyruvate aminotransferase; large pleated sheet, transaminase, pyridox phosphate; HET: PLP; 1.40A {Pseudomonas putida} Back     alignment and structure
>3cog_A Cystathionine gamma-lyase; CTH, PLP, propargylglycine, SGC, inhibitor, structural genom stockholm, structural genomics consortium; HET: PLP; 2.00A {Homo sapiens} PDB: 2nmp_A* 3elp_B Back     alignment and structure
>3e2y_A Kynurenine-oxoglutarate transaminase 3; alpha beta protein, PLP dependent protein, aminotransferase, pyridoxal phosphate, transferase; HET: GLN PMP; 2.26A {Mus musculus} SCOP: c.67.1.0 PDB: 2zjg_A* 3e2f_A* 3e2z_A* Back     alignment and structure
>3ri6_A O-acetylhomoserine sulfhydrylase; PYR 5'-phosphate, gamma-elimination, direct sulfhydrylation, CY metabolism, protein thiocarboxylate, TR; 2.20A {Wolinella succinogenes} Back     alignment and structure
>3ei9_A LL-diaminopimelate aminotransferase; lysine biosynthesis, pyridoxal 5' phosphat external aldimine, chloroplast, pyridox phosphate; HET: PL6; 1.55A {Arabidopsis thaliana} PDB: 3ei8_A* 3eib_A* 3ei6_A* 2z1z_A* 3ei5_A* 2z20_A* 3ei7_A 3eia_A* Back     alignment and structure
>3b46_A Aminotransferase BNA3; kynurenine aminotransferase, LLP, PLP, cytoplasm, mitochondrion, pyridoxal phosphate; HET: LLP; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3a8u_X Omega-amino acid--pyruvate aminotransferase; large pleated sheet, transaminase, pyridox phosphate; HET: PLP; 1.40A {Pseudomonas putida} Back     alignment and structure
>1z7d_A Ornithine aminotransferase; structural genomics consortium, SGC, malaria; 2.10A {Plasmodium yoelii yoelii} SCOP: c.67.1.4 PDB: 3lg0_A 3ntj_A Back     alignment and structure
>3ndn_A O-succinylhomoserine sulfhydrylase; seattle structural genomics center for infectious disease, S mycobacterium, PLP, schiff base; HET: LLP; 1.85A {Mycobacterium tuberculosis} Back     alignment and structure
>4hvk_A Probable cysteine desulfurase 2; transferase and ISCS, transferase; HET: PMP PG4; 1.43A {Archaeoglobus fulgidus} PDB: 4eb7_A* 4eb5_A* Back     alignment and structure
>1ibj_A CBL, cystathionine beta-lyase; PLP-dependent enzyme, methionine biosynthesis, transsulfurat lyase; HET: PLP; 2.30A {Arabidopsis thaliana} SCOP: c.67.1.3 Back     alignment and structure
>3gju_A Putative aminotransferase; pyridoxal phosphate, PLP-dependent transferase-like fold, ST genomics, joint center for structural genomics, JCSG; HET: MSE LLP PLP; 1.55A {Mesorhizobium loti} PDB: 3fcr_A* Back     alignment and structure
>3dod_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, biotin biosynthesis, pyridoxal phosphate, adenosyl-L-methionine; HET: PLP; 1.90A {Bacillus subtilis} SCOP: c.67.1.0 PDB: 3drd_A 3du4_A* Back     alignment and structure
>3f6t_A Aspartate aminotransferase; YP_194538.1, STRU genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: LLP; 2.15A {Lactobacillus acidophilus ncfm} Back     alignment and structure
>1uu1_A Histidinol-phosphate aminotransferase; histidine biosynthesis, pyridoxal phosphate, complete proteome; HET: PMP HSA; 2.38A {Thermotoga maritima} SCOP: c.67.1.1 PDB: 1uu0_A 1h1c_A* 1uu2_A* 2f8j_A* Back     alignment and structure
>3tfu_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; transferase, transferase-transferase inhibitor complex; HET: PL8; 1.94A {Mycobacterium tuberculosis} PDB: 3tft_A* 3bv0_A* 3lv2_A* Back     alignment and structure
>3i5t_A Aminotransferase; pyridoxal 5'-phosphate, PSI-2, NYSGXRC, ST genomics, protein structure initiative; HET: PLP; 2.00A {Rhodobacter sphaeroides 2} Back     alignment and structure
>1zod_A DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, cesium, lyase; HET: MES PLP; 1.80A {Burkholderia cepacia} SCOP: c.67.1.4 PDB: 1dka_A* 1m0o_A* 1m0p_A* 1m0n_A* 1zc9_A* 1zob_A* 1m0q_A* 2dkb_A* 1dgd_A* 1dge_A* 1d7u_A* 1d7s_A* 1d7r_A* 1d7v_A* 1z3z_A* Back     alignment and structure
>3ihj_A Alanine aminotransferase 2; helix, structural genomics, structural genomics consortium, pyridoxal phosphate; HET: PLP; 2.30A {Homo sapiens} Back     alignment and structure
>4eu1_A Mitochondrial aspartate aminotransferase; ssgcid, structural genomics, SEA structural genomics center for infectious disease; HET: LLP; 2.30A {Trypanosoma brucei} Back     alignment and structure
>3zrp_A Serine-pyruvate aminotransferase (AGXT); HET: PLP; 1.75A {Sulfolobus solfataricus} PDB: 3zrq_A* 3zrr_A* Back     alignment and structure
>3l44_A Glutamate-1-semialdehyde 2,1-aminomutase 1; alpha beta class, PLP-dependent transferase-like, bacillus A csgid, porphyrin biosynthesis; HET: LLP; 2.05A {Bacillus anthracis} SCOP: c.67.1.0 Back     alignment and structure
>2dr1_A PH1308 protein, 386AA long hypothetical serine aminotransferase; PLP, structural genomics, NPPSFA; HET: PLP; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>4e77_A Glutamate-1-semialdehyde 2,1-aminomutase; structural genomics, center for structural genomics of infec diseases, csgid, porphyrin biosynthesis; 2.00A {Yersinia pestis} Back     alignment and structure
>3fq8_A Glutamate-1-semialdehyde 2,1-aminomutase; drug resistance, microev0lution, integrated approach, chlorophyll biosynthesis; HET: PMP; 2.00A {Synechococcus elongatus pcc 6301} SCOP: c.67.1.4 PDB: 2hp1_A* 2hoz_A* 2hoy_A* 2hp2_A* 3fq7_A* 3usf_A* 2gsa_A* 3gsb_A* 4gsa_A* 3fqa_A* 2cfb_A* Back     alignment and structure
>3d6k_A Putative aminotransferase; APC82464, corynebacterium diphthe structural genomics, PSI-2, protein structure initiative; 2.00A {Corynebacterium diphtheriae} Back     alignment and structure
>3k28_A Glutamate-1-semialdehyde 2,1-aminomutase 2; biosynthesis of cofactors, prosthetic groups, and carriers, csgid, cytoplasm, isomerase; HET: MSE PLP; 1.95A {Bacillus anthracis str} SCOP: c.67.1.4 PDB: 3bs8_A* Back     alignment and structure
>2cjg_A L-lysine-epsilon aminotransferase; internal aldimine, pyridoxal phosphate, PLP, RV3290C, lysine amino transferase; HET: PMP; 1.95A {Mycobacterium tuberculosis} PDB: 2cjd_A* 2cin_A* 2cjh_A* 2jjg_A* 2jje_A* 2jjh_A* 2jjf_A Back     alignment and structure
>3n5m_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, csgid; 2.05A {Bacillus anthracis} Back     alignment and structure
>3n5m_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, csgid; 2.05A {Bacillus anthracis} Back     alignment and structure
>3oks_A 4-aminobutyrate transaminase; ssgcid, transferase, seattle structural genomics center for infectious disease; HET: LLP; 1.80A {Mycobacterium smegmatis} PDB: 3r4t_A* 3q8n_A Back     alignment and structure
>3nmy_A Xometc, cystathionine gamma-lyase-like protein; Cys-Met metabolism PLP-dependent enzyme family, CYST gamma lyase, pyridoxal-phosphate; HET: PLP; 2.07A {Xanthomonas oryzae PV} SCOP: c.67.1.0 PDB: 3e6g_A* 3nnp_A* Back     alignment and structure
>4a6r_A Omega transaminase; transferase, PLP-binding enzyme, transaminase fold type I; HET: TA8; 1.35A {Chromobacterium violaceum} PDB: 4a6t_A* 4a6u_A 4a72_A* 4ah3_A* Back     alignment and structure
>2cy8_A D-phgat, D-phenylglycine aminotransferase; structural genomics, NPPSFA, national PROJ protein structural and functional analyses; 2.30A {Pseudomonas stutzeri} Back     alignment and structure
>3dod_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, biotin biosynthesis, pyridoxal phosphate, adenosyl-L-methionine; HET: PLP; 1.90A {Bacillus subtilis} SCOP: c.67.1.0 PDB: 3drd_A 3du4_A* Back     alignment and structure
>3oks_A 4-aminobutyrate transaminase; ssgcid, transferase, seattle structural genomics center for infectious disease; HET: LLP; 1.80A {Mycobacterium smegmatis} PDB: 3r4t_A* 3q8n_A Back     alignment and structure
>3tfu_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; transferase, transferase-transferase inhibitor complex; HET: PL8; 1.94A {Mycobacterium tuberculosis} PDB: 3tft_A* 3bv0_A* 3lv2_A* Back     alignment and structure
>3qgu_A LL-diaminopimelate aminotransferase; L-lysine, pyridoxal-5' phosphate, chamydomonas reinhardtii; HET: GOL; 1.55A {Chlamydomonas reinhardtii} Back     alignment and structure
>3fsl_A Aromatic-amino-acid aminotransferase; tyrosine aminotransferase, pyridoxal phosphate, internal ALD schiff base, amino-acid biosynthesis; HET: PLR; 2.35A {Escherichia coli k-12} SCOP: c.67.1.1 PDB: 3tat_A* Back     alignment and structure
>3asa_A LL-diaminopimelate aminotransferase; PLP dependent aminotransferase; 2.05A {Chlamydia trachomatis} PDB: 3asb_A* Back     alignment and structure
>7aat_A Aspartate aminotransferase; transferase(aminotransferase); HET: PLP; 1.90A {Gallus gallus} SCOP: c.67.1.1 PDB: 1ivr_A* 1map_A* 1maq_A* 1oxo_A* 1oxp_A* 1ama_A* 1tas_A* 1tat_A* 1tar_A* 8aat_A* 9aat_A* 1aka_A* 1akb_A* 1akc_A* 3pd6_A* 3hlm_A* 3pdb_A* Back     alignment and structure
>4ffc_A 4-aminobutyrate aminotransferase (GABT); structural genomics, niaid, national institute of allergy AN infectious diseases; HET: LLP; 1.80A {Mycobacterium abscessus} Back     alignment and structure
>3l44_A Glutamate-1-semialdehyde 2,1-aminomutase 1; alpha beta class, PLP-dependent transferase-like, bacillus A csgid, porphyrin biosynthesis; HET: LLP; 2.05A {Bacillus anthracis} SCOP: c.67.1.0 Back     alignment and structure
>2ay1_A Aroat, aromatic amino acid aminotransferase; HET: PLP AHC; 2.20A {Paracoccus denitrificans} SCOP: c.67.1.1 PDB: 1ay5_A* 1ay4_A* 1ay8_A* 2ay2_A* 2ay3_A* 2ay4_A* 2ay5_A* 2ay6_A* 2ay7_A* 2ay8_A* 2ay9_A* Back     alignment and structure
>3b1d_A Betac-S lyase; HET: PLP PLS EPE; 1.66A {Streptococcus anginosus} PDB: 3b1c_A* 3b1e_A* Back     alignment and structure
>1zod_A DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, cesium, lyase; HET: MES PLP; 1.80A {Burkholderia cepacia} SCOP: c.67.1.4 PDB: 1dka_A* 1m0o_A* 1m0p_A* 1m0n_A* 1zc9_A* 1zob_A* 1m0q_A* 2dkb_A* 1dgd_A* 1dge_A* 1d7u_A* 1d7s_A* 1d7r_A* 1d7v_A* 1z3z_A* Back     alignment and structure
>2epj_A Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzyme, GSA, structural genomics, NPPSFA; HET: PMP; 1.70A {Aeropyrum pernix} PDB: 2zsl_A* 2zsm_A* Back     alignment and structure
>4ffc_A 4-aminobutyrate aminotransferase (GABT); structural genomics, niaid, national institute of allergy AN infectious diseases; HET: LLP; 1.80A {Mycobacterium abscessus} Back     alignment and structure
>2cjg_A L-lysine-epsilon aminotransferase; internal aldimine, pyridoxal phosphate, PLP, RV3290C, lysine amino transferase; HET: PMP; 1.95A {Mycobacterium tuberculosis} PDB: 2cjd_A* 2cin_A* 2cjh_A* 2jjg_A* 2jje_A* 2jjh_A* 2jjf_A Back     alignment and structure
>3k28_A Glutamate-1-semialdehyde 2,1-aminomutase 2; biosynthesis of cofactors, prosthetic groups, and carriers, csgid, cytoplasm, isomerase; HET: MSE PLP; 1.95A {Bacillus anthracis str} SCOP: c.67.1.4 PDB: 3bs8_A* Back     alignment and structure
>3qm2_A Phosphoserine aminotransferase; structural genomics, center for structural genomics of infec diseases, csgid; 2.25A {Salmonella enterica subsp} PDB: 1bjn_A* 1bjo_A* 3qbo_A* Back     alignment and structure
>4f4e_A Aromatic-amino-acid aminotransferase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: LLP; 1.80A {Burkholderia pseudomallei} PDB: 4eff_A* Back     alignment and structure
>3i16_A Aluminum resistance protein; YP_878183.1, carbon-sulfur lyase involved in aluminum resist structural genomics; HET: MSE TLA PLP; 2.00A {Clostridium novyi} PDB: 3gwp_A* Back     alignment and structure
>3f6t_A Aspartate aminotransferase; YP_194538.1, STRU genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: LLP; 2.15A {Lactobacillus acidophilus ncfm} Back     alignment and structure
>3ei9_A LL-diaminopimelate aminotransferase; lysine biosynthesis, pyridoxal 5' phosphat external aldimine, chloroplast, pyridox phosphate; HET: PL6; 1.55A {Arabidopsis thaliana} PDB: 3ei8_A* 3eib_A* 3ei6_A* 2z1z_A* 3ei5_A* 2z20_A* 3ei7_A 3eia_A* Back     alignment and structure
>4e77_A Glutamate-1-semialdehyde 2,1-aminomutase; structural genomics, center for structural genomics of infec diseases, csgid, porphyrin biosynthesis; 2.00A {Yersinia pestis} Back     alignment and structure
>1ajs_A Aspartate aminotransferase; PIG, in the presence of ligand 2-methylaspartate; HET: LLP PLA; 1.60A {Sus scrofa} SCOP: c.67.1.1 PDB: 1ajr_A* 3ii0_A* 1aat_A 2cst_A* Back     alignment and structure
>3hmu_A Aminotransferase, class III; structural genomics, pyridoxal phosphate, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi} Back     alignment and structure
>1iug_A Putative aspartate aminotransferase; wild type, pyridoxal-5'-phosphate form, riken structural genomics/proteomics initiative, RSGI; HET: LLP; 2.20A {Thermus thermophilus} SCOP: c.67.1.3 Back     alignment and structure
>3fq8_A Glutamate-1-semialdehyde 2,1-aminomutase; drug resistance, microev0lution, integrated approach, chlorophyll biosynthesis; HET: PMP; 2.00A {Synechococcus elongatus pcc 6301} SCOP: c.67.1.4 PDB: 2hp1_A* 2hoz_A* 2hoy_A* 2hp2_A* 3fq7_A* 3usf_A* 2gsa_A* 3gsb_A* 4gsa_A* 3fqa_A* 2cfb_A* Back     alignment and structure
>2q7w_A Aspartate aminotransferase; mechanism-based inhibitor, PLP, sadta, PH dependence; HET: KST PSZ PMP GOL; 1.40A {Escherichia coli} SCOP: c.67.1.1 PDB: 2qa3_A* 2qb2_A* 2qb3_A* 2qbt_A* 3qn6_A* 3pa9_A* 1aaw_A* 1amq_A* 1ams_A* 1arg_A* 1amr_A* 1art_A* 1asa_A* 1asd_A* 1ase_A* 1asl_A* 1asm_A* 1asn_A* 1c9c_A* 1cq6_A* ... Back     alignment and structure
>1t3i_A Probable cysteine desulfurase; PLP-binding enzyme, transferase; HET: 2OS PLP; 1.80A {Synechocystis SP} SCOP: c.67.1.3 Back     alignment and structure
>3jzl_A Putative cystathionine beta-lyase involved in ALU resistance; putative cystathionine beta-lyase involved in aluminum resis structural genomics; HET: LLP; 1.91A {Listeria monocytogenes str} PDB: 3fd0_A* Back     alignment and structure
>2e7u_A Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzyme, GSA, structural genomics, NPPSFA; HET: PMP; 1.90A {Thermus thermophilus} Back     alignment and structure
>1ohv_A 4-aminobutyrate aminotransferase; PLP-dependent enzyme, 4- AMIN acid, antiepileptic drug target; HET: PLP; 2.3A {Sus scrofa} SCOP: c.67.1.4 PDB: 1ohw_A* 1ohy_A* Back     alignment and structure
>3ht4_A Aluminum resistance protein; lyase, putative cystathionine BEAT-lyase, aluminium resistance protein, Q81A77_baccr, NESG, BCR213; 2.90A {Bacillus cereus atcc 14579} Back     alignment and structure
>3meb_A Aspartate aminotransferase; pyridoxal PHOS transferase, structural genomics, seattle structural genomi for infectious disease, ssgcid; HET: PLP; 1.90A {Giardia lamblia} Back     alignment and structure
>3ou5_A Serine hydroxymethyltransferase, mitochondrial; structural genomics, STRU genomics consortium, SGC; 2.04A {Homo sapiens} Back     alignment and structure
>3i5t_A Aminotransferase; pyridoxal 5'-phosphate, PSI-2, NYSGXRC, ST genomics, protein structure initiative; HET: PLP; 2.00A {Rhodobacter sphaeroides 2} Back     alignment and structure
>2epj_A Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzyme, GSA, structural genomics, NPPSFA; HET: PMP; 1.70A {Aeropyrum pernix} PDB: 2zsl_A* 2zsm_A* Back     alignment and structure
>3asa_A LL-diaminopimelate aminotransferase; PLP dependent aminotransferase; 2.05A {Chlamydia trachomatis} PDB: 3asb_A* Back     alignment and structure
>3gju_A Putative aminotransferase; pyridoxal phosphate, PLP-dependent transferase-like fold, ST genomics, joint center for structural genomics, JCSG; HET: MSE LLP PLP; 1.55A {Mesorhizobium loti} PDB: 3fcr_A* Back     alignment and structure
>2cy8_A D-phgat, D-phenylglycine aminotransferase; structural genomics, NPPSFA, national PROJ protein structural and functional analyses; 2.30A {Pseudomonas stutzeri} Back     alignment and structure
>3hvy_A Cystathionine beta-lyase family protein, YNBB B.S ortholog; NP_348457.1, putative cystathionine beta-lyase involved in A resistance; HET: LLP MSE; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>4a6r_A Omega transaminase; transferase, PLP-binding enzyme, transaminase fold type I; HET: TA8; 1.35A {Chromobacterium violaceum} PDB: 4a6t_A* 4a6u_A 4a72_A* 4ah3_A* Back     alignment and structure
>1kmj_A Selenocysteine lyase; persulfide perselenide NIFS pyridoxal phosphate, structural PSI, protein structure initiative; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.3 PDB: 1i29_A* 1jf9_A* 1kmk_A* 1c0n_A* Back     alignment and structure
>3ffr_A Phosphoserine aminotransferase SERC; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: LLP MSE P33; 1.75A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>1yaa_A Aspartate aminotransferase; HET: PLP; 2.05A {Saccharomyces cerevisiae} SCOP: c.67.1.1 Back     alignment and structure
>2aeu_A Hypothetical protein MJ0158; selenocysteine synthase, PLP, pyridoxal phosphate, HOMO- oligomerization, unknown function; 1.70A {Methanocaldococcus jannaschii} SCOP: c.67.1.8 PDB: 2aev_A* Back     alignment and structure
>4ao9_A Beta-phenylalanine aminotransferase; HET: PLP; 1.50A {Variovorax paradoxus} PDB: 4aoa_A* Back     alignment and structure
>4eu1_A Mitochondrial aspartate aminotransferase; ssgcid, structural genomics, SEA structural genomics center for infectious disease; HET: LLP; 2.30A {Trypanosoma brucei} Back     alignment and structure
>2e7u_A Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzyme, GSA, structural genomics, NPPSFA; HET: PMP; 1.90A {Thermus thermophilus} Back     alignment and structure
>1ohv_A 4-aminobutyrate aminotransferase; PLP-dependent enzyme, 4- AMIN acid, antiepileptic drug target; HET: PLP; 2.3A {Sus scrofa} SCOP: c.67.1.4 PDB: 1ohw_A* 1ohy_A* Back     alignment and structure
>2hox_A ALLIIN lyase 1; cysteine sulphoxide lyase, ALLIINASE; HET: NAG FUC BMA P1T; 1.40A {Allium sativum} SCOP: c.67.1.1 PDB: 2hor_A* 1lk9_A* Back     alignment and structure
>3bwn_A AT1G70560, L-tryptophan aminotransferase; auxin synthesis, pyridoxal-5'- phosphate, indole-3-pyruvate; HET: LLP PMP PHE; 2.25A {Arabidopsis thaliana} PDB: 3bwo_A* Back     alignment and structure
>4atq_A 4-aminobutyrate transaminase; transferase; HET: PLP; 2.75A {Arthrobacter aurescens} PDB: 4atp_A* Back     alignment and structure
>4ao9_A Beta-phenylalanine aminotransferase; HET: PLP; 1.50A {Variovorax paradoxus} PDB: 4aoa_A* Back     alignment and structure
>4e3q_A Pyruvate transaminase; aminotransferase, transferase; HET: PMP; 1.90A {Vibrio fluvialis} PDB: 4e3r_A* 3nui_A Back     alignment and structure
>3k7y_A Aspartate aminotransferase; aminotrans pyridoxal phosphate; HET: PLP; 2.80A {Plasmodium falciparum} SCOP: c.67.1.0 Back     alignment and structure
>2yky_A Beta-transaminase; transferase; HET: PLP SFE; 1.69A {Mesorhizobium SP} PDB: 2ykv_A* 2yku_A* 2ykx_A* Back     alignment and structure
>3tqx_A 2-amino-3-ketobutyrate coenzyme A ligase; energy metabolism, transferase; HET: PLP; 2.30A {Coxiella burnetii} Back     alignment and structure
>2w8t_A SPT, serine palmitoyltransferase; HET: LLP; 1.25A {Sphingomonas paucimobilis} PDB: 2w8u_A* 2w8w_A* 2xbn_A* 2w8j_A* 2w8v_A* 2jg2_A* 2jgt_A 2x8u_A* Back     alignment and structure
>2zy4_A L-aspartate beta-decarboxylase; pyridoxal 5'-phosphate, aminotransferase, lyase; HET: PLP; 2.00A {Alcaligenes faecalis subsp} PDB: 2zy3_A* 2zy5_A* 3fdd_A* 2zy2_A* Back     alignment and structure
>3bwn_A AT1G70560, L-tryptophan aminotransferase; auxin synthesis, pyridoxal-5'- phosphate, indole-3-pyruvate; HET: LLP PMP PHE; 2.25A {Arabidopsis thaliana} PDB: 3bwo_A* Back     alignment and structure
>3aow_A Putative uncharacterized protein PH0207; protein-PLP-AKG triple complex, schiff-base linkage, kynuren aminotransferase; HET: PLP AKG; 1.56A {Pyrococcus horikoshii} PDB: 3aov_A* 3ath_A* 3av7_A* 1x0m_A 1wst_A* Back     alignment and structure
>2zy4_A L-aspartate beta-decarboxylase; pyridoxal 5'-phosphate, aminotransferase, lyase; HET: PLP; 2.00A {Alcaligenes faecalis subsp} PDB: 2zy3_A* 2zy5_A* 3fdd_A* 2zy2_A* Back     alignment and structure
>4atq_A 4-aminobutyrate transaminase; transferase; HET: PLP; 2.75A {Arthrobacter aurescens} PDB: 4atp_A* Back     alignment and structure
>2yky_A Beta-transaminase; transferase; HET: PLP SFE; 1.69A {Mesorhizobium SP} PDB: 2ykv_A* 2yku_A* 2ykx_A* Back     alignment and structure
>4h51_A Aspartate aminotransferase; ssgcid, structural genomics, seattle struc genomics center for infectious disease, aspartate aminotran transferase; HET: LLP; 1.85A {Leishmania major} Back     alignment and structure
>2hox_A ALLIIN lyase 1; cysteine sulphoxide lyase, ALLIINASE; HET: NAG FUC BMA P1T; 1.40A {Allium sativum} SCOP: c.67.1.1 PDB: 2hor_A* 1lk9_A* Back     alignment and structure
>4e3q_A Pyruvate transaminase; aminotransferase, transferase; HET: PMP; 1.90A {Vibrio fluvialis} PDB: 4e3r_A* 3nui_A Back     alignment and structure
>4a0g_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; BIO3-BIO1, biotin synthesis; HET: PLP; 2.50A {Arabidopsis thaliana} PDB: 4a0h_A* 4a0r_A* 4a0f_A* Back     alignment and structure
>3if2_A Aminotransferase; YP_265399.1, structura genomics, joint center for structural genomics, JCSG, prote structure initiative, PSI-2; HET: PLP; 2.50A {Psychrobacter arcticus 273-4} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 891
d1js3a_476 c.67.1.6 (A:) DOPA decarboxylase {Pig (Sus scrofa) 4e-50
d1js3a_476 c.67.1.6 (A:) DOPA decarboxylase {Pig (Sus scrofa) 5e-42
d1js3a_476 c.67.1.6 (A:) DOPA decarboxylase {Pig (Sus scrofa) 1e-27
d1js3a_476 c.67.1.6 (A:) DOPA decarboxylase {Pig (Sus scrofa) 7e-05
d1pmma_450 c.67.1.6 (A:) Glutamate decarboxylase beta, GadB { 5e-16
d1pmma_450 c.67.1.6 (A:) Glutamate decarboxylase beta, GadB { 2e-15
d1pmma_450 c.67.1.6 (A:) Glutamate decarboxylase beta, GadB { 2e-11
d2z67a1434 c.67.1.9 (A:1-434) Selenocysteinyl-tRNA synthase ( 1e-12
d2z67a1434 c.67.1.9 (A:1-434) Selenocysteinyl-tRNA synthase ( 4e-05
d2z67a1434 c.67.1.9 (A:1-434) Selenocysteinyl-tRNA synthase ( 4e-05
d3bc8a1445 c.67.1.9 (A:23-467) Selenocysteinyl-tRNA synthase 8e-11
d3bc8a1445 c.67.1.9 (A:23-467) Selenocysteinyl-tRNA synthase 2e-07
d3bc8a1445 c.67.1.9 (A:23-467) Selenocysteinyl-tRNA synthase 0.003
>d1js3a_ c.67.1.6 (A:) DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823]} Length = 476 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: PLP-dependent transferase-like
superfamily: PLP-dependent transferases
family: Pyridoxal-dependent decarboxylase
domain: DOPA decarboxylase
species: Pig (Sus scrofa) [TaxId: 9823]

 Score =  181 bits (461), Expect = 4e-50
 Identities = 130/327 (39%), Positives = 187/327 (57%), Gaps = 45/327 (13%)

Query: 442 IRRHCELAKLFEGKVRRDPRFEISNDVRSSASECIFVCMLAARAQAISKLKKIHPFVDEG 501
           +    ++ +L E  +  +        ++ SASE   V +LAAR + + +L+   P + +G
Sbjct: 119 MDWLGKMLQLPEAFLAGEAGEGGGV-IQGSASEATLVALLAARTKVVRRLQAASPGLTQG 177

Query: 502 VLLSKLMAYCSKEAHSCVEKAAMMAFVRLKILEPDDKNSLRGATLRQVMQQDETMGYIPF 561
            +L KL+AY S +AHS VE+A ++  V+LK +  D K ++R + L++ +++D+  G IPF
Sbjct: 178 AVLEKLVAYASDQAHSSVERAGLIGGVKLKAIPSDGKFAMRASALQEALERDKAAGLIPF 237

Query: 562 FVSTTLGTTSC------------------------------------YRKSQGIEYADSF 585
           FV  TLGTTSC                                         G+E+ADSF
Sbjct: 238 FVVATLGTTSCCSFDNLLEVGPICHEEDIWLHVDAAYAGSAFICPEFRHLLNGVEFADSF 297

Query: 586 NVNVNKWLLTAFDSSCLWVADRYKLTSALVVDPLYLQHGHEGA---IDYRHWGIPLSRRF 642
           N N +KWLL  FD S +WV  R  LT A  +DP+YL+H H+G+    DYRHW +PL RRF
Sbjct: 298 NFNPHKWLLVNFDCSAMWVKRRTDLTGAFKLDPVYLKHSHQGSGLITDYRHWQLPLGRRF 357

Query: 643 RSLKLWFVIRTYGLSGLQKYIRRHCELAKLFEGKVRRDPRFEISNDVRLGLVCFRLRSEN 702
           RSLK+WFV R YG+ GLQ YIR+H +L+  FE  V +DPRFE+  +V LGLVCFRL+  +
Sbjct: 358 RSLKMWFVFRMYGVKGLQAYIRKHVQLSHEFEAFVLQDPRFEVCAEVTLGLVCFRLKGSD 417

Query: 703 NLIADQNNRKLLEDINASGRLHMVPAS 729
            L     N  LLE IN++ ++H+VP  
Sbjct: 418 GL-----NEALLERINSARKIHLVPCR 439
>d1js3a_ c.67.1.6 (A:) DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823]} Length = 476 Back     information, alignment and structure
>d1js3a_ c.67.1.6 (A:) DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823]} Length = 476 Back     information, alignment and structure
>d1js3a_ c.67.1.6 (A:) DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823]} Length = 476 Back     information, alignment and structure
>d1pmma_ c.67.1.6 (A:) Glutamate decarboxylase beta, GadB {Escherichia coli [TaxId: 562]} Length = 450 Back     information, alignment and structure
>d1pmma_ c.67.1.6 (A:) Glutamate decarboxylase beta, GadB {Escherichia coli [TaxId: 562]} Length = 450 Back     information, alignment and structure
>d1pmma_ c.67.1.6 (A:) Glutamate decarboxylase beta, GadB {Escherichia coli [TaxId: 562]} Length = 450 Back     information, alignment and structure
>d2z67a1 c.67.1.9 (A:1-434) Selenocysteinyl-tRNA synthase (SepSecS) {Methanococcus maripaludis [TaxId: 39152]} Length = 434 Back     information, alignment and structure
>d2z67a1 c.67.1.9 (A:1-434) Selenocysteinyl-tRNA synthase (SepSecS) {Methanococcus maripaludis [TaxId: 39152]} Length = 434 Back     information, alignment and structure
>d2z67a1 c.67.1.9 (A:1-434) Selenocysteinyl-tRNA synthase (SepSecS) {Methanococcus maripaludis [TaxId: 39152]} Length = 434 Back     information, alignment and structure
>d3bc8a1 c.67.1.9 (A:23-467) Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mus musculus) [TaxId: 10090]} Length = 445 Back     information, alignment and structure
>d3bc8a1 c.67.1.9 (A:23-467) Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mus musculus) [TaxId: 10090]} Length = 445 Back     information, alignment and structure
>d3bc8a1 c.67.1.9 (A:23-467) Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mus musculus) [TaxId: 10090]} Length = 445 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query891
d1js3a_476 DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823] 100.0
d1pmma_450 Glutamate decarboxylase beta, GadB {Escherichia co 100.0
d1js3a_476 DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823] 99.95
d3bc8a1445 Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mu 99.93
d1jf9a_405 NifS-like protein/selenocysteine lyase {Escherichi 99.88
d2z67a1434 Selenocysteinyl-tRNA synthase (SepSecS) {Methanoco 99.88
d1t3ia_408 Probable cysteine desulfurase SufS {Synechocystis 99.87
d1elua_381 Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 99.8
d1pmma_450 Glutamate decarboxylase beta, GadB {Escherichia co 99.8
d3bc8a1445 Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mu 99.8
d2z67a1434 Selenocysteinyl-tRNA synthase (SepSecS) {Methanoco 99.77
d1qz9a_404 Kynureninase {Pseudomonas fluorescens [TaxId: 294] 99.75
d1eg5a_376 NifS-like protein/selenocysteine lyase {Thermotoga 99.73
d1h0ca_388 Alanine-glyoxylate aminotransferase {Human (Homo s 99.7
d1p3wa_391 Cysteine desulfurase IscS {Escherichia coli [TaxId 99.68
d2e7ja1364 Selenocysteinyl-tRNA synthase (SepSecS) {Archaeogl 99.59
d1m32a_361 2-aminoethylphosphonate transaminase {Salmonella t 99.53
d1p3wa_391 Cysteine desulfurase IscS {Escherichia coli [TaxId 99.51
d1vjoa_377 Alanine-glyoxylate aminotransferase {Cyanobacteria 99.46
d2ch1a1388 3-hydroxykynurenine transaminase {Malaria mosquito 99.4
d1c4ka2462 Ornithine decarboxylase major domain {Lactobacillu 99.38
d2e7ja1364 Selenocysteinyl-tRNA synthase (SepSecS) {Archaeogl 99.31
d2bkwa1382 Alanine-glyoxylate aminotransferase {Baker's yeast 99.3
d2bkwa1382 Alanine-glyoxylate aminotransferase {Baker's yeast 99.28
d1v72a1345 Phenylserine aldolase PSALD {Pseudomonas putida [T 99.24
d1v72a1345 Phenylserine aldolase PSALD {Pseudomonas putida [T 99.04
d1fc4a_401 2-amino-3-ketobutyrate CoA ligase {Escherichia col 98.91
d1iuga_348 Subgroup IV putative aspartate aminotransferase {T 98.87
d1c4ka2462 Ornithine decarboxylase major domain {Lactobacillu 98.81
d1wyua1437 Glycine dehydrogenase (decarboxylating) subunit 1 98.8
d1bs0a_383 PLP-dependent acyl-CoA synthase (8-amino-7-oxonano 98.79
d1mdoa_376 Aminotransferase ArnB {Salmonella typhimurium [Tax 98.79
d1svva_340 Low-specificity threonine aldolase {Leishmania maj 98.78
d2v1pa1467 Tryptophan indol-lyase (tryptophanase) {Escherichi 98.76
d1wyub1471 Glycine dehydrogenase subunit 2 (P-protein) {Therm 98.74
d1bjna_360 Phosphoserine aminotransferase, PSAT {Escherichia 98.74
d1w23a_360 Phosphoserine aminotransferase, PSAT {Bacillus alc 98.71
d1m6sa_343 Low-specificity threonine aldolase {Thermotoga mar 98.67
d1c7ga_456 Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 5 98.65
d1dfoa_416 Serine hydroxymethyltransferase {Escherichia coli 98.65
d1jf9a_405 NifS-like protein/selenocysteine lyase {Escherichi 98.61
d1wyua1437 Glycine dehydrogenase (decarboxylating) subunit 1 98.6
d1kl1a_405 Serine hydroxymethyltransferase {Bacillus stearoth 98.59
d1eg5a_376 NifS-like protein/selenocysteine lyase {Thermotoga 98.57
d1ax4a_465 Tryptophan indol-lyase (tryptophanase) {Proteus vu 98.56
d1ax4a_465 Tryptophan indol-lyase (tryptophanase) {Proteus vu 98.55
d2v1pa1467 Tryptophan indol-lyase (tryptophanase) {Escherichi 98.49
d1svva_340 Low-specificity threonine aldolase {Leishmania maj 98.44
d2c0ra1361 Phosphoserine aminotransferase, PSAT {Bacillus cir 98.44
d1b9ha_384 3-amino-5-hydroxybenzoic acid synthase (AHBA synth 98.43
d1mdoa_376 Aminotransferase ArnB {Salmonella typhimurium [Tax 98.42
d1elua_381 Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 98.41
d1rv3a_470 Serine hydroxymethyltransferase {Rabbit (Oryctolag 98.4
d1t3ia_408 Probable cysteine desulfurase SufS {Synechocystis 98.4
d1wyub1471 Glycine dehydrogenase subunit 2 (P-protein) {Therm 98.33
d2a7va1463 Serine hydroxymethyltransferase {Human (Homo sapie 98.31
d2bwna1396 5-aminolevulinate synthase {Rhodobacter capsulatus 98.28
d2fnua1371 Spore coat polysaccharide biosynthesis protein C { 98.2
d1bjna_360 Phosphoserine aminotransferase, PSAT {Escherichia 98.12
d1m6sa_343 Low-specificity threonine aldolase {Thermotoga mar 98.11
d2bwna1396 5-aminolevulinate synthase {Rhodobacter capsulatus 98.07
d2c0ra1361 Phosphoserine aminotransferase, PSAT {Bacillus cir 98.05
d1fg7a_354 Histidinol-phosphate aminotransferase HisC {Escher 98.03
d1qz9a_404 Kynureninase {Pseudomonas fluorescens [TaxId: 294] 98.01
d2aeua1366 Hypothetical protein MJ0158 {Archaeon Methanococcu 97.99
d1dfoa_416 Serine hydroxymethyltransferase {Escherichia coli 97.97
d1kl1a_405 Serine hydroxymethyltransferase {Bacillus stearoth 97.92
d1c7ga_456 Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 5 97.92
d1b9ha_384 3-amino-5-hydroxybenzoic acid synthase (AHBA synth 97.84
d1d2fa_361 Modulator in mal gene expression, MalY {Escherichi 97.79
d2fnua1371 Spore coat polysaccharide biosynthesis protein C { 97.77
d1iaya_428 1-aminocyclopropane-1-carboxylate synthase (ACC sy 97.76
d1o69a_374 Aminotransferase homolog WlaK (PglE, Cj1121c) {Cam 97.74
d1rv3a_470 Serine hydroxymethyltransferase {Rabbit (Oryctolag 97.73
d1j32a_388 Aspartate aminotransferase, AAT {Phormidium lapide 97.72
d1m7ya_431 1-aminocyclopropane-1-carboxylate synthase (ACC sy 97.69
d1v2da_368 Glutamine aminotransferase {Thermus thermophilus [ 97.65
d1gc0a_392 Methionine gamma-lyase, MGL {Pseudomonas putida [T 97.61
d1bw0a_412 Tyrosine aminotransferase (TAT) {Trypanosoma cruzi 97.52
d1y4ia1397 Methionine gamma-lyase, MGL {Citrobacter freundii 97.5
d1vp4a_420 Putative aminotransferase TM1131 {Thermotoga marit 97.45
d1h0ca_388 Alanine-glyoxylate aminotransferase {Human (Homo s 97.45
d1iaya_428 1-aminocyclopropane-1-carboxylate synthase (ACC sy 97.43
d1gdea_388 Aromatic aminoacid aminotransferase, AroAT {Archae 97.43
d1v2da_368 Glutamine aminotransferase {Thermus thermophilus [ 97.4
d1d2fa_361 Modulator in mal gene expression, MalY {Escherichi 97.34
d2aeua1366 Hypothetical protein MJ0158 {Archaeon Methanococcu 97.31
d1j32a_388 Aspartate aminotransferase, AAT {Phormidium lapide 97.29
d2a7va1463 Serine hydroxymethyltransferase {Human (Homo sapie 97.29
d1m32a_361 2-aminoethylphosphonate transaminase {Salmonella t 97.29
d1cs1a_384 Cystathionine gamma-synthase, CGS {Escherichia col 97.22
d1wsta1403 Multiple substrate aminotransferase, MSAT {Thermoc 97.19
d1gdea_388 Aromatic aminoacid aminotransferase, AroAT {Archae 97.17
d1b5pa_382 Aspartate aminotransferase, AAT {Thermus thermophi 97.16
d1ibja_380 Cystathionine beta-lyase, CBL {Thale cress (Arabid 97.15
d1lc5a_355 L-threonine-O-3-phosphate decarboxylase CobD {Salm 97.15
d1m7ya_431 1-aminocyclopropane-1-carboxylate synthase (ACC sy 97.14
d1lc5a_355 L-threonine-O-3-phosphate decarboxylase CobD {Salm 97.02
d2ch1a1388 3-hydroxykynurenine transaminase {Malaria mosquito 96.98
d1vp4a_420 Putative aminotransferase TM1131 {Thermotoga marit 96.97
d1xi9a_395 Putative alanine aminotransferase {Pyrococcus furi 96.95
d1b5pa_382 Aspartate aminotransferase, AAT {Thermus thermophi 96.91
d1vjoa_377 Alanine-glyoxylate aminotransferase {Cyanobacteria 96.89
d1wsta1403 Multiple substrate aminotransferase, MSAT {Thermoc 96.89
d1o69a_374 Aminotransferase homolog WlaK (PglE, Cj1121c) {Cam 96.86
d1c7na_394 Cystalysin {Treponema denticola [TaxId: 158]} 96.82
d1bw0a_412 Tyrosine aminotransferase (TAT) {Trypanosoma cruzi 96.8
d1qgna_398 Cystathionine gamma-synthase, CGS {Common tobacco 96.63
d1sffa_425 4-aminobutyrate aminotransferase, GABA-aminotransf 96.58
d1pffa_331 Methionine gamma-lyase, MGL {Trichomonas vaginalis 96.52
d1cl1a_391 Cystathionine beta-lyase, CBL {Escherichia coli [T 96.43
d1e5ea_394 Methionine gamma-lyase, MGL {Trichomonas vaginalis 96.41
d1fg7a_354 Histidinol-phosphate aminotransferase HisC {Escher 96.26
d1c7na_394 Cystalysin {Treponema denticola [TaxId: 158]} 96.19
d1xi9a_395 Putative alanine aminotransferase {Pyrococcus furi 96.16
d1vefa1387 Acetylornithine/acetyl-lysine aminotransferase Arg 96.14
d2f8ja1334 Histidinol-phosphate aminotransferase HisC {Thermo 96.13
d2gb3a1389 AAT homologue TM1698 {Thermotoga maritima [TaxId: 96.13
d2gb3a1389 AAT homologue TM1698 {Thermotoga maritima [TaxId: 96.07
d1z7da1404 Ornithine aminotransferase {Plasmodium yoelii yoel 96.05
d2ctza1421 O-acetyl-L-homoserine sulfhydrylase {Thermus therm 96.0
d1s0aa_429 Adenosylmethionine-8-amino-7-oxononanoate aminotra 95.93
d2byla1404 Ornithine aminotransferase {Human (Homo sapiens) [ 95.8
d1e5ea_394 Methionine gamma-lyase, MGL {Trichomonas vaginalis 95.78
d2r5ea1418 Kynurenine--oxoglutarate transaminase I {Yellowfev 95.7
d7aata_401 Aspartate aminotransferase, AAT {Chicken (Gallus g 95.61
d1ohwa_461 4-aminobutyrate aminotransferase, GABA-aminotransf 95.3
d1cs1a_384 Cystathionine gamma-synthase, CGS {Escherichia col 95.3
d1o4sa_375 Aspartate aminotransferase, AAT {Thermotoga mariti 95.23
d1y4ia1397 Methionine gamma-lyase, MGL {Citrobacter freundii 95.17
d1qgna_398 Cystathionine gamma-synthase, CGS {Common tobacco 95.1
d1n8pa_393 Cystathionine gamma-lyase (CYS3) {Baker's yeast (S 95.03
d1u08a_382 Putative methionine aminotransferase YdbL {Escheri 94.99
d1pffa_331 Methionine gamma-lyase, MGL {Trichomonas vaginalis 94.89
d1u08a_382 Putative methionine aminotransferase YdbL {Escheri 94.88
d2q7wa1396 Aspartate aminotransferase, AAT {Escherichia coli 94.87
d1zoda1431 Dialkylglycine decarboxylase {Pseudomonas cepacia 94.84
d2ay1a_394 Aromatic aminoacid aminotransferase, AroAT {Paraco 94.55
d1gc0a_392 Methionine gamma-lyase, MGL {Pseudomonas putida [T 94.54
d1w7la_418 Kynurenine--oxoglutarate transaminase I {Human (Ho 94.5
d1ibja_380 Cystathionine beta-lyase, CBL {Thale cress (Arabid 94.23
d2r5ea1418 Kynurenine--oxoglutarate transaminase I {Yellowfev 93.91
d1cl1a_391 Cystathionine beta-lyase, CBL {Escherichia coli [T 93.74
d1o4sa_375 Aspartate aminotransferase, AAT {Thermotoga mariti 93.55
d2byla1404 Ornithine aminotransferase {Human (Homo sapiens) [ 93.11
d1yaaa_412 Aspartate aminotransferase, AAT {Baker's yeast (Sa 92.5
d3tata_397 Aromatic aminoacid aminotransferase, AroAT {Escher 92.06
d1n8pa_393 Cystathionine gamma-lyase (CYS3) {Baker's yeast (S 91.94
d1vefa1387 Acetylornithine/acetyl-lysine aminotransferase Arg 91.9
d1ajsa_412 Aspartate aminotransferase, AAT {Pig (Sus scrofa), 90.96
d2ctza1421 O-acetyl-L-homoserine sulfhydrylase {Thermus therm 90.73
d1w7la_418 Kynurenine--oxoglutarate transaminase I {Human (Ho 88.75
d1fc4a_401 2-amino-3-ketobutyrate CoA ligase {Escherichia col 88.44
d2f8ja1334 Histidinol-phosphate aminotransferase HisC {Thermo 88.31
d1iuga_348 Subgroup IV putative aspartate aminotransferase {T 87.11
d2gsaa_427 Glutamate-1-semialdehyde aminomutase (aminotransfe 85.55
d1sffa_425 4-aminobutyrate aminotransferase, GABA-aminotransf 85.4
d1z7da1404 Ornithine aminotransferase {Plasmodium yoelii yoel 80.07
>d1js3a_ c.67.1.6 (A:) DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: PLP-dependent transferase-like
superfamily: PLP-dependent transferases
family: Pyridoxal-dependent decarboxylase
domain: DOPA decarboxylase
species: Pig (Sus scrofa) [TaxId: 9823]

Probab=100.00  E-value=7.3e-66  Score=594.67  Aligned_cols=405  Identities=49%  Similarity=0.913  Sum_probs=343.8

Q ss_pred             hhhHhhccCCCCCCccccccCCCCCCHHHHHHHHHHHhcCCCCCccccChhHHHHHHHHHHHHHHHcCCCCCCCCCC-CC
Q psy852            4 LFHFLSHQVTHWQHPRFHAYFPSGNSYPSVLADMLSDAIGCIGFSWAASPSCTELETIVLDWLGKAIGLPEKFLMYP-PQ   82 (891)
Q Consensus         4 ~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~l~~~~n~~~~~~~~~p~~~~~E~~~~~~l~~l~g~~~~~~~~~-~~   82 (891)
                      |.+.|+|+++||+||||++|++++.++++++|+++++++|+|+.+|+.||++++||+++++||++|+|||+++.... ..
T Consensus        60 ~~~~i~~~~~~~~~P~f~~~~~~~~~~~~~l~~~~~~~~n~n~~~~~~sp~~t~iE~~v~~wl~~l~g~p~~~~~~~~~~  139 (476)
T d1js3a_          60 VEKIIMPGVTHWHSPYFFAYFPTASSYPAMLADMLCGAIGCIGFSWAASPACTELETVMMDWLGKMLQLPEAFLAGEAGE  139 (476)
T ss_dssp             HHHTTGGGCCCTTSTTBCSSSCCCCCHHHHHHHHHHHHHCCCCSSGGGCHHHHHHHHHHHHHHHHHTTCCGGGCCTTTCS
T ss_pred             HHHHHhCCCCCCCCCCeeEeCCCCCCHHHHHHHHHHHhhcccccchhhhhhHHHHHHHHHHHHHHHhCCCcccccCCCCC
Confidence            55678999999999999999999999999999999999999999999999999999999999999999998764321 11


Q ss_pred             CCCCCCCCCccccccccCCCCCCCCcccchhHHHHHHHHHHHHhccc-----cCCccccccccCCeEEEecCCCChHHHH
Q psy852           83 GKNATTPNDIDMNIEDYMTPANQPQSLGGGVIQSVQNIIVLTRGQKK-----IHPFVDEGVLLSKLMAYCSKEAHSCVEK  157 (891)
Q Consensus        83 ~~g~~tp~~~~~~~~~~~t~~~~~~~~~gGt~~~~~~~~~~ar~~~~-----~~~~~~~g~~~~~~~v~~S~~~H~Sv~k  157 (891)
                      +.                     |.+++|||. +|+..+.+||++..     ..+...++...+++++|+|+++|||+.|
T Consensus       140 ~~---------------------G~~~~Ggs~-anl~al~~AR~~~~~~~~~~~~g~~~~~~~~~~vv~~s~~~H~Si~k  197 (476)
T d1js3a_         140 GG---------------------GVIQGSASE-ATLVALLAARTKVVRRLQAASPGLTQGAVLEKLVAYASDQAHSSVER  197 (476)
T ss_dssp             CE---------------------EEEESCHHH-HHHHHHHHHHHHHHHHHHHHSTTCCHHHHHHHEEEEEETTCCHHHHH
T ss_pred             CC---------------------ceECCcHHH-HHHHHHHHHHHHHHHhhcccccCcccccccCceEEEecccccHHHHH
Confidence            11                     224678875 67778888887631     1222333344578999999999999999


Q ss_pred             HHHHcCCeEEEEecCCCCcccHHHHHHHHHhhhhcCCcceEEEeecccCccccccCHHHHHHHHHHcCCceeeeccccCC
Q psy852          158 AAMMAFVRLKILEPDDKNSLRGATLRQVMQQDETMGYIPFFVSTTLGTTSCCSFDNLAEIGPVAKEFDVWLHVDGAYAGS  237 (891)
Q Consensus       158 aa~~~~~~v~~V~~d~~g~id~~~L~~~l~~~~~~g~~p~~V~~t~Gtt~~GavDpl~~I~~i~~~~~~~lHvDaA~GG~  237 (891)
                      ++.+.|..++.||+|++|+||+++|+++|++++++|..|++|++|+|||++|++|||++|+++|++|++|+||||||||+
T Consensus       198 a~~~lGl~~~~v~~d~~~~md~~~L~~~i~~~~~~g~~p~~VvataGtt~~G~iDpl~~I~~i~~~~~~wlHVDAA~Gg~  277 (476)
T d1js3a_         198 AGLIGGVKLKAIPSDGKFAMRASALQEALERDKAAGLIPFFVVATLGTTSCCSFDNLLEVGPICHEEDIWLHVDAAYAGS  277 (476)
T ss_dssp             HHHHHTCEEEEECCCTTSCCCHHHHHHHHHHHHHTTCEEEEEEEEBSCTTTCCBCCHHHHHHHHHHTTCEEEEECTTGGG
T ss_pred             HHHhcCceEEEeccCCCCCcCHHHHHHHHHHHHhcCCCcEEEeecCCCccceeeccHHHHHHHHHhcCcEEEEecccchh
Confidence            99888888999999999999999999999999999999999999999999999999999999999998877777777776


Q ss_pred             ccccCCCCccCCCCcccccCCCCcccccCCCCcchhHHHHhhhhHHHHHhhhcccCCccchhhHHHHhhhhhcccccccc
Q psy852          238 SFICPEFRPFMNGKTSFDNLHLSPIWYERPSSASECIFVCMLSARAQAISKLKKIHPFVDEGVLLSKLMAYCSKEAHSCV  317 (891)
Q Consensus       238 ~~~~~~~~~~~~g~~~~d~~~~s~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  317 (891)
                      .++++                                                                           
T Consensus       278 ~~~~~---------------------------------------------------------------------------  282 (476)
T d1js3a_         278 AFICP---------------------------------------------------------------------------  282 (476)
T ss_dssp             GGGST---------------------------------------------------------------------------
T ss_pred             hhhhc---------------------------------------------------------------------------
Confidence            65543                                                                           


Q ss_pred             ccccccccccccccceEEEeeccccCccccCccccccccCCCcccEEEEeCCCcCCccCCceEEEEeccccchhhcccCc
Q psy852          318 ETRGHIQSYRDAIFDVWLHVDGAYAGSSFICPEFRPFMNGIEYADSFNVNVNKWLLTAFDSSCLWVADRYKLTSALVVDP  397 (891)
Q Consensus       318 ~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~~~~~~~gi~~~ds~~~~~HK~~~~p~~~g~~~~r~~~~~~~~~~~~~  397 (891)
                                                      +.+++++|++.||||++|+|||+++||+||++++|++..+..++...+
T Consensus       283 --------------------------------~~~~~~~gi~~aDSit~d~HK~l~~P~~~g~~l~r~~~~~~~~~~~~~  330 (476)
T d1js3a_         283 --------------------------------EFRHLLNGVEFADSFNFNPHKWLLVNFDCSAMWVKRRTDLTGAFKLDP  330 (476)
T ss_dssp             --------------------------------TTGGGGTTGGGCSEEEECHHHHSSCCSSCEEEEESCHHHHHGGGC---
T ss_pred             --------------------------------chhhhhcCCcccceeeecCccccccCCcceeecccchHHHHHHHhcCh
Confidence                                            444667888899999999999999999999999999877665554444


Q ss_pred             cccCCCCCCcccccccccCCCCChhHHHHHHHHHHhcHHHHHHHHHHHHHHHHHHHHhhccCCccccccCCCCCcchhHH
Q psy852          398 LYLQHGHEGAIDYRHWGIPLSRRFRSLKLWFVIRTYGLSGLQKYIRRHCELAKLFEGKVRRDPRFEISNDVRSSASECIF  477 (891)
Q Consensus       398 ~y~~~~~~~~~~~~~~~~~~sr~~~~l~~w~~l~~~g~~G~~~ii~~~lelAr~l~~~L~~~~~~eVv~~itsggsean~  477 (891)
                      .|+.....                                                                        
T Consensus       331 ~~~~~~~~------------------------------------------------------------------------  338 (476)
T d1js3a_         331 VYLKHSHQ------------------------------------------------------------------------  338 (476)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             hhhccccc------------------------------------------------------------------------
Confidence            44432100                                                                        


Q ss_pred             HHHHHHHHHHHHhhhccCccccccccccceEEEecccchHHHHHHHHHcCceEEEecCCCCCCcCHHHHHHHHHhhhhcC
Q psy852          478 VCMLAARAQAISKLKKIHPFVDEGVLLSKLMAYCSKEAHSCVEKAAMMAFVRLKILEPDDKNSLRGATLRQVMQQDETMG  557 (891)
Q Consensus       478 ~al~aAR~~~~~~~~~~~~~~~~g~~~~~~vI~~S~~aH~Sv~Kaa~l~gv~v~~Vp~d~~G~mD~~~Le~aI~~d~~~g  557 (891)
                                                                                                      
T Consensus       339 --------------------------------------------------------------------------------  338 (476)
T d1js3a_         339 --------------------------------------------------------------------------------  338 (476)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             CccEEEEecCCccchhhhhcCCCCccEEEEcCcccCCcccccEEEEEeCCccchhhhccCCCccccCCCCCccccCCccc
Q psy852          558 YIPFFVSTTLGTTSCYRKSQGIEYADSFNVNVNKWLLTAFDSSCLWVADRYKLTSALVVDPLYLQHGHEGAIDYRHWGIP  637 (891)
Q Consensus       558 ~ip~~VvataGTT~c~~~ldGi~~aDSIs~d~HK~L~~P~g~G~llvR~~~~L~~~l~~~~~Yl~~~~e~~~~~~~~ti~  637 (891)
                                                                                        +....+++.+++++
T Consensus       339 ------------------------------------------------------------------~~~~~~~~~~~~~~  352 (476)
T d1js3a_         339 ------------------------------------------------------------------GSGLITDYRHWQLP  352 (476)
T ss_dssp             -------------------------------------------------------------------CCSCCCGGGSSSC
T ss_pred             ------------------------------------------------------------------cccccccccccccc
Confidence                                                                              00022345678999


Q ss_pred             ccccccchHHHHHHHHHHHhhHHHHHHHHHHHHHHHHHHhccCCCcEEeCCCceeEEEEEecCCcchhhhhhHHHHHHHH
Q psy852          638 LSRRFRSLKLWFVIRTYGLSGLQKYIRRHCELAKLFEGKVRRDPRFEISNDVRLGLVCFRLRSENNLIADQNNRKLLEDI  717 (891)
Q Consensus       638 ~SRr~~aL~lW~~L~~lG~~G~~~~i~~~~~lA~~L~~~L~~~~~~eil~~~~~~iV~Fr~~~~~~~~~d~ln~~L~~~L  717 (891)
                      +||+++++++|++|+.+|.+||++++++.+++|++|.+.|++.|+||++.+|.+++||||+++.     |.+|+++.++|
T Consensus       353 ~sr~~~al~lw~~l~~~G~~g~~~~i~~~~~lA~~l~~~l~~~~~fel~~~p~l~iV~Fr~~~~-----d~~n~~l~~~l  427 (476)
T d1js3a_         353 LGRRFRSLKMWFVFRMYGVKGLQAYIRKHVQLSHEFEAFVLQDPRFEVCAEVTLGLVCFRLKGS-----DGLNEALLERI  427 (476)
T ss_dssp             SCCCCTHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCTTEEECSCCCSSEEEEEESSC-----HHHHHHHHHHH
T ss_pred             cchhhHHHHHHHHHHHHhHhHHHHHHHHHHHHHHHHHHHHhcCCCeEEECCCceEEEEEEccCC-----hHHHHHHHHHH
Confidence            9999999999999999999999999999999999999999999999999999999999999876     78999999999


Q ss_pred             HhCCcEEEeeccccCCeEE-EEec-CCCCHHHHHHHHHHHHHHHH
Q psy852          718 NASGRLHMVPASQEQNDEV-FELQ-ERKRKDDLAYKRSFFVRMLG  760 (891)
Q Consensus       718 ~~~G~~~~s~s~~~g~~~l-~sv~-~~tT~edId~li~~L~ei~~  760 (891)
                      +++|.+|++++.++++.++ +++. +.||++|||.+++.|++++.
T Consensus       428 ~~~G~~~~s~t~~~g~~~lR~~i~n~~Tt~~did~~~~~i~~~a~  472 (476)
T d1js3a_         428 NSARKIHLVPCRLRGQFVLRFAICSRKVESGHVRLAWEHIRGLAA  472 (476)
T ss_dssp             HHHTSCBCEEEEETTEEEEEEECCCTTCCHHHHHHHHHHHHHHHH
T ss_pred             HhcCCEEEeeeeECCEEEEEEEeCCCCCCHHHHHHHHHHHHHHHH
Confidence            9999999999999999999 8865 67999999999999999985
>d1pmma_ c.67.1.6 (A:) Glutamate decarboxylase beta, GadB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1js3a_ c.67.1.6 (A:) DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d3bc8a1 c.67.1.9 (A:23-467) Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jf9a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2z67a1 c.67.1.9 (A:1-434) Selenocysteinyl-tRNA synthase (SepSecS) {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1t3ia_ c.67.1.3 (A:) Probable cysteine desulfurase SufS {Synechocystis sp. PCC 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1elua_ c.67.1.3 (A:) Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 1143]} Back     information, alignment and structure
>d1pmma_ c.67.1.6 (A:) Glutamate decarboxylase beta, GadB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3bc8a1 c.67.1.9 (A:23-467) Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2z67a1 c.67.1.9 (A:1-434) Selenocysteinyl-tRNA synthase (SepSecS) {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1qz9a_ c.67.1.3 (A:) Kynureninase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1eg5a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1h0ca_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p3wa_ c.67.1.3 (A:) Cysteine desulfurase IscS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2e7ja1 c.67.1.9 (A:8-371) Selenocysteinyl-tRNA synthase (SepSecS) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1m32a_ c.67.1.3 (A:) 2-aminoethylphosphonate transaminase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1p3wa_ c.67.1.3 (A:) Cysteine desulfurase IscS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vjoa_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Cyanobacteria (Nostoc sp. pcc 7120) [TaxId: 103690]} Back     information, alignment and structure
>d2ch1a1 c.67.1.3 (A:2-389) 3-hydroxykynurenine transaminase {Malaria mosquito (Anopheles gambiae) [TaxId: 7165]} Back     information, alignment and structure
>d1c4ka2 c.67.1.5 (A:108-569) Ornithine decarboxylase major domain {Lactobacillus sp., strain 30a [TaxId: 1591]} Back     information, alignment and structure
>d2e7ja1 c.67.1.9 (A:8-371) Selenocysteinyl-tRNA synthase (SepSecS) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2bkwa1 c.67.1.3 (A:3-384) Alanine-glyoxylate aminotransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2bkwa1 c.67.1.3 (A:3-384) Alanine-glyoxylate aminotransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v72a1 c.67.1.1 (A:6-350) Phenylserine aldolase PSALD {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1v72a1 c.67.1.1 (A:6-350) Phenylserine aldolase PSALD {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1fc4a_ c.67.1.4 (A:) 2-amino-3-ketobutyrate CoA ligase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iuga_ c.67.1.3 (A:) Subgroup IV putative aspartate aminotransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1c4ka2 c.67.1.5 (A:108-569) Ornithine decarboxylase major domain {Lactobacillus sp., strain 30a [TaxId: 1591]} Back     information, alignment and structure
>d1wyua1 c.67.1.7 (A:1-437) Glycine dehydrogenase (decarboxylating) subunit 1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1bs0a_ c.67.1.4 (A:) PLP-dependent acyl-CoA synthase (8-amino-7-oxonanoate synthase, AONS) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mdoa_ c.67.1.4 (A:) Aminotransferase ArnB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1svva_ c.67.1.1 (A:) Low-specificity threonine aldolase {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2v1pa1 c.67.1.2 (A:5-471) Tryptophan indol-lyase (tryptophanase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wyub1 c.67.1.7 (B:2-472) Glycine dehydrogenase subunit 2 (P-protein) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1bjna_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w23a_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Bacillus alcalophilus [TaxId: 1445]} Back     information, alignment and structure
>d1m6sa_ c.67.1.1 (A:) Low-specificity threonine aldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1c7ga_ c.67.1.2 (A:) Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 549]} Back     information, alignment and structure
>d1dfoa_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jf9a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wyua1 c.67.1.7 (A:1-437) Glycine dehydrogenase (decarboxylating) subunit 1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1kl1a_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1eg5a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ax4a_ c.67.1.2 (A:) Tryptophan indol-lyase (tryptophanase) {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d1ax4a_ c.67.1.2 (A:) Tryptophan indol-lyase (tryptophanase) {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d2v1pa1 c.67.1.2 (A:5-471) Tryptophan indol-lyase (tryptophanase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1svva_ c.67.1.1 (A:) Low-specificity threonine aldolase {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2c0ra1 c.67.1.4 (A:2-362) Phosphoserine aminotransferase, PSAT {Bacillus circulans, subsp. alkalophilus [TaxId: 1397]} Back     information, alignment and structure
>d1b9ha_ c.67.1.4 (A:) 3-amino-5-hydroxybenzoic acid synthase (AHBA synthase) {Amycolatopsis mediterranei [TaxId: 33910]} Back     information, alignment and structure
>d1mdoa_ c.67.1.4 (A:) Aminotransferase ArnB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1elua_ c.67.1.3 (A:) Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 1143]} Back     information, alignment and structure
>d1rv3a_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1t3ia_ c.67.1.3 (A:) Probable cysteine desulfurase SufS {Synechocystis sp. PCC 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1wyub1 c.67.1.7 (B:2-472) Glycine dehydrogenase subunit 2 (P-protein) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2a7va1 c.67.1.4 (A:26-488) Serine hydroxymethyltransferase {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Back     information, alignment and structure
>d2bwna1 c.67.1.4 (A:2-397) 5-aminolevulinate synthase {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d2fnua1 c.67.1.4 (A:2-372) Spore coat polysaccharide biosynthesis protein C {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1bjna_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1m6sa_ c.67.1.1 (A:) Low-specificity threonine aldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2bwna1 c.67.1.4 (A:2-397) 5-aminolevulinate synthase {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d2c0ra1 c.67.1.4 (A:2-362) Phosphoserine aminotransferase, PSAT {Bacillus circulans, subsp. alkalophilus [TaxId: 1397]} Back     information, alignment and structure
>d1fg7a_ c.67.1.1 (A:) Histidinol-phosphate aminotransferase HisC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qz9a_ c.67.1.3 (A:) Kynureninase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d2aeua1 c.67.1.8 (A:9-374) Hypothetical protein MJ0158 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1dfoa_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kl1a_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1c7ga_ c.67.1.2 (A:) Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 549]} Back     information, alignment and structure
>d1b9ha_ c.67.1.4 (A:) 3-amino-5-hydroxybenzoic acid synthase (AHBA synthase) {Amycolatopsis mediterranei [TaxId: 33910]} Back     information, alignment and structure
>d1d2fa_ c.67.1.3 (A:) Modulator in mal gene expression, MalY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fnua1 c.67.1.4 (A:2-372) Spore coat polysaccharide biosynthesis protein C {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1iaya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Tomato (Lycopersicon esculentum) [TaxId: 4081]} Back     information, alignment and structure
>d1o69a_ c.67.1.4 (A:) Aminotransferase homolog WlaK (PglE, Cj1121c) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1rv3a_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1j32a_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1m7ya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Apple (Malus domestica) [TaxId: 3750]} Back     information, alignment and structure
>d1v2da_ c.67.1.1 (A:) Glutamine aminotransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1gc0a_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1bw0a_ c.67.1.1 (A:) Tyrosine aminotransferase (TAT) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1y4ia1 c.67.1.3 (A:2-398) Methionine gamma-lyase, MGL {Citrobacter freundii [TaxId: 546]} Back     information, alignment and structure
>d1vp4a_ c.67.1.1 (A:) Putative aminotransferase TM1131 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1h0ca_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iaya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Tomato (Lycopersicon esculentum) [TaxId: 4081]} Back     information, alignment and structure
>d1gdea_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1v2da_ c.67.1.1 (A:) Glutamine aminotransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1d2fa_ c.67.1.3 (A:) Modulator in mal gene expression, MalY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2aeua1 c.67.1.8 (A:9-374) Hypothetical protein MJ0158 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1j32a_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d2a7va1 c.67.1.4 (A:26-488) Serine hydroxymethyltransferase {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Back     information, alignment and structure
>d1m32a_ c.67.1.3 (A:) 2-aminoethylphosphonate transaminase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1cs1a_ c.67.1.3 (A:) Cystathionine gamma-synthase, CGS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wsta1 c.67.1.1 (A:13-415) Multiple substrate aminotransferase, MSAT {Thermococcus profundus [TaxId: 49899]} Back     information, alignment and structure
>d1gdea_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1b5pa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ibja_ c.67.1.3 (A:) Cystathionine beta-lyase, CBL {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1lc5a_ c.67.1.1 (A:) L-threonine-O-3-phosphate decarboxylase CobD {Salmonella enterica [TaxId: 28901]} Back     information, alignment and structure
>d1m7ya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Apple (Malus domestica) [TaxId: 3750]} Back     information, alignment and structure
>d1lc5a_ c.67.1.1 (A:) L-threonine-O-3-phosphate decarboxylase CobD {Salmonella enterica [TaxId: 28901]} Back     information, alignment and structure
>d2ch1a1 c.67.1.3 (A:2-389) 3-hydroxykynurenine transaminase {Malaria mosquito (Anopheles gambiae) [TaxId: 7165]} Back     information, alignment and structure
>d1vp4a_ c.67.1.1 (A:) Putative aminotransferase TM1131 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xi9a_ c.67.1.1 (A:) Putative alanine aminotransferase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1b5pa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1vjoa_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Cyanobacteria (Nostoc sp. pcc 7120) [TaxId: 103690]} Back     information, alignment and structure
>d1wsta1 c.67.1.1 (A:13-415) Multiple substrate aminotransferase, MSAT {Thermococcus profundus [TaxId: 49899]} Back     information, alignment and structure
>d1o69a_ c.67.1.4 (A:) Aminotransferase homolog WlaK (PglE, Cj1121c) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1c7na_ c.67.1.3 (A:) Cystalysin {Treponema denticola [TaxId: 158]} Back     information, alignment and structure
>d1bw0a_ c.67.1.1 (A:) Tyrosine aminotransferase (TAT) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1qgna_ c.67.1.3 (A:) Cystathionine gamma-synthase, CGS {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1sffa_ c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GABA-aminotransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pffa_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Trichomonas vaginalis, MGL2 [TaxId: 5722]} Back     information, alignment and structure
>d1cl1a_ c.67.1.3 (A:) Cystathionine beta-lyase, CBL {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e5ea_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Trichomonas vaginalis, MGL1 [TaxId: 5722]} Back     information, alignment and structure
>d1fg7a_ c.67.1.1 (A:) Histidinol-phosphate aminotransferase HisC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c7na_ c.67.1.3 (A:) Cystalysin {Treponema denticola [TaxId: 158]} Back     information, alignment and structure
>d1xi9a_ c.67.1.1 (A:) Putative alanine aminotransferase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1vefa1 c.67.1.4 (A:9-395) Acetylornithine/acetyl-lysine aminotransferase ArgD {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2f8ja1 c.67.1.1 (A:1-334) Histidinol-phosphate aminotransferase HisC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2gb3a1 c.67.1.1 (A:4-392) AAT homologue TM1698 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2gb3a1 c.67.1.1 (A:4-392) AAT homologue TM1698 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1z7da1 c.67.1.4 (A:7-410) Ornithine aminotransferase {Plasmodium yoelii yoelii [TaxId: 73239]} Back     information, alignment and structure
>d2ctza1 c.67.1.3 (A:1-421) O-acetyl-L-homoserine sulfhydrylase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1s0aa_ c.67.1.4 (A:) Adenosylmethionine-8-amino-7-oxononanoate aminotransferase, BioA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2byla1 c.67.1.4 (A:36-439) Ornithine aminotransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e5ea_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Trichomonas vaginalis, MGL1 [TaxId: 5722]} Back     information, alignment and structure
>d2r5ea1 c.67.1.1 (A:12-429) Kynurenine--oxoglutarate transaminase I {Yellowfever mosquito (Aedes aegypti) [TaxId: 7159]} Back     information, alignment and structure
>d7aata_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Chicken (Gallus gallus), mitochondria [TaxId: 9031]} Back     information, alignment and structure
>d1ohwa_ c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GABA-aminotransferase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1cs1a_ c.67.1.3 (A:) Cystathionine gamma-synthase, CGS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o4sa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1y4ia1 c.67.1.3 (A:2-398) Methionine gamma-lyase, MGL {Citrobacter freundii [TaxId: 546]} Back     information, alignment and structure
>d1qgna_ c.67.1.3 (A:) Cystathionine gamma-synthase, CGS {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1n8pa_ c.67.1.3 (A:) Cystathionine gamma-lyase (CYS3) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1u08a_ c.67.1.1 (A:) Putative methionine aminotransferase YdbL {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pffa_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Trichomonas vaginalis, MGL2 [TaxId: 5722]} Back     information, alignment and structure
>d1u08a_ c.67.1.1 (A:) Putative methionine aminotransferase YdbL {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2q7wa1 c.67.1.1 (A:1-396) Aspartate aminotransferase, AAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1zoda1 c.67.1.4 (A:3-433) Dialkylglycine decarboxylase {Pseudomonas cepacia [TaxId: 292]} Back     information, alignment and structure
>d2ay1a_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1gc0a_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1w7la_ c.67.1.1 (A:) Kynurenine--oxoglutarate transaminase I {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ibja_ c.67.1.3 (A:) Cystathionine beta-lyase, CBL {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2r5ea1 c.67.1.1 (A:12-429) Kynurenine--oxoglutarate transaminase I {Yellowfever mosquito (Aedes aegypti) [TaxId: 7159]} Back     information, alignment and structure
>d1cl1a_ c.67.1.3 (A:) Cystathionine beta-lyase, CBL {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o4sa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2byla1 c.67.1.4 (A:36-439) Ornithine aminotransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yaaa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Baker's yeast (Saccharomyces cerevisiae), cytosolic form [TaxId: 4932]} Back     information, alignment and structure
>d3tata_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1n8pa_ c.67.1.3 (A:) Cystathionine gamma-lyase (CYS3) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vefa1 c.67.1.4 (A:9-395) Acetylornithine/acetyl-lysine aminotransferase ArgD {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ajsa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Pig (Sus scrofa), cytosolic form [TaxId: 9823]} Back     information, alignment and structure
>d2ctza1 c.67.1.3 (A:1-421) O-acetyl-L-homoserine sulfhydrylase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1w7la_ c.67.1.1 (A:) Kynurenine--oxoglutarate transaminase I {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fc4a_ c.67.1.4 (A:) 2-amino-3-ketobutyrate CoA ligase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f8ja1 c.67.1.1 (A:1-334) Histidinol-phosphate aminotransferase HisC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1iuga_ c.67.1.3 (A:) Subgroup IV putative aspartate aminotransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2gsaa_ c.67.1.4 (A:) Glutamate-1-semialdehyde aminomutase (aminotransferase) {Synechococcus sp., strain GR6 [TaxId: 1131]} Back     information, alignment and structure
>d1sffa_ c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GABA-aminotransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z7da1 c.67.1.4 (A:7-410) Ornithine aminotransferase {Plasmodium yoelii yoelii [TaxId: 73239]} Back     information, alignment and structure