Psyllid ID: psy8544

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360----
MAYKIGINGFGRIGRLVLREALHRNTPVVGINDPHLSVDYLAYMLKYDSTHGRFKGDVKTEGNNIVVNGKKIAVFQKMKPEEIPWSQTGAEYIVESTGVFKTKDTASAHLKGGAKKVIITAPSKDAPMFVCGVNLDKYDPSHSVVSNASCTTNCLAPLAKVIHDNFEILEGLMTTVHAVTATQKTVDAPSKKMWRDGRGANQNIIPASTGAAKAVAKVIPDLEGKLTGMAFRVPVPNVSVVDLTVRLCCDVTYDEIKAKVKAASQGPMKGILGYTEDEVVSSDFNGEVCSSVFDAKAGIALNKNFVKLVTWYDNEYGYSCRVLDLIQYMKSKDTGSKPKDTGSKPKDTGSKPKDTKGTPQDACG
ccEEEEEEccccHHHHHHHHHHcccccEEEEccccccccHHEEEEcccccccccccEEEEEccEEEEccEEEEEEEcccccccccccccccEEEEcccccccHHHHHHHHcccccEEEEccccccccEEEEEcccccccccccEEEcccHHHccHHHHHHHHcccccccccHHHHHHHHccccccccccccccccccccccccccccccHHHHHHHHccccccccccEEEEEccccccEEEEEEEEccccccHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccEEEEEEEEcccccHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccc
ccEcEEEEcccHHHHHHHHHHHHccccEEEEEcccccHHHHHHHHHcccccccccccEEEEccEEEEccEEEEEEccccHHHccHHHHcccEEEEcccccccHHHHHHHHcccccEEEEccccccccEccccccHHHccccccEEEcccHHHHHHHHHHHHHHHHHcEEEEEEEEEEccccccEccccccccccHHHcEcccccEEEcccHHHHHHHHcHHHcccEEEEEEEccccccEEEEEEEEEcccccHHHHHHHHHHHHHccccccEEEEcccccHHHHccccccEEEEHHHcEEEEccEEEEEEEEcccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccc
maykigingfgRIGRLVLREAlhrntpvvgindphLSVDYLAYMLKydsthgrfkgdvktegnnivvNGKKIAVFqkmkpeeipwsqtgaEYIVEstgvfktkdtasahLKGGAKKVIItapskdapmfvcgvnldkydpshsvvsnascttnclaplakVIHDNFEILEGLMTTVHAVtatqktvdapskkmwrdgrganqniipastGAAKAVAKVIpdlegkltgmafrvpvpnvsvVDLTVRLCCDVTYDEIKAKVKAasqgpmkgilgytedevvssdfngevcssvfdakaGIALNKNFVKLVTWYDNEYGYSCRVLDLIQYMkskdtgskpkdtgskpkdtgskpkdtkgtpqdacg
maykigingfgrIGRLVLREALHRntpvvgindphLSVDYLAYMLKYDSTHGRFkgdvktegnnivvngKKIAVFQKMKpeeipwsqtgAEYIVESTGVFKTKDTASAHLKGGAKKVIITAPSKDAPMFVCGVNLDKYDPSHSVVSNASCTTNCLAPLAKVIHDNFEILEGLMTTVHAVtatqktvdapskkmwrdGRGANQNIIPASTGAAKAVAKVIPDLEGKLTGMAFRVPVPNVSVVDLTVRLCCDVTYDEIKAKvkaasqgpmkgILGYTEDEVVSSDFNGEVCSSVFDAKAGIALNKNFVKLVTWYDNEYGYSCRVLDLIQYMKskdtgskpkdtgskpkdtgskpkdtkgtpqdacg
MAYKIGINGFGRIGRLVLREALHRNTPVVGINDPHLSVDYLAYMLKYDSTHGRFKGDVKTEGNNIVVNGKKIAVFQKMKPEEIPWSQTGAEYIVESTGVFKTKDTASAHLKGGAKKVIITAPSKDAPMFVCGVNLDKYDPSHSVVSNASCTTNCLAPLAKVIHDNFEILEGLMTTVHAVTATQKTVDAPSKKMWRDGRGANQNIIPASTGAAKAVAKVIPDLEGKLTGMAFRVPVPNVSVVDLTVRLCCDVTYDEIKAKVKAASQGPMKGILGYTEDEVVSSDFNGEVCSSVFDAKAGIALNKNFVKLVTWYDNEYGYSCRVLDLIQYMKSKDTGSKPKDTGSKPKDTGSKPKDTKGTPQDACG
**YKIGINGFGRIGRLVLREALHRNTPVVGINDPHLSVDYLAYMLKYDSTHGRFKGDVKTEGNNIVVNGKKIAVFQKMKPEEIPWSQTGAEYIVESTGVFKTKDTASAHLKGGAKKVIITAPSKDAPMFVCGVNLDKYDPSHSVVSNASCTTNCLAPLAKVIHDNFEILEGLMTTVHAVTATQKTV*******W*******QNIIPASTGAAKAVAKVIPDLEGKLTGMAFRVPVPNVSVVDLTVRLCCDVTYDEIKAKVKAASQGPMKGILGYTEDEVVSSDFNGEVCSSVFDAKAGIALNKNFVKLVTWYDNEYGYSCRVLDLIQYM***********************************
MAYKIGINGFGRIGRLVLREALHRNTPVVGINDPHLSVDYLAYMLKYDSTHGRFKGDVKTEGNNIVVNGKKIAVFQKMKPEEIPWSQTGAEYIVESTGVFKTKDTASAHLKGGAKKVIITAPSKDAPMFVCGVNLDKYDPSHSVVSNASCTTNCLAPLAKVIHDNFEILEGLMTTVHAVTATQKTVDAPSKKMWRDGRGANQNIIPASTGAAKAVAKVIPDLEGKLTGMAFRVPVPNVSVVDLTVRLCCDVTYDEIKAKVKAASQGPMKGILGYTEDEVVSSDFNGEVCSSVFDAKAGIALNKNFVKLVTWYDNEYGYSCRVLDLIQYM***********************************
MAYKIGINGFGRIGRLVLREALHRNTPVVGINDPHLSVDYLAYMLKYDSTHGRFKGDVKTEGNNIVVNGKKIAVFQKMKPEEIPWSQTGAEYIVESTGVFKTKDTASAHLKGGAKKVIITAPSKDAPMFVCGVNLDKYDPSHSVVSNASCTTNCLAPLAKVIHDNFEILEGLMTTVHAVTATQKTVDAPSKKMWRDGRGANQNIIPASTGAAKAVAKVIPDLEGKLTGMAFRVPVPNVSVVDLTVRLCCDVTYDEIKAKVKAASQGPMKGILGYTEDEVVSSDFNGEVCSSVFDAKAGIALNKNFVKLVTWYDNEYGYSCRVLDLIQYMKSK********************************
*AYKIGINGFGRIGRLVLREALHRNTPVVGINDPHLSVDYLAYMLKYDSTHGRFKGDVKTEGNNIVVNGKKIAVFQKMKPEEIPWSQTGAEYIVESTGVFKTKDTASAHLKGGAKKVIITAPSKDAPMFVCGVNLDKYDPSHSVVSNASCTTNCLAPLAKVIHDNFEILEGLMTTVHAVTATQKTVDAPSKKMWRDGRGANQNIIPASTGAAKAVAKVIPDLEGKLTGMAFRVPVPNVSVVDLTVRLCCDVTYDEIKAKVKAASQGPMKGILGYTEDEVVSSDFNGEVCSSVFDAKAGIALNKNFVKLVTWYDNEYGYSCRVLDLIQYMKSKDT******************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAYKIGINGFGRIGRLVLREALHRNTPVVGINDPHLSVDYLAYMLKYDSTHGRFKGDVKTEGNNIVVNGKKIAVFQKMKPEEIPWSQTGAEYIVESTGVFKTKDTASAHLKGGAKKVIITAPSKDAPMFVCGVNLDKYDPSHSVVSNASCTTNCLAPLAKVIHDNFEILEGLMTTVHAVTATQKTVDAPSKKMWRDGRGANQNIIPASTGAAKAVAKVIPDLEGKLTGMAFRVPVPNVSVVDLTVRLCCDVTYDEIKAKVKAASQGPMKGILGYTEDEVVSSDFNGEVCSSVFDAKAGIALNKNFVKLVTWYDNEYGYSCRVLDLIQYMKSKDTGSKPKDTGSKPKDTGSKPKDTKGTPQDACG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query364 2.2.26 [Sep-21-2011]
Q4U3L0333 Glyceraldehyde-3-phosphat N/A N/A 0.906 0.990 0.757 1e-145
P07486332 Glyceraldehyde-3-phosphat yes N/A 0.906 0.993 0.739 1e-144
P07487332 Glyceraldehyde-3-phosphat yes N/A 0.906 0.993 0.739 1e-143
P56649333 Glyceraldehyde-3-phosphat N/A N/A 0.909 0.993 0.728 1e-143
O44104332 Glyceraldehyde-3-phosphat yes N/A 0.906 0.993 0.727 1e-142
P00357333 Glyceraldehyde-3-phosphat N/A N/A 0.909 0.993 0.719 1e-141
Q01597332 Glyceraldehyde-3-phosphat N/A N/A 0.906 0.993 0.721 1e-140
Q5R2J2333 Glyceraldehyde-3-phosphat N/A N/A 0.906 0.990 0.706 1e-136
P17244333 Glyceraldehyde-3-phosphat yes N/A 0.906 0.990 0.703 1e-136
Q05025333 Glyceraldehyde-3-phosphat N/A N/A 0.906 0.990 0.709 1e-136
>sp|Q4U3L0|G3P_GLOMM Glyceraldehyde-3-phosphate dehydrogenase OS=Glossina morsitans morsitans GN=Gapdh PE=2 SV=1 Back     alignment and function desciption
 Score =  516 bits (1328), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 250/330 (75%), Positives = 275/330 (83%)

Query: 4   KIGINGFGRIGRLVLREALHRNTPVVGINDPHLSVDYLAYMLKYDSTHGRFKGDVKTEGN 63
           KIGINGFGRIGRLVLR AL +   VV +NDP + V+Y+ Y+ KYDSTHGRFKG V  +G 
Sbjct: 3   KIGINGFGRIGRLVLRAALDKGAEVVAVNDPFIDVNYMVYLFKYDSTHGRFKGTVAADGG 62

Query: 64  NIVVNGKKIAVFQKMKPEEIPWSQTGAEYIVESTGVFKTKDTASAHLKGGAKKVIITAPS 123
            +VVNGKKI VF +  P  I W+  GAEYIVESTGVF T D ASAH KGGAKKV+I+APS
Sbjct: 63  FLVVNGKKITVFCERDPTNINWASAGAEYIVESTGVFTTIDKASAHFKGGAKKVVISAPS 122

Query: 124 KDAPMFVCGVNLDKYDPSHSVVSNASCTTNCLAPLAKVIHDNFEILEGLMTTVHAVTATQ 183
            DAPMFVCGVNL+ Y P   VVSNASCTTNCLAPLAKVIHDNFEI+EGLMTTVHA TATQ
Sbjct: 123 ADAPMFVCGVNLEAYSPDMKVVSNASCTTNCLAPLAKVIHDNFEIVEGLMTTVHATTATQ 182

Query: 184 KTVDAPSKKMWRDGRGANQNIIPASTGAAKAVAKVIPDLEGKLTGMAFRVPVPNVSVVDL 243
           KTVD PS K+WRDGRGA QNIIPASTGAAKAV KVIP+L GKLTGMAFRVP PNVSVVDL
Sbjct: 183 KTVDGPSGKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSVVDL 242

Query: 244 TVRLCCDVTYDEIKAKVKAASQGPMKGILGYTEDEVVSSDFNGEVCSSVFDAKAGIALNK 303
           TVRL    TYDEIKAKV  ASQGPMKGIL YTE+EVVS+DF G+  SSVFDAKAGI LN 
Sbjct: 243 TVRLGKSATYDEIKAKVLEASQGPMKGILDYTEEEVVSTDFVGDTHSSVFDAKAGIPLND 302

Query: 304 NFVKLVTWYDNEYGYSCRVLDLIQYMKSKD 333
            FVKL++WYDNE+GYS RV+DLI+YM+SKD
Sbjct: 303 KFVKLISWYDNEFGYSNRVIDLIKYMQSKD 332

Glossina morsitans morsitans (taxid: 37546)
EC: 1EC: .EC: 2EC: .EC: 1EC: .EC: 1EC: 2
>sp|P07486|G3P1_DROME Glyceraldehyde-3-phosphate dehydrogenase 1 OS=Drosophila melanogaster GN=Gapdh1 PE=2 SV=2 Back     alignment and function description
>sp|P07487|G3P2_DROME Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Drosophila melanogaster GN=Gapdh2 PE=1 SV=2 Back     alignment and function description
>sp|P56649|G3P_PANVR Glyceraldehyde-3-phosphate dehydrogenase OS=Panulirus versicolor PE=1 SV=1 Back     alignment and function description
>sp|O44104|G3P2_DROPS Glyceraldehyde-3-phosphate dehydrogenase 2 OS=Drosophila pseudoobscura pseudoobscura GN=Gapdh2 PE=2 SV=2 Back     alignment and function description
>sp|P00357|G3P_HOMAM Glyceraldehyde-3-phosphate dehydrogenase OS=Homarus americanus PE=1 SV=2 Back     alignment and function description
>sp|Q01597|G3P_DROHY Glyceraldehyde-3-phosphate dehydrogenase OS=Drosophila hydei GN=Gapdh1 PE=3 SV=1 Back     alignment and function description
>sp|Q5R2J2|G3P_PELSI Glyceraldehyde-3-phosphate dehydrogenase OS=Pelodiscus sinensis GN=GAPDH PE=2 SV=1 Back     alignment and function description
>sp|P17244|G3P_CRIGR Glyceraldehyde-3-phosphate dehydrogenase OS=Cricetulus griseus GN=GAPDH PE=2 SV=2 Back     alignment and function description
>sp|Q05025|G3P_COTJA Glyceraldehyde-3-phosphate dehydrogenase OS=Coturnix coturnix japonica GN=GAPDH PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query364
46561740332 glyceraldehyde 3-phosphate dehydrogenase 0.906 0.993 0.778 1e-150
53830712333 putative glyceraldehyde-3-phosphate dehy 0.906 0.990 0.769 1e-149
312306044332 glyceraldehyde-3-phosphate dehydrogenase 0.903 0.990 0.762 1e-148
48142692333 PREDICTED: glyceraldehyde-3-phosphate de 0.906 0.990 0.760 1e-147
383851102333 PREDICTED: glyceraldehyde-3-phosphate de 0.906 0.990 0.766 1e-147
380447700332 GAPDH [Locusta migratoria] 0.906 0.993 0.763 1e-147
388523595332 glyceraldehyde-3-phosphate dehydrogenase 0.906 0.993 0.760 1e-146
307181618333 Glyceraldehyde-3-phosphate dehydrogenase 0.906 0.990 0.754 1e-146
380017629349 PREDICTED: glyceraldehyde-3-phosphate de 0.906 0.945 0.754 1e-146
332026368349 Glyceraldehyde-3-phosphate dehydrogenase 0.906 0.945 0.757 1e-146
>gi|46561740|gb|AAT01075.1| glyceraldehyde 3-phosphate dehydrogenase [Homalodisca vitripennis] Back     alignment and taxonomy information
 Score =  537 bits (1383), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 257/330 (77%), Positives = 287/330 (86%)

Query: 4   KIGINGFGRIGRLVLREALHRNTPVVGINDPHLSVDYLAYMLKYDSTHGRFKGDVKTEGN 63
           KIGINGFGRIGRLVLR +L R   VV INDP + +DY+ YM KYDSTHGRFKG+VK EG+
Sbjct: 3   KIGINGFGRIGRLVLRASLERGGQVVAINDPFIGLDYMVYMFKYDSTHGRFKGEVKAEGD 62

Query: 64  NIVVNGKKIAVFQKMKPEEIPWSQTGAEYIVESTGVFKTKDTASAHLKGGAKKVIITAPS 123
           ++VVNG KIAVF +  P+ IPW + GAEY+VESTGVF T D ASAHL GGAKKVII+APS
Sbjct: 63  HLVVNGNKIAVFSERDPKAIPWGKAGAEYVVESTGVFTTIDKASAHLDGGAKKVIISAPS 122

Query: 124 KDAPMFVCGVNLDKYDPSHSVVSNASCTTNCLAPLAKVIHDNFEILEGLMTTVHAVTATQ 183
            DAPMFV GVNLD YDPS+ VVSNASCTTNCLAPLAKVIHDNFEI+EGLMTTVHA TATQ
Sbjct: 123 ADAPMFVVGVNLDAYDPSYKVVSNASCTTNCLAPLAKVIHDNFEIVEGLMTTVHATTATQ 182

Query: 184 KTVDAPSKKMWRDGRGANQNIIPASTGAAKAVAKVIPDLEGKLTGMAFRVPVPNVSVVDL 243
           KTVD PS K+WRDGRGA QNIIPA+TGAAKAV KVIP L GKLTGMAFRVPVPNVSVVDL
Sbjct: 183 KTVDGPSGKLWRDGRGAQQNIIPAATGAAKAVGKVIPALNGKLTGMAFRVPVPNVSVVDL 242

Query: 244 TVRLCCDVTYDEIKAKVKAASQGPMKGILGYTEDEVVSSDFNGEVCSSVFDAKAGIALNK 303
           TVRL  D TYD+IKAKVKAAS+GP+KGILGYTED+VVSSDF G+  SS+FDAKAGI LN 
Sbjct: 243 TVRLGKDATYDDIKAKVKAASEGPLKGILGYTEDDVVSSDFIGDNHSSIFDAKAGIPLNG 302

Query: 304 NFVKLVTWYDNEYGYSCRVLDLIQYMKSKD 333
            FVKL++WYDNE+GYS RV+DLI+YM++KD
Sbjct: 303 KFVKLISWYDNEFGYSSRVIDLIKYMQTKD 332

Source: Homalodisca vitripennis

Species: Homalodisca vitripennis

Genus: Homalodisca

Family: Cicadellidae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|53830712|gb|AAU95199.1| putative glyceraldehyde-3-phosphate dehydrogenase [Oncometopia nigricans] Back     alignment and taxonomy information
>gi|312306044|gb|ADQ73875.1| glyceraldehyde-3-phosphate dehydrogenase [Laodelphax striatella] Back     alignment and taxonomy information
>gi|48142692|ref|XP_393605.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase 2 isoform 1 [Apis mellifera] Back     alignment and taxonomy information
>gi|383851102|ref|XP_003701079.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|380447700|gb|AFD54028.1| GAPDH [Locusta migratoria] Back     alignment and taxonomy information
>gi|388523595|gb|AFK49796.1| glyceraldehyde-3-phosphate dehydrogenase [Cryptocercus punctulatus] Back     alignment and taxonomy information
>gi|307181618|gb|EFN69158.1| Glyceraldehyde-3-phosphate dehydrogenase [Camponotus floridanus] Back     alignment and taxonomy information
>gi|380017629|ref|XP_003692754.1| PREDICTED: glyceraldehyde-3-phosphate dehydrogenase 2-like [Apis florea] Back     alignment and taxonomy information
>gi|332026368|gb|EGI66497.1| Glyceraldehyde-3-phosphate dehydrogenase 2 [Acromyrmex echinatior] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query364
UNIPROTKB|Q4U3L0333 Gapdh "Glyceraldehyde-3-phosph 0.906 0.990 0.757 1.5e-131
UNIPROTKB|P80534363 P80534 "Glyceraldehyde-3-phosp 0.840 0.842 0.699 7.7e-131
FB|FBgn0001091332 Gapdh1 "Glyceraldehyde 3 phosp 0.906 0.993 0.739 1.5e-129
FB|FBgn0001092332 Gapdh2 "Glyceraldehyde 3 phosp 0.906 0.993 0.739 6.6e-129
UNIPROTKB|Q01597332 Gapdh1 "Glyceraldehyde-3-phosp 0.906 0.993 0.721 1.1e-126
UNIPROTKB|Q5R2J2333 GAPDH "Glyceraldehyde-3-phosph 0.906 0.990 0.706 3e-124
UNIPROTKB|Q05025333 GAPDH "Glyceraldehyde-3-phosph 0.906 0.990 0.709 4.9e-124
UNIPROTKB|P17244333 GAPDH "Glyceraldehyde-3-phosph 0.906 0.990 0.703 1.7e-123
UNIPROTKB|P00356333 GAPDH "Glyceraldehyde-3-phosph 0.906 0.990 0.706 2.7e-123
ZFIN|ZDB-GENE-030115-1333 gapdh "glyceraldehyde-3-phosph 0.906 0.990 0.703 4.4e-123
UNIPROTKB|Q4U3L0 Gapdh "Glyceraldehyde-3-phosphate dehydrogenase" [Glossina morsitans morsitans (taxid:37546)] Back     alignment and assigned GO terms
 Score = 1290 (459.2 bits), Expect = 1.5e-131, P = 1.5e-131
 Identities = 250/330 (75%), Positives = 275/330 (83%)

Query:     4 KIGINGFGRIGRLVLREALHRNTPVVGINDPHLSVDYLAYMLKYDSTHGRFKGDVKTEGN 63
             KIGINGFGRIGRLVLR AL +   VV +NDP + V+Y+ Y+ KYDSTHGRFKG V  +G 
Sbjct:     3 KIGINGFGRIGRLVLRAALDKGAEVVAVNDPFIDVNYMVYLFKYDSTHGRFKGTVAADGG 62

Query:    64 NIVVNGKKIAVFQKMKPEEIPWSQTGAEYIVESTGVFKTKDTASAHLKGGAKKVIITAPS 123
              +VVNGKKI VF +  P  I W+  GAEYIVESTGVF T D ASAH KGGAKKV+I+APS
Sbjct:    63 FLVVNGKKITVFCERDPTNINWASAGAEYIVESTGVFTTIDKASAHFKGGAKKVVISAPS 122

Query:   124 KDAPMFVCGVNLDKYDPSHSVVSNASCTTNCLAPLAKVIHDNFEILEGLMTTVHAVTATQ 183
              DAPMFVCGVNL+ Y P   VVSNASCTTNCLAPLAKVIHDNFEI+EGLMTTVHA TATQ
Sbjct:   123 ADAPMFVCGVNLEAYSPDMKVVSNASCTTNCLAPLAKVIHDNFEIVEGLMTTVHATTATQ 182

Query:   184 KTVDAPSKKMWRDGRGANQNIIPASTGAAKAVAKVIPDLEGKLTGMAFRVPVPNVSVVDL 243
             KTVD PS K+WRDGRGA QNIIPASTGAAKAV KVIP+L GKLTGMAFRVP PNVSVVDL
Sbjct:   183 KTVDGPSGKLWRDGRGAAQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTPNVSVVDL 242

Query:   244 TVRLCCDVTYDEIKAKVKAASQGPMKGILGYTEDEVVSSDFNGEVCSSVFDAKAGIALNK 303
             TVRL    TYDEIKAKV  ASQGPMKGIL YTE+EVVS+DF G+  SSVFDAKAGI LN 
Sbjct:   243 TVRLGKSATYDEIKAKVLEASQGPMKGILDYTEEEVVSTDFVGDTHSSVFDAKAGIPLND 302

Query:   304 NFVKLVTWYDNEYGYSCRVLDLIQYMKSKD 333
              FVKL++WYDNE+GYS RV+DLI+YM+SKD
Sbjct:   303 KFVKLISWYDNEFGYSNRVIDLIKYMQSKD 332
GO:0005737 "cytoplasm" evidence=ISS
GO:0015630 "microtubule cytoskeleton" evidence=ISS
UNIPROTKB|P80534 P80534 "Glyceraldehyde-3-phosphate dehydrogenase, muscle" [Jaculus orientalis (taxid:48868)] Back     alignment and assigned GO terms
FB|FBgn0001091 Gapdh1 "Glyceraldehyde 3 phosphate dehydrogenase 1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0001092 Gapdh2 "Glyceraldehyde 3 phosphate dehydrogenase 2" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q01597 Gapdh1 "Glyceraldehyde-3-phosphate dehydrogenase" [Drosophila hydei (taxid:7224)] Back     alignment and assigned GO terms
UNIPROTKB|Q5R2J2 GAPDH "Glyceraldehyde-3-phosphate dehydrogenase" [Pelodiscus sinensis (taxid:13735)] Back     alignment and assigned GO terms
UNIPROTKB|Q05025 GAPDH "Glyceraldehyde-3-phosphate dehydrogenase" [Coturnix japonica (taxid:93934)] Back     alignment and assigned GO terms
UNIPROTKB|P17244 GAPDH "Glyceraldehyde-3-phosphate dehydrogenase" [Cricetulus griseus (taxid:10029)] Back     alignment and assigned GO terms
UNIPROTKB|P00356 GAPDH "Glyceraldehyde-3-phosphate dehydrogenase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030115-1 gapdh "glyceraldehyde-3-phosphate dehydrogenase" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q4KYY3G3P_SPECI2, ., 6, ., 9, 9, ., -0.69180.90650.9909N/AN/A
P17244G3P_CRIGR2, ., 6, ., 9, 9, ., -0.70390.90650.9909yesN/A
P46406G3P_RABIT2, ., 6, ., 9, 9, ., -0.69180.90650.9909yesN/A
P07487G3P2_DROME1, ., 2, ., 1, ., 1, 20.73930.90650.9939yesN/A
P07486G3P1_DROME1, ., 2, ., 1, ., 1, 20.73930.90650.9939yesN/A
P80534G3P_JACOR1, ., 2, ., 1, ., 1, 20.63710.90650.9090N/AN/A
P78958G3P1_SCHPO1, ., 2, ., 1, ., 1, 20.67670.90650.9821noN/A
Q00584G3P_CLAPU1, ., 2, ., 1, ., 1, 20.67660.91480.9881N/AN/A
P0CN75G3P_CRYNB1, ., 2, ., 1, ., 1, 20.67460.91480.9823N/AN/A
P29497G3P_COCHE1, ., 2, ., 1, ., 1, 20.67060.91480.9881N/AN/A
P04797G3P_RAT2, ., 6, ., 9, 9, ., -0.69780.90650.9909yesN/A
P09317G3P_USTMA1, ., 2, ., 1, ., 1, 20.70090.90650.9792N/AN/A
Q96UF2G3P2_MUCCL1, ., 2, ., 1, ., 1, 20.68190.89560.9644N/AN/A
P48812G3P_BRUMA1, ., 2, ., 1, ., 1, 20.70140.90380.9705N/AN/A
P00356G3P_CHICK2, ., 6, ., 9, 9, ., -0.70690.90650.9909yesN/A
P00357G3P_HOMAM1, ., 2, ., 1, ., 1, 20.71900.90930.9939N/AN/A
P00355G3P_PIG2, ., 6, ., 9, 9, ., -0.68580.90650.9909yesN/A
P04406G3P_HUMAN2, ., 6, ., 9, 9, ., -0.67970.90650.9850yesN/A
P54118G3P_NEUCR1, ., 2, ., 1, ., 1, 20.69160.91480.9852N/AN/A
Q9N2D5G3P_FELCA2, ., 6, ., 9, 9, ., -0.68880.90650.9909N/AN/A
Q05025G3P_COTJA2, ., 6, ., 9, 9, ., -0.70990.90650.9909N/AN/A
Q9UR38G3P_LENED1, ., 2, ., 1, ., 1, 20.69160.91480.9881N/AN/A
P32637G3P_PODAS1, ., 2, ., 1, ., 1, 20.66760.91480.9881yesN/A
Q8WZN0G3P_SORMA1, ., 2, ., 1, ., 1, 20.69460.91480.9852N/AN/A
O42259G3P_ONCMY2, ., 6, ., 9, 9, ., -0.67870.90380.9820N/AN/A
Q5MJ86G3P2_DANRE1, ., 2, ., 1, ., 1, 20.69690.90380.9820noN/A
Q4U3L0G3P_GLOMM1, ., 2, ., 1, ., 1, 20.75750.90650.9909N/AN/A
Q28259G3P_CANFA2, ., 6, ., 9, 9, ., -0.69480.90650.9909yesN/A
O44104G3P2_DROPS1, ., 2, ., 1, ., 1, 20.72720.90650.9939yesN/A
Q5XJ10G3P_DANRE2, ., 6, ., 9, 9, ., -0.70390.90650.9909yesN/A
Q27652G3P_ECHMU1, ., 2, ., 1, ., 1, 20.66860.91480.9910N/AN/A
P56649G3P_PANVR1, ., 2, ., 1, ., 1, 20.72800.90930.9939N/AN/A
O01360G3P_ONCVO1, ., 2, ., 1, ., 1, 20.71340.90380.9705N/AN/A
O43026G3P2_SCHPO1, ., 2, ., 1, ., 1, 20.69780.90650.9850yesN/A
Q5R2J2G3P_PELSI2, ., 6, ., 9, 9, ., -0.70690.90650.9909N/AN/A
O13507G3P_PHARH1, ., 2, ., 1, ., 1, 20.66560.91480.9852N/AN/A
Q01597G3P_DROHY1, ., 2, ., 1, ., 1, 20.72120.90650.9939N/AN/A
P28844G3P_COCLU1, ., 2, ., 1, ., 1, 20.66460.91480.9881N/AN/A
A3FKF7G3P_MUSPF2, ., 6, ., 9, 9, ., -0.69480.90650.9909N/AN/A
Q9P8C0G3P_PHANO1, ., 2, ., 1, ., 1, 20.68560.91480.9881N/AN/A
P51469G3P_XENLA2, ., 6, ., 9, 9, ., -0.69780.90650.9909N/AN/A
O14556G3PT_HUMAN1, ., 2, ., 1, ., 1, 20.65750.90380.8063noN/A
P53430G3P_MONPU1, ., 2, ., 1, ., 1, 20.68880.90650.9792N/AN/A
Q5RAB4G3P_PONAB2, ., 6, ., 9, 9, ., -0.68270.90650.9850yesN/A
P32809G3P2_CAEBR1, ., 2, ., 1, ., 1, 20.67160.90100.9618N/AN/A
P10096G3P_BOVIN2, ., 6, ., 9, 9, ., -0.68580.90650.9909yesN/A
P20287G3P_SCHMA1, ., 2, ., 1, ., 1, 20.70480.90650.9763N/AN/A
P0CN74G3P_CRYNJ1, ., 2, ., 1, ., 1, 20.67460.91480.9823yesN/A
O57479G3P_COLLI2, ., 6, ., 9, 9, ., -0.70390.90650.9909N/AN/A
P16858G3P_MOUSE2, ., 6, ., 9, 9, ., -0.70090.90650.9909yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer1.2.1.120.991
4th Layer1.2.1.59LOW CONFIDENCE prediction!
3rd Layer1.2.10.976

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query364
PLN02272421 PLN02272, PLN02272, glyceraldehyde-3-phosphate deh 0.0
COG0057335 COG0057, GapA, Glyceraldehyde-3-phosphate dehydrog 1e-176
PTZ00023337 PTZ00023, PTZ00023, glyceraldehyde-3-phosphate deh 1e-170
TIGR01534326 TIGR01534, GAPDH-I, glyceraldehyde-3-phosphate deh 1e-167
PRK15425331 PRK15425, gapA, glyceraldehyde-3-phosphate dehydro 1e-150
PLN02358338 PLN02358, PLN02358, glyceraldehyde-3-phosphate deh 1e-146
PRK07729343 PRK07729, PRK07729, glyceraldehyde-3-phosphate deh 1e-136
PTZ00434361 PTZ00434, PTZ00434, cytosolic glyceraldehyde 3-pho 1e-122
PRK07403337 PRK07403, PRK07403, glyceraldehyde-3-phosphate deh 1e-115
PLN03096395 PLN03096, PLN03096, glyceraldehyde-3-phosphate deh 1e-104
PRK08955334 PRK08955, PRK08955, glyceraldehyde-3-phosphate deh 1e-102
PLN02237442 PLN02237, PLN02237, glyceraldehyde-3-phosphate deh 1e-100
pfam02800157 pfam02800, Gp_dh_C, Glyceraldehyde 3-phosphate deh 1e-88
PRK08289477 PRK08289, PRK08289, glyceraldehyde-3-phosphate deh 6e-86
TIGR01532325 TIGR01532, E4PD_g-proteo, erythrose-4-phosphate de 3e-84
PRK13535336 PRK13535, PRK13535, erythrose 4-phosphate dehydrog 2e-83
pfam00044148 pfam00044, Gp_dh_N, Glyceraldehyde 3-phosphate deh 4e-76
smart00846149 smart00846, Gp_dh_N, Glyceraldehyde 3-phosphate de 9e-74
PTZ00353342 PTZ00353, PTZ00353, glycosomal glyceraldehyde-3-ph 2e-55
>gnl|CDD|177912 PLN02272, PLN02272, glyceraldehyde-3-phosphate dehydrogenase Back     alignment and domain information 
 Score =  527 bits (1358), Expect = 0.0
 Identities = 222/328 (67%), Positives = 266/328 (81%), Gaps = 2/328 (0%)

Query: 4   KIGINGFGRIGRLVLREALHRN-TPVVGINDPHLSVDYLAYMLKYDSTHGRFKGDVKT-E 61
           KIGINGFGRIGRLVLR A  R+   VV +NDP +   Y+AYM KYDSTHG FKG +   +
Sbjct: 87  KIGINGFGRIGRLVLRIATSRDDIEVVAVNDPFIDAKYMAYMFKYDSTHGNFKGTINVVD 146

Query: 62  GNNIVVNGKKIAVFQKMKPEEIPWSQTGAEYIVESTGVFKTKDTASAHLKGGAKKVIITA 121
            + + +NGK+I V  K  P EIPW   GAEY+VES+GVF T + ASAHLKGGAKKV+I+A
Sbjct: 147 DSTLEINGKQIKVTSKRDPAEIPWGDFGAEYVVESSGVFTTVEKASAHLKGGAKKVVISA 206

Query: 122 PSKDAPMFVCGVNLDKYDPSHSVVSNASCTTNCLAPLAKVIHDNFEILEGLMTTVHAVTA 181
           PS DAPMFV GVN   Y P+ ++VSNASCTTNCLAPLAKV+H+ F ILEGLMTTVHA TA
Sbjct: 207 PSADAPMFVVGVNEKTYKPNMNIVSNASCTTNCLAPLAKVVHEEFGILEGLMTTVHATTA 266

Query: 182 TQKTVDAPSKKMWRDGRGANQNIIPASTGAAKAVAKVIPDLEGKLTGMAFRVPVPNVSVV 241
           TQKTVD PS K WR GRGA+QNIIP+STGAAKAV KV+P+L GKLTGMAFRVP PNVSVV
Sbjct: 267 TQKTVDGPSMKDWRGGRGASQNIIPSSTGAAKAVGKVLPELNGKLTGMAFRVPTPNVSVV 326

Query: 242 DLTVRLCCDVTYDEIKAKVKAASQGPMKGILGYTEDEVVSSDFNGEVCSSVFDAKAGIAL 301
           DLT RL    +Y+++KA +K AS+GP+KGILGYT+++VVS+DF G+  SS+FDAKAGI L
Sbjct: 327 DLTCRLEKSASYEDVKAAIKYASEGPLKGILGYTDEDVVSNDFVGDSRSSIFDAKAGIGL 386

Query: 302 NKNFVKLVTWYDNEYGYSCRVLDLIQYM 329
           + +F+KLV+WYDNE+GYS RVLDLI++M
Sbjct: 387 SASFMKLVSWYDNEWGYSNRVLDLIEHM 414

Length = 421
>gnl|CDD|223135 COG0057, GapA, Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|173322 PTZ00023, PTZ00023, glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|233453 TIGR01534, GAPDH-I, glyceraldehyde-3-phosphate dehydrogenase, type I Back     alignment and domain information
>gnl|CDD|185323 PRK15425, gapA, glyceraldehyde-3-phosphate dehydrogenase A; Provisional Back     alignment and domain information
>gnl|CDD|165999 PLN02358, PLN02358, glyceraldehyde-3-phosphate dehydrogenase Back     alignment and domain information
>gnl|CDD|236079 PRK07729, PRK07729, glyceraldehyde-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|185614 PTZ00434, PTZ00434, cytosolic glyceraldehyde 3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180962 PRK07403, PRK07403, glyceraldehyde-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|215572 PLN03096, PLN03096, glyceraldehyde-3-phosphate dehydrogenase A; Provisional Back     alignment and domain information
>gnl|CDD|169599 PRK08955, PRK08955, glyceraldehyde-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|215131 PLN02237, PLN02237, glyceraldehyde-3-phosphate dehydrogenase B Back     alignment and domain information
>gnl|CDD|217235 pfam02800, Gp_dh_C, Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain Back     alignment and domain information
>gnl|CDD|236219 PRK08289, PRK08289, glyceraldehyde-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>gnl|CDD|130595 TIGR01532, E4PD_g-proteo, erythrose-4-phosphate dehydrogenase Back     alignment and domain information
>gnl|CDD|184122 PRK13535, PRK13535, erythrose 4-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|215675 pfam00044, Gp_dh_N, Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain Back     alignment and domain information
>gnl|CDD|214851 smart00846, Gp_dh_N, Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain Back     alignment and domain information
>gnl|CDD|173546 PTZ00353, PTZ00353, glycosomal glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 364
PTZ00434361 cytosolic glyceraldehyde 3-phosphate dehydrogenase 100.0
PRK15425331 gapA glyceraldehyde-3-phosphate dehydrogenase A; P 100.0
PTZ00023337 glyceraldehyde-3-phosphate dehydrogenase; Provisio 100.0
PLN02237442 glyceraldehyde-3-phosphate dehydrogenase B 100.0
PRK07403337 glyceraldehyde-3-phosphate dehydrogenase; Reviewed 100.0
PLN02272421 glyceraldehyde-3-phosphate dehydrogenase 100.0
PRK07729343 glyceraldehyde-3-phosphate dehydrogenase; Validate 100.0
PLN03096395 glyceraldehyde-3-phosphate dehydrogenase A; Provis 100.0
PLN02358338 glyceraldehyde-3-phosphate dehydrogenase 100.0
PTZ00353342 glycosomal glyceraldehyde-3-phosphate dehydrogenas 100.0
PRK08955334 glyceraldehyde-3-phosphate dehydrogenase; Validate 100.0
PRK13535336 erythrose 4-phosphate dehydrogenase; Provisional 100.0
COG0057335 GapA Glyceraldehyde-3-phosphate dehydrogenase/eryt 100.0
TIGR01534327 GAPDH-I glyceraldehyde-3-phosphate dehydrogenase, 100.0
PRK08289477 glyceraldehyde-3-phosphate dehydrogenase; Reviewed 100.0
TIGR01532325 E4PD_g-proteo D-erythrose-4-phosphate dehydrogenas 100.0
KOG0657|consensus285 100.0
TIGR01546333 GAPDH-II_archae glyceraldehyde-3-phosphate dehydro 100.0
PF02800157 Gp_dh_C: Glyceraldehyde 3-phosphate dehydrogenase, 100.0
PRK04207341 glyceraldehyde-3-phosphate dehydrogenase; Provisio 100.0
PF00044151 Gp_dh_N: Glyceraldehyde 3-phosphate dehydrogenase, 100.0
PRK06901322 aspartate-semialdehyde dehydrogenase; Provisional 100.0
smart00846149 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, 100.0
COG0136334 Asd Aspartate-semialdehyde dehydrogenase [Amino ac 100.0
TIGR01745366 asd_gamma aspartate-semialdehyde dehydrogenase, ga 100.0
TIGR01296339 asd_B aspartate-semialdehyde dehydrogenase (peptid 100.0
PRK14874334 aspartate-semialdehyde dehydrogenase; Provisional 100.0
PRK06728347 aspartate-semialdehyde dehydrogenase; Provisional 100.0
PRK06598369 aspartate-semialdehyde dehydrogenase; Reviewed 100.0
PRK08040336 putative semialdehyde dehydrogenase; Provisional 100.0
PRK05671336 aspartate-semialdehyde dehydrogenase; Reviewed 100.0
PLN02383344 aspartate semialdehyde dehydrogenase 99.97
TIGR00978341 asd_EA aspartate-semialdehyde dehydrogenase (non-p 99.97
PRK08664349 aspartate-semialdehyde dehydrogenase; Reviewed 99.97
PRK00436343 argC N-acetyl-gamma-glutamyl-phosphate reductase; 99.94
TIGR01850346 argC N-acetyl-gamma-glutamyl-phosphate reductase, 99.92
PLN02968381 Probable N-acetyl-gamma-glutamyl-phosphate reducta 99.92
KOG4777|consensus361 99.9
PRK11863313 N-acetyl-gamma-glutamyl-phosphate reductase; Provi 99.88
TIGR01851310 argC_other N-acetyl-gamma-glutamyl-phosphate reduc 99.77
PRK08300302 acetaldehyde dehydrogenase; Validated 99.63
TIGR03215285 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylati 99.47
COG0002349 ArgC Acetylglutamate semialdehyde dehydrogenase [A 99.23
PF02774184 Semialdhyde_dhC: Semialdehyde dehydrogenase, dimer 99.12
PF01118121 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD bi 99.07
smart00859122 Semialdhyde_dh Semialdehyde dehydrogenase, NAD bin 98.33
PRK13301267 putative L-aspartate dehydrogenase; Provisional 98.03
PRK13303265 L-aspartate dehydrogenase; Provisional 97.8
TIGR01921324 DAP-DH diaminopimelate dehydrogenase. This model r 97.8
KOG4354|consensus340 97.77
COG1712255 Predicted dinucleotide-utilizing enzyme [General f 97.65
PRK06270341 homoserine dehydrogenase; Provisional 97.56
PF01113124 DapB_N: Dihydrodipicolinate reductase, N-terminus; 97.31
TIGR00036266 dapB dihydrodipicolinate reductase. 97.22
PRK13302271 putative L-aspartate dehydrogenase; Provisional 97.19
PRK13304265 L-aspartate dehydrogenase; Reviewed 97.17
COG0289266 DapB Dihydrodipicolinate reductase [Amino acid tra 97.07
PRK06813346 homoserine dehydrogenase; Validated 97.06
PRK00048257 dihydrodipicolinate reductase; Provisional 97.05
PRK08374336 homoserine dehydrogenase; Provisional 96.99
PF01408120 GFO_IDH_MocA: Oxidoreductase family, NAD-binding R 96.87
PRK06349426 homoserine dehydrogenase; Provisional 96.83
PRK09414445 glutamate dehydrogenase; Provisional 96.79
PRK06392326 homoserine dehydrogenase; Provisional 96.77
PRK11579346 putative oxidoreductase; Provisional 96.69
PLN02775286 Probable dihydrodipicolinate reductase 96.62
PRK05447385 1-deoxy-D-xylulose 5-phosphate reductoisomerase; P 96.54
COG0460333 ThrA Homoserine dehydrogenase [Amino acid transpor 96.32
cd01076227 NAD_bind_1_Glu_DH NAD(P) binding domain of glutama 96.26
PF03447117 NAD_binding_3: Homoserine dehydrogenase, NAD bindi 96.23
cd05211217 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of 96.18
cd05313254 NAD_bind_2_Glu_DH NAD(P) binding domain of glutama 95.92
PLN02477410 glutamate dehydrogenase 95.69
PLN02696454 1-deoxy-D-xylulose-5-phosphate reductoisomerase 95.64
PRK10206344 putative oxidoreductase; Provisional 95.62
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 95.59
COG4569310 MhpF Acetaldehyde dehydrogenase (acetylating) [Sec 95.51
PLN02700377 homoserine dehydrogenase family protein 95.2
PTZ00079454 NADP-specific glutamate dehydrogenase; Provisional 95.18
TIGR02130275 dapB_plant dihydrodipicolinate reductase. This nar 95.04
COG0569225 TrkA K+ transport systems, NAD-binding component [ 95.03
COG4091438 Predicted homoserine dehydrogenase [Amino acid tra 94.97
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 94.96
CHL00194317 ycf39 Ycf39; Provisional 94.87
COG0673342 MviM Predicted dehydrogenases and related proteins 94.68
PRK05472213 redox-sensing transcriptional repressor Rex; Provi 94.66
PRK14031444 glutamate dehydrogenase; Provisional 94.55
PF02826178 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehy 94.42
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 94.21
PRK14030445 glutamate dehydrogenase; Provisional 94.16
PRK09436819 thrA bifunctional aspartokinase I/homoserine dehyd 93.67
COG2344211 AT-rich DNA-binding protein [General function pred 93.66
TIGR03649285 ergot_EASG ergot alkaloid biosynthesis protein, AF 93.6
PRK07417279 arogenate dehydrogenase; Reviewed 93.54
PRK09466810 metL bifunctional aspartate kinase II/homoserine d 93.31
PRK08229341 2-dehydropantoate 2-reductase; Provisional 93.26
COG2910211 Putative NADH-flavin reductase [General function p 93.15
TIGR00243389 Dxr 1-deoxy-D-xylulose 5-phosphate reductoisomeras 92.84
PLN00016378 RNA-binding protein; Provisional 92.83
PRK11199374 tyrA bifunctional chorismate mutase/prephenate deh 92.68
cd08230355 glucose_DH Glucose dehydrogenase. Glucose dehydrog 92.64
TIGR02853287 spore_dpaA dipicolinic acid synthetase, A subunit. 92.6
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 92.56
COG1063350 Tdh Threonine dehydrogenase and related Zn-depende 92.4
PRK08507275 prephenate dehydrogenase; Validated 92.23
TIGR01202308 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyl 92.2
PRK08410311 2-hydroxyacid dehydrogenase; Provisional 92.09
PRK06487317 glycerate dehydrogenase; Provisional 91.92
PLN02819 1042 lysine-ketoglutarate reductase/saccharopine dehydr 91.83
cd05213311 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain 91.7
PF03435386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 91.56
TIGR03366280 HpnZ_proposed putative phosphonate catabolism asso 91.45
PF0380796 F420_oxidored: NADP oxidoreductase coenzyme F420-d 91.45
TIGR03736244 PRTRC_ThiF PRTRC system ThiF family protein. A nov 91.38
PRK06932314 glycerate dehydrogenase; Provisional 91.35
PRK08306296 dipicolinate synthase subunit A; Reviewed 91.21
COG2085211 Predicted dinucleotide-binding enzymes [General fu 91.06
PF0262996 CoA_binding: CoA binding domain; InterPro: IPR0037 91.0
PRK07531 495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 90.91
COG1748389 LYS9 Saccharopine dehydrogenase and related protei 90.89
PF00056141 Ldh_1_N: lactate/malate dehydrogenase, NAD binding 90.84
PLN02928347 oxidoreductase family protein 90.76
COG0111324 SerA Phosphoglycerate dehydrogenase and related de 90.73
PF10727127 Rossmann-like: Rossmann-like domain; InterPro: IPR 90.71
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 90.61
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 90.56
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 90.52
PF13380116 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5 90.4
PRK07634245 pyrroline-5-carboxylate reductase; Reviewed 90.36
COG1052324 LdhA Lactate dehydrogenase and related dehydrogena 90.25
PRK06436303 glycerate dehydrogenase; Provisional 90.17
PRK07574385 formate dehydrogenase; Provisional 90.11
PRK06223307 malate dehydrogenase; Reviewed 89.98
PRK05476425 S-adenosyl-L-homocysteine hydrolase; Provisional 89.87
PRK09880343 L-idonate 5-dehydrogenase; Provisional 89.83
PRK15409323 bifunctional glyoxylate/hydroxypyruvate reductase 89.67
PRK13243333 glyoxylate reductase; Reviewed 89.66
PRK11559296 garR tartronate semialdehyde reductase; Provisiona 89.61
KOG1502|consensus327 89.6
PRK11790409 D-3-phosphoglycerate dehydrogenase; Provisional 89.57
TIGR01915219 npdG NADPH-dependent F420 reductase. This model re 89.5
PRK15469312 ghrA bifunctional glyoxylate/hydroxypyruvate reduc 89.47
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 89.04
PRK12480330 D-lactate dehydrogenase; Provisional 88.86
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 88.71
cd01483143 E1_enzyme_family Superfamily of activating enzymes 88.71
PRK00045423 hemA glutamyl-tRNA reductase; Reviewed 88.7
PRK11880267 pyrroline-5-carboxylate reductase; Reviewed 88.65
TIGR02279 503 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa 88.43
PLN02306386 hydroxypyruvate reductase 88.36
PRK15438378 erythronate-4-phosphate dehydrogenase PdxB; Provis 88.35
PRK08818370 prephenate dehydrogenase; Provisional 88.13
PRK08268 507 3-hydroxy-acyl-CoA dehydrogenase; Validated 87.97
PRK06522304 2-dehydropantoate 2-reductase; Reviewed 87.92
TIGR01035417 hemA glutamyl-tRNA reductase. This enzyme, togethe 87.83
PF02670129 DXP_reductoisom: 1-deoxy-D-xylulose 5-phosphate re 87.77
PLN03139386 formate dehydrogenase; Provisional 87.75
PRK00066315 ldh L-lactate dehydrogenase; Reviewed 87.55
cd01065155 NAD_bind_Shikimate_DH NAD(P) binding domain of Shi 87.46
PLN02657390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 87.25
COG0451314 WcaG Nucleoside-diphosphate-sugar epimerases [Cell 87.23
PF00670162 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase 87.23
PLN02166436 dTDP-glucose 4,6-dehydratase 86.81
PRK03369 488 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 86.51
PRK01438 480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 86.51
cd08242319 MDR_like Medium chain dehydrogenases/reductase (MD 86.5
PTZ00117319 malate dehydrogenase; Provisional 86.27
cd00755231 YgdL_like Family of activating enzymes (E1) of ubi 86.09
TIGR01761343 thiaz-red thiazolinyl imide reductase. This reduct 86.06
COG0334411 GdhA Glutamate dehydrogenase/leucine dehydrogenase 85.96
cd08239339 THR_DH_like L-threonine dehydrogenase (TDH)-like. 85.57
PTZ00082321 L-lactate dehydrogenase; Provisional 85.48
PRK00257381 erythronate-4-phosphate dehydrogenase; Validated 85.46
PRK13403335 ketol-acid reductoisomerase; Provisional 85.31
PLN02260668 probable rhamnose biosynthetic enzyme 85.16
PRK08605332 D-lactate dehydrogenase; Validated 85.1
PLN02214342 cinnamoyl-CoA reductase 85.05
PLN02256304 arogenate dehydrogenase 84.71
COG0771 448 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligas 84.69
TIGR01327525 PGDH D-3-phosphoglycerate dehydrogenase. This mode 84.65
cd08281371 liver_ADH_like1 Zinc-dependent alcohol dehydrogena 84.6
PLN02712667 arogenate dehydrogenase 84.6
PRK12464383 1-deoxy-D-xylulose 5-phosphate reductoisomerase; P 84.56
cd05294309 LDH-like_MDH_nadp A lactate dehydrogenases-like st 84.37
cd08298329 CAD2 Cinnamyl alcohol dehydrogenases (CAD). These 84.29
PRK13581526 D-3-phosphoglycerate dehydrogenase; Provisional 84.19
PLN02586360 probable cinnamyl alcohol dehydrogenase 83.95
PRK06718202 precorrin-2 dehydrogenase; Reviewed 83.93
COG0039313 Mdh Malate/lactate dehydrogenases [Energy producti 83.64
PLN02712 667 arogenate dehydrogenase 83.38
PLN02662322 cinnamyl-alcohol dehydrogenase family protein 83.34
KOG1203|consensus411 83.22
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 82.97
TIGR03201349 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-Co 82.85
cd01336325 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosoli 82.82
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 82.8
KOG2741|consensus351 82.7
COG1062366 AdhC Zn-dependent alcohol dehydrogenases, class II 82.29
PLN03209 576 translocon at the inner envelope of chloroplast su 82.05
PLN02688266 pyrroline-5-carboxylate reductase 81.96
cd05291306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 81.8
cd01080168 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of 81.68
COG3804350 Uncharacterized conserved protein related to dihyd 81.63
TIGR01777292 yfcH conserved hypothetical protein TIGR01777. Thi 81.38
PRK03659601 glutathione-regulated potassium-efflux system prot 81.23
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 80.91
PRK03562621 glutathione-regulated potassium-efflux system prot 80.7
cd05293312 LDH_1 A subgroup of L-lactate dehydrogenases. L-la 80.68
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 80.59
PRK09599301 6-phosphogluconate dehydrogenase-like protein; Rev 80.46
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 80.18
PRK00094325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 80.12
TIGR03451358 mycoS_dep_FDH mycothiol-dependent formaldehyde deh 80.02
>PTZ00434 cytosolic glyceraldehyde 3-phosphate dehydrogenase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=2.1e-121  Score=896.57  Aligned_cols=336  Identities=54%  Similarity=0.893  Sum_probs=323.1

Q ss_pred             CCceEEEEccChHHHHHHHHHhcC-----CCcEEEEeCCCCCHHHHHHHhhcccccccCCcceee--------cCCeEEE
Q psy8544           1 MAYKIGINGFGRIGRLVLREALHR-----NTPVVGINDPHLSVDYLAYMLKYDSTHGRFKGDVKT--------EGNNIVV   67 (364)
Q Consensus         1 m~irVaInG~G~IGr~vlr~l~~~-----~~~ivaInd~~~~~~~~a~ll~ydS~~g~~~~~v~~--------~~~~l~i   67 (364)
                      |++||||||||||||+++|++.++     +++||||||+.+++++++|||||||+||+|+++++.        +++.|.+
T Consensus         2 m~ikVgINGFGRIGR~v~R~~~~~~~~~~~ievVAINd~~~~~~~~ayLlkyDS~hG~~~~~v~~~~~~~~~~~~~~l~i   81 (361)
T PTZ00434          2 APIKVGINGFGRIGRMVFQAICDQGLIGTEIDVVAVVDMSTNAEYFAYQMKYDTVHGRPKYTVETTKSSPSVKTDDVLVV   81 (361)
T ss_pred             CceEEEEECcChHHHHHHHHHHHcccCCCCeEEEEEeCCCCChhheeeeeeeecCCCCcCCceeecccccccccCCEEEE
Confidence            568999999999999999998763     799999999768999999999999999999999998        7899999


Q ss_pred             CCEEEEEE-ecCCCCCCCCcCCCccEEEeecCCCCCHhhHHHHHhCCCCEEEEeCCCCC-CCeEEcccCccccCC-CCCe
Q psy8544          68 NGKKIAVF-QKMKPEEIPWSQTGAEYIVESTGVFKTKDTASAHLKGGAKKVIITAPSKD-APMFVCGVNLDKYDP-SHSV  144 (364)
Q Consensus        68 ~gk~I~v~-~~~~p~~~~w~~~gvDiV~estG~f~s~e~a~~hl~aGakkVIIsaps~d-~p~vV~gVN~~~~~~-~~~I  144 (364)
                      ||++|.++ ++++|+++||+++|+|||+||||.|++++.++.|+++||||||||+|++| .|+||+||||+.|++ .++|
T Consensus        82 ng~~I~~~~~~~dP~~ipW~~~gvD~ViE~TG~f~t~~~a~~Hl~~GAKkViiSAP~~d~~~t~V~GVN~~~y~~~~~~I  161 (361)
T PTZ00434         82 NGHRIKCVKAQRNPADLPWGKLGVDYVIESTGLFTDKLAAEGHLKGGAKKVVISAPASGGAKTIVMGVNQHEYSPTEHHV  161 (361)
T ss_pred             CCEEEEEEEecCChhhCchhhcCCCEEEeCceeeccHHHHhhhhhcCCCEEEECCCCCCCCceEEEcCChHHcCcccCcE
Confidence            99999986 99999999999999999999999999999999999999999999999987 689999999999997 5789


Q ss_pred             EecCCchhhhHHhHHHHH-hhhcCeeEEEEEeeeccccchhhhcCCCcccccccccccceeecCCCChHHHHHHHccCCC
Q psy8544         145 VSNASCTTNCLAPLAKVI-HDNFEILEGLMTTVHAVTATQKTVDAPSKKMWRDGRGANQNIIPASTGAAKAVAKVIPDLE  223 (364)
Q Consensus       145 ISnaSCTTn~Lap~lk~L-~d~fGI~~~~~TTvha~t~~q~~~D~~~~~d~r~~r~~a~NIIP~~tGaak~~~kVlPeL~  223 (364)
                      |||+|||||||||++|+| ||+|||++++|||+|+||++|+++|+|+++||||+|++++||||++||++|++++|||+|+
T Consensus       162 iSnASCTTNcLAP~~kvL~~~~fGI~~g~mTTVHayT~~Q~~~D~~~~kD~Rr~Raaa~nIIPtsTGAAkAv~~VlP~L~  241 (361)
T PTZ00434        162 VSNASCTTNCLAPIVHVLTKEGFGIETGLMTTIHSYTATQKTVDGVSVKDWRGGRAAAVNIIPSTTGAAKAVGMVIPSTK  241 (361)
T ss_pred             EECCChHHHhhHHHHHHhhcCCcceEEEEEEEEecccCCcccccCcCcccccccccccccCccCCcchhhhhceeccccC
Confidence            999999999999999999 7999999999999999999999999997799999999999999999999999999999999


Q ss_pred             CceeeEEEeceeccceEEEEEEEeccCCCHHHHHHHHHHccCCCCCccccccCCceEeecCCCCCceeEEecCCcceec-
Q psy8544         224 GKLTGMAFRVPVPNVSVVDLTVRLCCDVTYDEIKAKVKAASQGPMKGILGYTEDEVVSSDFNGEVCSSVFDAKAGIALN-  302 (364)
Q Consensus       224 gki~~~avRVPv~~gs~~dl~~~l~k~~s~eei~~~l~~a~~~~lkgil~~~e~~~VS~df~~~~~s~i~d~~~~~~~~-  302 (364)
                      ||++|+++||||++||++||+++++|++++||||++|++|++++|||||+|+|+|+||+||+|++||+|||+.+|++++ 
T Consensus       242 GKl~G~a~RVPt~nvS~vDLt~~l~k~~t~eein~a~k~aa~~~lkgIl~y~~~plVS~Df~g~~~Ssi~D~~~t~v~~~  321 (361)
T PTZ00434        242 GKLTGMSFRVPTPDVSVVDLTFRATRDTSIQEIDAAIKRASQTYMKGILGFTDDELVSADFINDNRSSIYDSKATLQNNL  321 (361)
T ss_pred             CceeeEEEecccCcEeEEEEEEEeCCCCCHHHHHHHHHHhhhccccCcccccCCCccccccCCCCCCeEEEhhhCeEecc
Confidence            9999999999999999999999999999999999999999999999999999999999999999999999999999996 


Q ss_pred             ---CceEEEEEEecCCCcchhhhhHHHHHHhccCCCC
Q psy8544         303 ---KNFVKLVTWYDNEYGYSCRVLDLIQYMKSKDTGS  336 (364)
Q Consensus       303 ---~~~~kl~~WyDNE~gys~r~~dl~~~~~~~~~~~  336 (364)
                         ++|+|+++||||||||||||+||+.||.+....+
T Consensus       322 ~~~~~~vKv~~WYDNEwGys~Rl~dl~~~~~~~~~~~  358 (361)
T PTZ00434        322 PGERRFFKIVSWYDNEWGYSHRVVDLVRYMAAKDAAS  358 (361)
T ss_pred             CCCCCEEEEEEEecCchHHHHHHHHHHHHHHhccccc
Confidence               4899999999999999999999999998776543

>PRK15425 gapA glyceraldehyde-3-phosphate dehydrogenase A; Provisional Back     alignment and domain information
>PTZ00023 glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PLN02237 glyceraldehyde-3-phosphate dehydrogenase B Back     alignment and domain information
>PRK07403 glyceraldehyde-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>PLN02272 glyceraldehyde-3-phosphate dehydrogenase Back     alignment and domain information
>PRK07729 glyceraldehyde-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PLN03096 glyceraldehyde-3-phosphate dehydrogenase A; Provisional Back     alignment and domain information
>PLN02358 glyceraldehyde-3-phosphate dehydrogenase Back     alignment and domain information
>PTZ00353 glycosomal glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK08955 glyceraldehyde-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK13535 erythrose 4-phosphate dehydrogenase; Provisional Back     alignment and domain information
>COG0057 GapA Glyceraldehyde-3-phosphate dehydrogenase/erythrose-4-phosphate dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR01534 GAPDH-I glyceraldehyde-3-phosphate dehydrogenase, type I Back     alignment and domain information
>PRK08289 glyceraldehyde-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01532 E4PD_g-proteo D-erythrose-4-phosphate dehydrogenase Back     alignment and domain information
>KOG0657|consensus Back     alignment and domain information
>TIGR01546 GAPDH-II_archae glyceraldehyde-3-phosphate dehydrogenase, type II Back     alignment and domain information
>PF02800 Gp_dh_C: Glyceraldehyde 3-phosphate dehydrogenase, C-terminal domain; InterPro: IPR020829 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) plays an important role in glycolysis and gluconeogenesis [] by reversibly catalysing the oxidation and phosphorylation of D-glyceraldehyde-3-phosphate to 1,3-diphospho-glycerate Back     alignment and domain information
>PRK04207 glyceraldehyde-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PF00044 Gp_dh_N: Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain; InterPro: IPR020828 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) plays an important role in glycolysis and gluconeogenesis [] by reversibly catalysing the oxidation and phosphorylation of D-glyceraldehyde-3-phosphate to 1,3-diphospho-glycerate Back     alignment and domain information
>PRK06901 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>smart00846 Gp_dh_N Glyceraldehyde 3-phosphate dehydrogenase, NAD binding domain Back     alignment and domain information
>COG0136 Asd Aspartate-semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01745 asd_gamma aspartate-semialdehyde dehydrogenase, gamma-proteobacterial Back     alignment and domain information
>TIGR01296 asd_B aspartate-semialdehyde dehydrogenase (peptidoglycan organisms) Back     alignment and domain information
>PRK14874 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PRK06728 aspartate-semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PRK06598 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PRK08040 putative semialdehyde dehydrogenase; Provisional Back     alignment and domain information
>PRK05671 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PLN02383 aspartate semialdehyde dehydrogenase Back     alignment and domain information
>TIGR00978 asd_EA aspartate-semialdehyde dehydrogenase (non-peptidoglycan organisms) Back     alignment and domain information
>PRK08664 aspartate-semialdehyde dehydrogenase; Reviewed Back     alignment and domain information
>PRK00436 argC N-acetyl-gamma-glutamyl-phosphate reductase; Validated Back     alignment and domain information
>TIGR01850 argC N-acetyl-gamma-glutamyl-phosphate reductase, common form Back     alignment and domain information
>PLN02968 Probable N-acetyl-gamma-glutamyl-phosphate reductase Back     alignment and domain information
>KOG4777|consensus Back     alignment and domain information
>PRK11863 N-acetyl-gamma-glutamyl-phosphate reductase; Provisional Back     alignment and domain information
>TIGR01851 argC_other N-acetyl-gamma-glutamyl-phosphate reductase, uncommon form Back     alignment and domain information
>PRK08300 acetaldehyde dehydrogenase; Validated Back     alignment and domain information
>TIGR03215 ac_ald_DH_ac acetaldehyde dehydrogenase (acetylating) Back     alignment and domain information
>COG0002 ArgC Acetylglutamate semialdehyde dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PF02774 Semialdhyde_dhC: Semialdehyde dehydrogenase, dimerisation domain; InterPro: IPR012280 This domain contains N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate Back     alignment and domain information
>PF01118 Semialdhyde_dh: Semialdehyde dehydrogenase, NAD binding domain; InterPro: IPR000534 The semialdehyde dehydrogenase family is found in N-acetyl-glutamine semialdehyde dehydrogenase (AgrC), which is involved in arginine biosynthesis, and aspartate-semialdehyde dehydrogenase [], an enzyme involved in the biosynthesis of various amino acids from aspartate Back     alignment and domain information
>smart00859 Semialdhyde_dh Semialdehyde dehydrogenase, NAD binding domain Back     alignment and domain information
>PRK13301 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK13303 L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01921 DAP-DH diaminopimelate dehydrogenase Back     alignment and domain information
>KOG4354|consensus Back     alignment and domain information
>COG1712 Predicted dinucleotide-utilizing enzyme [General function prediction only] Back     alignment and domain information
>PRK06270 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PF01113 DapB_N: Dihydrodipicolinate reductase, N-terminus; InterPro: IPR000846 Dihydrodipicolinate reductase catalyzes the second step in the biosynthesis of diaminopimelic acid and lysine, the NAD or NADP-dependent reduction of 2,3-dihydrodipicolinate into 2,3,4,5-tetrahydrodipicolinate [, , ] Back     alignment and domain information
>TIGR00036 dapB dihydrodipicolinate reductase Back     alignment and domain information
>PRK13302 putative L-aspartate dehydrogenase; Provisional Back     alignment and domain information
>PRK13304 L-aspartate dehydrogenase; Reviewed Back     alignment and domain information
>COG0289 DapB Dihydrodipicolinate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06813 homoserine dehydrogenase; Validated Back     alignment and domain information
>PRK00048 dihydrodipicolinate reductase; Provisional Back     alignment and domain information
>PRK08374 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PF01408 GFO_IDH_MocA: Oxidoreductase family, NAD-binding Rossmann fold; InterPro: IPR000683 This group of enzymes utilise NADP or NAD, and is known as the GFO/IDH/MOCA family in UniProtKB/Swiss-Prot Back     alignment and domain information
>PRK06349 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK09414 glutamate dehydrogenase; Provisional Back     alignment and domain information
>PRK06392 homoserine dehydrogenase; Provisional Back     alignment and domain information
>PRK11579 putative oxidoreductase; Provisional Back     alignment and domain information
>PLN02775 Probable dihydrodipicolinate reductase Back     alignment and domain information
>PRK05447 1-deoxy-D-xylulose 5-phosphate reductoisomerase; Provisional Back     alignment and domain information
>COG0460 ThrA Homoserine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>cd01076 NAD_bind_1_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 1 Back     alignment and domain information
>PF03447 NAD_binding_3: Homoserine dehydrogenase, NAD binding domain; InterPro: IPR005106 Bacteria, plants and fungi metabolise aspartic acid to produce four amino acids - lysine, threonine, methionine and isoleucine - in a series of reactions known as the aspartate pathway Back     alignment and domain information
>cd05211 NAD_bind_Glu_Leu_Phe_Val NAD(P) binding domain of glutamate dehydrogenase, leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>cd05313 NAD_bind_2_Glu_DH NAD(P) binding domain of glutamate dehydrogenase, subgroup 2 Back     alignment and domain information
>PLN02477 glutamate dehydrogenase Back     alignment and domain information
>PLN02696 1-deoxy-D-xylulose-5-phosphate reductoisomerase Back     alignment and domain information
>PRK10206 putative oxidoreductase; Provisional Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>COG4569 MhpF Acetaldehyde dehydrogenase (acetylating) [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN02700 homoserine dehydrogenase family protein Back     alignment and domain information
>PTZ00079 NADP-specific glutamate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02130 dapB_plant dihydrodipicolinate reductase Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG4091 Predicted homoserine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>COG0673 MviM Predicted dehydrogenases and related proteins [General function prediction only] Back     alignment and domain information
>PRK05472 redox-sensing transcriptional repressor Rex; Provisional Back     alignment and domain information
>PRK14031 glutamate dehydrogenase; Provisional Back     alignment and domain information
>PF02826 2-Hacid_dh_C: D-isomer specific 2-hydroxyacid dehydrogenase, NAD binding domain; InterPro: IPR006140 A number of NAD-dependent 2-hydroxyacid dehydrogenases which seem to be specific for the D-isomer of their substrate have been shown to be functionally and structurally related Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK14030 glutamate dehydrogenase; Provisional Back     alignment and domain information
>PRK09436 thrA bifunctional aspartokinase I/homoserine dehydrogenase I; Provisional Back     alignment and domain information
>COG2344 AT-rich DNA-binding protein [General function prediction only] Back     alignment and domain information
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family Back     alignment and domain information
>PRK07417 arogenate dehydrogenase; Reviewed Back     alignment and domain information
>PRK09466 metL bifunctional aspartate kinase II/homoserine dehydrogenase II; Provisional Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>COG2910 Putative NADH-flavin reductase [General function prediction only] Back     alignment and domain information
>TIGR00243 Dxr 1-deoxy-D-xylulose 5-phosphate reductoisomerase Back     alignment and domain information
>PLN00016 RNA-binding protein; Provisional Back     alignment and domain information
>PRK11199 tyrA bifunctional chorismate mutase/prephenate dehydrogenase; Provisional Back     alignment and domain information
>cd08230 glucose_DH Glucose dehydrogenase Back     alignment and domain information
>TIGR02853 spore_dpaA dipicolinic acid synthetase, A subunit Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PRK08507 prephenate dehydrogenase; Validated Back     alignment and domain information
>TIGR01202 bchC 2-desacetyl-2-hydroxyethyl bacteriochlorophyllide A dehydrogenase Back     alignment and domain information
>PRK08410 2-hydroxyacid dehydrogenase; Provisional Back     alignment and domain information
>PRK06487 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase Back     alignment and domain information
>cd05213 NAD_bind_Glutamyl_tRNA_reduct NADP-binding domain of glutamyl-tRNA reductase Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase Back     alignment and domain information
>PF03807 F420_oxidored: NADP oxidoreductase coenzyme F420-dependent; InterPro: IPR004455 The function of F420-dependent NADP reductase is the transfer of electrons from reduced coenzyme F420 into an electron transport chain Back     alignment and domain information
>TIGR03736 PRTRC_ThiF PRTRC system ThiF family protein Back     alignment and domain information
>PRK06932 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK08306 dipicolinate synthase subunit A; Reviewed Back     alignment and domain information
>COG2085 Predicted dinucleotide-binding enzymes [General function prediction only] Back     alignment and domain information
>PF02629 CoA_binding: CoA binding domain; InterPro: IPR003781 This domain has a Rossmann fold and is found in a number of proteins including succinyl CoA synthetases, malate and ATP-citrate ligases Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PF00056 Ldh_1_N: lactate/malate dehydrogenase, NAD binding domain Prosite entry for lactate dehydrogenase Prosite entry for malate dehydrogenase; InterPro: IPR001236 L-lactate dehydrogenases are metabolic enzymes which catalyse the conversion of L-lactate to pyruvate, the last step in anaerobic glycolysis [] Back     alignment and domain information
>PLN02928 oxidoreductase family protein Back     alignment and domain information
>COG0111 SerA Phosphoglycerate dehydrogenase and related dehydrogenases [Amino acid transport and metabolism] Back     alignment and domain information
>PF10727 Rossmann-like: Rossmann-like domain; InterPro: IPR019665 This entry represents an NAD/NADP-binding domain with a core Rossmann-type fold, found in an uncharacterised protein family thought to be putative NADP oxidoreductase coenzyme F420-dependent proteins and/or NAD-dependent glycerol-3-phosphate dehydrogenase-like proteins Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PF13380 CoA_binding_2: CoA binding domain; PDB: 3FF4_A 2D5A_A 2D59_A 2E6U_X 1IUL_A 1IUK_A 1Y81_A 2DUW_A Back     alignment and domain information
>PRK07634 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>COG1052 LdhA Lactate dehydrogenase and related dehydrogenases [Energy production and conversion / Coenzyme metabolism / General function prediction only] Back     alignment and domain information
>PRK06436 glycerate dehydrogenase; Provisional Back     alignment and domain information
>PRK07574 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>PRK05476 S-adenosyl-L-homocysteine hydrolase; Provisional Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK15409 bifunctional glyoxylate/hydroxypyruvate reductase B; Provisional Back     alignment and domain information
>PRK13243 glyoxylate reductase; Reviewed Back     alignment and domain information
>PRK11559 garR tartronate semialdehyde reductase; Provisional Back     alignment and domain information
>KOG1502|consensus Back     alignment and domain information
>PRK11790 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01915 npdG NADPH-dependent F420 reductase Back     alignment and domain information
>PRK15469 ghrA bifunctional glyoxylate/hydroxypyruvate reductase A; Provisional Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>PRK12480 D-lactate dehydrogenase; Provisional Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>PRK00045 hemA glutamyl-tRNA reductase; Reviewed Back     alignment and domain information
>PRK11880 pyrroline-5-carboxylate reductase; Reviewed Back     alignment and domain information
>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC Back     alignment and domain information
>PLN02306 hydroxypyruvate reductase Back     alignment and domain information
>PRK15438 erythronate-4-phosphate dehydrogenase PdxB; Provisional Back     alignment and domain information
>PRK08818 prephenate dehydrogenase; Provisional Back     alignment and domain information
>PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>TIGR01035 hemA glutamyl-tRNA reductase Back     alignment and domain information
>PF02670 DXP_reductoisom: 1-deoxy-D-xylulose 5-phosphate reductoisomerase; InterPro: IPR013512 1-deoxy-D-xylulose 5-phosphate reductoisomerase synthesises 2-C-methyl-D-erythritol 4-phosphate from 1-deoxy-D-xylulose 5-phosphate in a single step by intramolecular rearrangement and reduction and is responsible for terpenoid biosynthesis in some organisms [] Back     alignment and domain information
>PLN03139 formate dehydrogenase; Provisional Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>cd01065 NAD_bind_Shikimate_DH NAD(P) binding domain of Shikimate dehydrogenase Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>COG0451 WcaG Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PF00670 AdoHcyase_NAD: S-adenosyl-L-homocysteine hydrolase, NAD binding domain; InterPro: IPR015878 S-adenosyl-L-homocysteine hydrolase (3 Back     alignment and domain information
>PLN02166 dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>PRK03369 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>cd08242 MDR_like Medium chain dehydrogenases/reductase (MDR)/zinc-dependent alcohol dehydrogenase-like family Back     alignment and domain information
>PTZ00117 malate dehydrogenase; Provisional Back     alignment and domain information
>cd00755 YgdL_like Family of activating enzymes (E1) of ubiquitin-like proteins related to the E Back     alignment and domain information
>TIGR01761 thiaz-red thiazolinyl imide reductase Back     alignment and domain information
>COG0334 GdhA Glutamate dehydrogenase/leucine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK00257 erythronate-4-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK13403 ketol-acid reductoisomerase; Provisional Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>PRK08605 D-lactate dehydrogenase; Validated Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>PLN02256 arogenate dehydrogenase Back     alignment and domain information
>COG0771 MurD UDP-N-acetylmuramoylalanine-D-glutamate ligase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR01327 PGDH D-3-phosphoglycerate dehydrogenase Back     alignment and domain information
>cd08281 liver_ADH_like1 Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>PRK12464 1-deoxy-D-xylulose 5-phosphate reductoisomerase; Provisional Back     alignment and domain information
>cd05294 LDH-like_MDH_nadp A lactate dehydrogenases-like structure with malate dehydrogenase enzymatic activity Back     alignment and domain information
>cd08298 CAD2 Cinnamyl alcohol dehydrogenases (CAD) Back     alignment and domain information
>PRK13581 D-3-phosphoglycerate dehydrogenase; Provisional Back     alignment and domain information
>PLN02586 probable cinnamyl alcohol dehydrogenase Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>COG0039 Mdh Malate/lactate dehydrogenases [Energy production and conversion] Back     alignment and domain information
>PLN02712 arogenate dehydrogenase Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>KOG1203|consensus Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>TIGR03201 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase Back     alignment and domain information
>cd01336 MDH_cytoplasmic_cytosolic Cytoplasmic and cytosolic Malate dehydrogenases Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>KOG2741|consensus Back     alignment and domain information
>COG1062 AdhC Zn-dependent alcohol dehydrogenases, class III [Energy production and conversion] Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>PLN02688 pyrroline-5-carboxylate reductase Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>cd01080 NAD_bind_m-THF_DH_Cyclohyd NADP binding domain of methylene-tetrahydrofolate dehydrogenase/cyclohydrolase Back     alignment and domain information
>COG3804 Uncharacterized conserved protein related to dihydrodipicolinate reductase [Function unknown] Back     alignment and domain information
>TIGR01777 yfcH conserved hypothetical protein TIGR01777 Back     alignment and domain information
>PRK03659 glutathione-regulated potassium-efflux system protein KefB; Provisional Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>PRK03562 glutathione-regulated potassium-efflux system protein KefC; Provisional Back     alignment and domain information
>cd05293 LDH_1 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>PRK09599 6-phosphogluconate dehydrogenase-like protein; Reviewed Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query364
1szj_G333 Structure Of Holo-Glyceraldehyde-3-Phosphate-Dehydr 1e-144
1ihx_A333 Crystal Structure Of Two D-Glyceraldehyde-3-Phospha 1e-144
1dss_G333 Structure Of Active-Site Carboxymethylated D-Glycer 1e-143
1gpd_G334 Studies Of Asymmetry In The Three-Dimensional Struc 1e-142
4gpd_1333 The Structure Of Lobster Apo-D-Glyceraldehyde-3-Pho 1e-142
1j0x_O332 Crystal Structure Of The Rabbit Muscle Glyceraldehy 1e-133
1znq_O338 Crsytal Structure Of Human Liver Gapdh Length = 338 1e-133
1u8f_O335 Crystal Structure Of Human Placental Glyceraldehyde 1e-133
3h9e_B346 Crystal Structure Of Human Sperm-Specific Glycerald 1e-130
2vyn_D334 Structure Of E.Coli Gapdh Rat Sperm Gapdh Heterotet 1e-129
3gpd_R334 Twinning In Crystals Of Human Skeletal Muscle D-Gly 1e-129
1s7c_A331 Crystal Structure Of Mes Buffer Bound Form Of Glyce 1e-128
3e6a_O336 Crystal Structure And Functional Analysis Of Glycer 1e-127
3e5r_O337 Crystal Structure And Functional Analysis Of Glycer 1e-127
1gad_O330 Comparison Of The Structures Of Wild Type And A N31 1e-127
1gae_O330 Comparison Of The Structures Of Wild Type And A N31 1e-126
2i5p_O342 Crystal Structure Of Glyceraldehyde-3-Phosphate Deh 1e-126
2vyn_A331 Structure Of E.Coli Gapdh Rat Sperm Gapdh Heterotet 1e-126
3pym_A332 Structure Of Gapdh 3 From S.Cerevisiae At 2.0 A Res 1e-123
4iq8_A340 Crystal Structure Of Glyceraldehyde-3-phosphate Deh 1e-123
1vsu_A359 Crystal Structure Of Apo-Glyceraldehyde 3-Phosphate 1e-117
3cps_A354 Crystal Structure Of Cryptosporidium Parvum Glycera 1e-117
1dc4_A330 Structural Analysis Of Glyceraldehyde 3-Phosphate D 1e-117
3cif_A359 Crystal Structure Of C153s Mutant Glyceraldehyde 3- 1e-115
3sth_A361 Crystal Structure Of Glyceraldehyde-3-Phosphate Deh 1e-111
1ywg_O337 The Structure Of Glyceraldehyde-3-Phosphate Dehydro 1e-110
2b4r_O345 Crystal Structure Of Glyceraldehyde-3-Phosphate Deh 1e-110
1gd1_O334 Structure Of Holo-Glyceraldehyde-3-Phosphate Dehydr 2e-99
3dbv_O334 Glyceraldehyde-3-Phosphate Dehydrogenase Mutant Wit 4e-99
1npt_O334 Glyceraldehyde-3-Phosphate Dehydrogenase Mutant Wit 2e-98
1nq5_O334 Glyceraldehyde-3-Phosphate Dehydrogenase Mutant Wit 2e-98
1dbv_O334 Glyceraldehyde-3-Phosphate Dehydrogenase Mutant Wit 3e-98
1k3t_A359 Structure Of Glycosomal Glyceraldehyde-3-Phosphate 3e-95
2x0n_A359 Structure Of Glycosomal Glyceraldehyde-3-Phosphate 4e-94
3dmt_C359 Structure Of Glycosomal Glyceraldehyde-3-Phosphate 5e-94
1gyp_A358 Crystal Structure Of Glycosomal Glyceraldehyde-3-Ph 4e-92
1a7k_A360 Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase 5e-92
1hdg_O332 The Crystal Structure Of Holo-glyceraldehyde-3-phos 5e-87
2ep7_A342 Structural Study Of Project Id Aq_1065 From Aquifex 2e-84
3hja_A356 Crystal Structure Of Glyceraldehyde-3-Phosphate Deh 2e-81
1vc2_A331 Crystal Structure Of Glyceraldehyde 3-Phosphate Deh 3e-80
3doc_A335 Crystal Structure Of Trka Glyceraldehyde-3-Phosphat 1e-79
1cer_O331 Determinants Of Enzyme Thermostability Observed In 2e-79
4dib_A345 The Crystal Structure Of Glyceraldehyde-3-Phosphate 1e-78
2g82_O331 High Resolution Structures Of Thermus Aquaticus Gly 2e-78
3gnq_A344 Crystal Structure Of Glyceraldehyde-3-Phosphate Deh 3e-76
3l0d_A356 Crystal Structure Of Glyceraldehyde-3-phosphate Deh 4e-76
3vaz_P344 Crystal Structure Of Staphylococcal Gapdh1 In A Hex 1e-73
3lvf_P338 Crystal Structure Of Holo Glyceraldehyde-3-Phosphat 1e-73
3k73_Q336 Crystal Structure Of Phosphate Bound Holo Glycerald 1e-73
3lc7_O339 Crystal Structure Of Apo Glyceraldehyde-3-Phosphate 2e-73
3b1j_A339 Crystal Structure Of Dehydrogenese Length = 339 2e-73
2d2i_A380 Crystal Structure Of Nadp-Dependent Glyceraldehyde- 2e-73
1jn0_O335 Crystal Structure Of The Non-Regulatory A4 Isoform 5e-73
3lc1_P336 Crystal Structure Of H178n Mutant Of Glyceraldehyde 1e-72
3hq4_R336 Crystal Structure Of C151s Mutant Of Glyceraldehyde 1e-72
3k9q_Q336 Crsytal Strcuture Of C151g Mutant Of Glyceraldehyde 2e-72
1rm3_O337 Crystal Structure Of Mutant T33a Of Photosynthetic 3e-72
2pkr_O365 Crystal Structure Of (A+cte)4 Chimeric Form Of Phot 3e-72
1nbo_O337 The Dual Coenzyme Specificity Of Photosynthetic Gly 3e-72
1rm5_O337 Crystal Structure Of Mutant S188a Of Photosynthetic 3e-72
3ksd_Q336 Crystal Structure Of C151s+h178n Mutant Of Glyceral 1e-71
1obf_O335 The Crystal Structure Of Glyceraldehyde 3-Phosphate 2e-69
3k2b_A337 Crystal Structure Of Photosynthetic A4 Isoform Glyc 9e-69
2pkq_O368 Crystal Structure Of The Photosynthetic A2b2-Glycer 1e-68
2x5j_O339 Crystal Structure Of The Apoform Of The D-Erythrose 4e-59
2xf8_A338 Structure Of The D-Erythrose-4-Phosphate Dehydrogen 2e-58
2x5k_O339 Structure Of An Active Site Mutant Of The D-Erythro 6e-57
>pdb|1SZJ|G Chain G, Structure Of Holo-Glyceraldehyde-3-Phosphate-Dehydrogenase From Palinurus Versicolor Refined 2.0 Angstrom Resolution Length = 333 Back     alignment and structure 
Iteration: 1

 Score =  508 bits (1307), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 241/331 (72%), Positives = 282/331 (85%)
Query: 4   KIGINGFGRIGRLVLREALHRNTPVVGINDPHLSVDYLAYMLKYDSTHGRFKGDVKTEGN 63
           KIGINGFGRIGRLVLR AL     VV +NDP ++++Y+ YM KYDSTHG FKG+VK E  
Sbjct: 2   KIGINGFGRIGRLVLRAALEMGAQVVAVNDPFIALEYMVYMFKYDSTHGMFKGEVKAEDG 61
Query: 64  NIVVNGKKIAVFQKMKPEEIPWSQTGAEYIVESTGVFKTKDTASAHLKGGAKKVIITAPS 123
            +VV+GKKI VF +MKPE IPWS+ GAEYIVESTGVF T + ASAH KGGAKKVII+APS
Sbjct: 62  ALVVDGKKITVFNEMKPENIPWSKAGAEYIVESTGVFTTIEKASAHFKGGAKKVIISAPS 121
Query: 124 KDAPMFVCGVNLDKYDPSHSVVSNASCTTNCLAPLAKVIHDNFEILEGLMTTVHAVTATQ 183
            DAPMFVCGVNL+KY     VVSNASCTTNCLAP+AKV+H+NFEI+EGLMTTVHAVTATQ
Sbjct: 122 ADAPMFVCGVNLEKYSKDMKVVSNASCTTNCLAPVAKVLHENFEIVEGLMTTVHAVTATQ 181
Query: 184 KTVDAPSKKMWRDGRGANQNIIPASTGAAKAVAKVIPDLEGKLTGMAFRVPVPNVSVVDL 243
           KTVD PS K WR GRGA QNIIP+STGAAKAV KVIP+L+GKLTGMAFRVP PNVSVVDL
Sbjct: 182 KTVDGPSAKDWRGGRGAAQNIIPSSTGAAKAVGKVIPELDGKLTGMAFRVPTPNVSVVDL 241
Query: 244 TVRLCCDVTYDEIKAKVKAASQGPMKGILGYTEDEVVSSDFNGEVCSSVFDAKAGIALNK 303
           TVRL  + +YD+IKA +KAAS+GP++G+LGYTED+VVS DF G+  SS+FDAKAGI L+K
Sbjct: 242 TVRLGKECSYDDIKAAMKAASEGPLQGVLGYTEDDVVSCDFTGDNRSSIFDAKAGIQLSK 301
Query: 304 NFVKLVTWYDNEYGYSCRVLDLIQYMKSKDT 334
            FVK+V+WYDNE+GYS RV+DLI++M+  D+
Sbjct: 302 TFVKVVSWYDNEFGYSQRVIDLIKHMQKVDS 332
>pdb|1IHX|A Chain A, Crystal Structure Of Two D-Glyceraldehyde-3-Phosphate Dehydrogenase Complexes: A Case Of Asymmetry Length = 333 Back     alignment and structure
>pdb|1DSS|G Chain G, Structure Of Active-Site Carboxymethylated D-Glyceraldehyde-3- Phosphate Dehydrogenase From Palinurus Versicolor Length = 333 Back     alignment and structure
>pdb|1GPD|G Chain G, Studies Of Asymmetry In The Three-Dimensional Structure Of Lobster D- Glyceraldehyde-3-Phosphate Dehydrogenase Length = 334 Back     alignment and structure
>pdb|4GPD|1 Chain 1, The Structure Of Lobster Apo-D-Glyceraldehyde-3-Phosphate Dehydrogenase At 3.0 Angstroms Resolution Length = 333 Back     alignment and structure
>pdb|1J0X|O Chain O, Crystal Structure Of The Rabbit Muscle Glyceraldehyde-3- Phosphate Dehydrogenase (Gapdh) Length = 332 Back     alignment and structure
>pdb|1ZNQ|O Chain O, Crsytal Structure Of Human Liver Gapdh Length = 338 Back     alignment and structure
>pdb|1U8F|O Chain O, Crystal Structure Of Human Placental Glyceraldehyde-3- Phosphate Dehydrogenase At 1.75 Resolution Length = 335 Back     alignment and structure
>pdb|2VYN|D Chain D, Structure Of E.Coli Gapdh Rat Sperm Gapdh Heterotetramer Length = 334 Back     alignment and structure
>pdb|3GPD|R Chain R, Twinning In Crystals Of Human Skeletal Muscle D-Glyceraldehyde-3- Phosphate Dehydrogenase Length = 334 Back     alignment and structure
>pdb|1S7C|A Chain A, Crystal Structure Of Mes Buffer Bound Form Of Glyceraldehyde 3- Phosphate Dehydrogenase From Escherichia Coli Length = 331 Back     alignment and structure
>pdb|3E6A|O Chain O, Crystal Structure And Functional Analysis Of Glyceraldehyde- 3-Phosphate Dehydrogenase From Oryza Sativa Length = 336 Back     alignment and structure
>pdb|3E5R|O Chain O, Crystal Structure And Functional Analysis Of Glyceraldehyde- 3-Phosphate Dehydrogenase From Oryza Sativa Length = 337 Back     alignment and structure
>pdb|1GAD|O Chain O, Comparison Of The Structures Of Wild Type And A N313t Mutant Of Escherichia Coli Glyceraldehyde 3-Phosphate Dehydrogenases: Implication For Nad Binding And Cooperativity Length = 330 Back     alignment and structure
>pdb|1GAE|O Chain O, Comparison Of The Structures Of Wild Type And A N313t Mutant Of Escherichia Coli Glyceraldehyde 3-Phosphate Dehydrogenases: Implication For Nad Binding And Cooperativity Length = 330 Back     alignment and structure
>pdb|2I5P|O Chain O, Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase Isoform 1 From K. Marxianus Length = 342 Back     alignment and structure
>pdb|2VYN|A Chain A, Structure Of E.Coli Gapdh Rat Sperm Gapdh Heterotetramer Length = 331 Back     alignment and structure
>pdb|3PYM|A Chain A, Structure Of Gapdh 3 From S.Cerevisiae At 2.0 A Resolution Length = 332 Back     alignment and structure
>pdb|4IQ8|A Chain A, Crystal Structure Of Glyceraldehyde-3-phosphate Dehydrogenase 3 From Saccharomyces Cerevisiae Length = 340 Back     alignment and structure
>pdb|1VSU|A Chain A, Crystal Structure Of Apo-Glyceraldehyde 3-Phosphate Dehydrogenase From Cryptosporidium Parvum Length = 359 Back     alignment and structure
>pdb|3CPS|A Chain A, Crystal Structure Of Cryptosporidium Parvum Glyceraldehyde-3-Phosphate Dehydrogenase Length = 354 Back     alignment and structure
>pdb|1DC4|A Chain A, Structural Analysis Of Glyceraldehyde 3-Phosphate Dehydrogenase From Escherichia Coli: Direct Evidence For Substrate Binding And Cofactor-Induced Conformational Changes Length = 330 Back     alignment and structure
>pdb|3CIF|A Chain A, Crystal Structure Of C153s Mutant Glyceraldehyde 3-Phosphate Dehydrogenase From Cryptosporidium Parvum Length = 359 Back     alignment and structure
>pdb|3STH|A Chain A, Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase From Toxoplasma Gondii Length = 361 Back     alignment and structure
>pdb|1YWG|O Chain O, The Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase From Plasmodium Falciparum Length = 337 Back     alignment and structure
>pdb|2B4R|O Chain O, Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase From Plasmodium Falciparum At 2.25 Angstrom Resolution Reveals Intriguing Extra Electron Density In The Active Site Length = 345 Back     alignment and structure
>pdb|1GD1|O Chain O, Structure Of Holo-Glyceraldehyde-3-Phosphate Dehydrogenase From Bacillus Stearothermophilus At 1.8 Angstroms Resolution Length = 334 Back     alignment and structure
>pdb|3DBV|O Chain O, Glyceraldehyde-3-Phosphate Dehydrogenase Mutant With Leu 33 Replaced By Thr, Thr 34 Replaced By Gly, Asp 36 Replaced By Gly, Leu 187 Replaced By Ala, And Pro 188 Replaced By Ser Complexed With Nad+ Length = 334 Back     alignment and structure
>pdb|1NPT|O Chain O, Glyceraldehyde-3-Phosphate Dehydrogenase Mutant With Cys 149 Replaced By Ala Complexed With Nad+ Length = 334 Back     alignment and structure
>pdb|1NQ5|O Chain O, Glyceraldehyde-3-Phosphate Dehydrogenase Mutant With Cys 149 Replaced By Ser Complexed With Nad+ Length = 334 Back     alignment and structure
>pdb|1DBV|O Chain O, Glyceraldehyde-3-Phosphate Dehydrogenase Mutant With Asp 32 Replaced By Gly, Leu 187 Replaced By Ala, And Pro 188 Replaced By Ser Complexed With Nad+ Length = 334 Back     alignment and structure
>pdb|1K3T|A Chain A, Structure Of Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase From Trypanosoma Cruzi Complexed With Chalepin, A Coumarin Derivative Inhibitor Length = 359 Back     alignment and structure
>pdb|2X0N|A Chain A, Structure Of Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase From Trypanosoma Brucei Determined From Laue Data Length = 359 Back     alignment and structure
>pdb|3DMT|C Chain C, Structure Of Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase From Trypanosoma Cruzi In Complex With The Irreversible Iodoacetate Inhibitor Length = 359 Back     alignment and structure
>pdb|1GYP|A Chain A, Crystal Structure Of Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase From Leishmania Mexicana: Implications For Structure-Based Drug Design And A New Position For The Inorganic Phosphate Binding Site Length = 358 Back     alignment and structure
>pdb|1A7K|A Chain A, Glycosomal Glyceraldehyde-3-Phosphate Dehydrogenase In A Monoclinic Crystal Form Length = 360 Back     alignment and structure
>pdb|1HDG|O Chain O, The Crystal Structure Of Holo-glyceraldehyde-3-phosphate Dehydrogenase From The Hyperthermophilic Bacterium Thermotoga Maritima At 2.5 Angstroms Resolution Length = 332 Back     alignment and structure
>pdb|2EP7|A Chain A, Structural Study Of Project Id Aq_1065 From Aquifex Aeolicus Vf5 Length = 342 Back     alignment and structure
>pdb|3HJA|A Chain A, Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase From Borrelia Burgdorferi Length = 356 Back     alignment and structure
>pdb|1VC2|A Chain A, Crystal Structure Of Glyceraldehyde 3-Phosphate Dehydrogenase From Thermus Thermophilus Hb8 Length = 331 Back     alignment and structure
>pdb|3DOC|A Chain A, Crystal Structure Of Trka Glyceraldehyde-3-Phosphate Dehydrogenase From Brucella Melitensis Length = 335 Back     alignment and structure
>pdb|1CER|O Chain O, Determinants Of Enzyme Thermostability Observed In The Molecular Structure Of Thermus Aquaticus D-Glyceraldehyde- 3-Phosphate Dehydrogenase At 2.5 Angstroms Resolution Length = 331 Back     alignment and structure
>pdb|4DIB|A Chain A, The Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase From Bacillus Anthracis Str. Sterne Length = 345 Back     alignment and structure
>pdb|2G82|O Chain O, High Resolution Structures Of Thermus Aquaticus Glyceraldehyde-3- Phosphate Dehydrogenase: Role Of 220's Loop Motion In Catalysis Length = 331 Back     alignment and structure
>pdb|3GNQ|A Chain A, Crystal Structure Of Glyceraldehyde-3-Phosphate Dehydrogenase, Type I From Burkholderia Pseudomallei Length = 344 Back     alignment and structure
>pdb|3L0D|A Chain A, Crystal Structure Of Glyceraldehyde-3-phosphate Dehydrogenase From Bartonella Henselae With Bound Nad Length = 356 Back     alignment and structure
>pdb|3VAZ|P Chain P, Crystal Structure Of Staphylococcal Gapdh1 In A Hexagonal Space Group Length = 344 Back     alignment and structure
>pdb|3LVF|P Chain P, Crystal Structure Of Holo Glyceraldehyde-3-Phosphate Dehydrogenase 1 (Gapdh1) From Methicillin Resistant Staphylococcus Aureus Mrsa252 At 1.7 Angstrom Resolution Length = 338 Back     alignment and structure
>pdb|3K73|Q Chain Q, Crystal Structure Of Phosphate Bound Holo Glyceraldehyde-3-Phosphate Dehydrogenase 1 From Mrsa252 At 2.5 Angstrom Resolution Length = 336 Back     alignment and structure
>pdb|3LC7|O Chain O, Crystal Structure Of Apo Glyceraldehyde-3-Phosphate Dehydrogenase 1 (Gapdh1) From Methicllin Resistant Staphylococcus Aureus (Mrsa252) Length = 339 Back     alignment and structure
>pdb|3B1J|A Chain A, Crystal Structure Of Dehydrogenese Length = 339 Back     alignment and structure
>pdb|2D2I|A Chain A, Crystal Structure Of Nadp-Dependent Glyceraldehyde-3- Phosphate Dehydrogenase From Synechococcus Sp. Complexed With Nadp+ Length = 380 Back     alignment and structure
>pdb|1JN0|O Chain O, Crystal Structure Of The Non-Regulatory A4 Isoform Of Spinach Chloroplast Glyceraldehyde-3-Phosphate Dehydrogenase Complexed With Nadp Length = 335 Back     alignment and structure
>pdb|3LC1|P Chain P, Crystal Structure Of H178n Mutant Of Glyceraldehyde-3-Phosphate- Dehydrogenase 1 (Gapdh 1) From Staphylococcus Aureus Mrsa252 Complexed With Nad At 2.0 Angstrom Resolution. Length = 336 Back     alignment and structure
>pdb|3HQ4|R Chain R, Crystal Structure Of C151s Mutant Of Glyceraldehyde-3-Phosphate Dehydrogenase 1 (Gapdh1) Complexed With Nad From Staphylococcus Aureus Mrsa252 At 2.2 Angstrom Resolution Length = 336 Back     alignment and structure
>pdb|3K9Q|Q Chain Q, Crsytal Strcuture Of C151g Mutant Of Glyceraldehyde 3-Phosphate Dehydrogenase 1 From Methicillin Resistant Staphylococcus Aureus (Mrsa252) At 2.5 Angstrom Resolution Length = 336 Back     alignment and structure
>pdb|1RM3|O Chain O, Crystal Structure Of Mutant T33a Of Photosynthetic Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed With Nadp Length = 337 Back     alignment and structure
>pdb|2PKR|O Chain O, Crystal Structure Of (A+cte)4 Chimeric Form Of Photosyntetic Glyceraldehyde-3-Phosphate Dehydrogenase, Complexed With Nadp Length = 365 Back     alignment and structure
>pdb|1NBO|O Chain O, The Dual Coenzyme Specificity Of Photosynthetic Glyceraldehyde-3- Phosphate Dehydrogenase Interpreted By The Crystal Structure Of A4 Isoform Complexed With Nad Length = 337 Back     alignment and structure
>pdb|1RM5|O Chain O, Crystal Structure Of Mutant S188a Of Photosynthetic Glyceraldehyde-3- Phosphate Dehydrogenase A4 Isoform, Complexed With Nadp Length = 337 Back     alignment and structure
>pdb|3KSD|Q Chain Q, Crystal Structure Of C151s+h178n Mutant Of Glyceraldehyde-3-phosphate Dehydrogenase 1 (gapdh1) From Staphylococcus Aureus Mrsa252 Complexed With Nad At 2.2 Angstrom Resolution Length = 336 Back     alignment and structure
>pdb|1OBF|O Chain O, The Crystal Structure Of Glyceraldehyde 3-Phosphate Dehydrogenase From Alcaligenes Xylosoxidans At 1.7 Resolution. Length = 335 Back     alignment and structure
>pdb|3K2B|A Chain A, Crystal Structure Of Photosynthetic A4 Isoform Glyceraldehyde-3- Phosphate Dehydrogenase Complexed With Nad, From Arabidopsis Thaliana Length = 337 Back     alignment and structure
>pdb|2PKQ|O Chain O, Crystal Structure Of The Photosynthetic A2b2-Glyceraldehyde-3- Phosphate Dehydrogenase, Complexed With Nadp Length = 368 Back     alignment and structure
>pdb|2X5J|O Chain O, Crystal Structure Of The Apoform Of The D-Erythrose-4-Phosphate Dehydrogenase From E. Coli Length = 339 Back     alignment and structure
>pdb|2XF8|A Chain A, Structure Of The D-Erythrose-4-Phosphate Dehydrogenase From E.Coli In Complex With A Nad Cofactor Analog (3- Chloroacetyl Adenine Pyridine Dinucleotide) And Sulfate Anion Length = 338 Back     alignment and structure
>pdb|2X5K|O Chain O, Structure Of An Active Site Mutant Of The D-Erythrose-4-Phosphate Dehydrogenase From E. Coli Length = 339 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query364
3h9e_O346 Glyceraldehyde-3-phosphate dehydrogenase, testis-; 0.0
3pym_A332 GAPDH 3, glyceraldehyde-3-phosphate dehydrogenase 0.0
3cps_A354 Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, g 0.0
1u8f_O335 GAPDH, glyceraldehyde-3-phosphate dehydrogenase, l 0.0
3e5r_O337 PP38, glyceraldehyde-3-phosphate dehydrogenase, cy 0.0
2b4r_O345 Glyceraldehyde-3-phosphate dehydrogenase; SGPP, st 0.0
1gad_O330 D-glyceraldehyde-3-phosphate dehydrogenase; oxidor 0.0
3ids_C359 GAPDH, glyceraldehyde-3-phosphate dehydrogenase, g 0.0
3cmc_O334 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; m 0.0
3lvf_P338 GAPDH 1, glyceraldehyde-3-phosphate dehydrogenase 0.0
2g82_O331 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; G 0.0
4dib_A345 GAPDH, glyceraldehyde 3-phosphate dehydrogenase; n 0.0
2d2i_A380 Glyceraldehyde 3-phosphate dehydrogenase; rossmann 0.0
3hja_A356 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; n 0.0
3b1j_A339 Glyceraldehyde 3-phosphate dehydrogenase (NADP+); 0.0
1rm4_O337 Glyceraldehyde 3-phosphate dehydrogenase A; rossma 0.0
2ep7_A342 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; o 0.0
1hdg_O332 Holo-D-glyceraldehyde-3-phosphate dehydrogenase; o 0.0
3doc_A335 Glyceraldehyde 3-phosphate dehydrogenase; ssgcid, 0.0
2x5j_O339 E4PDH, D-erythrose-4-phosphate dehydrogenase; oxid 1e-179
1obf_O335 Glyceraldehyde 3-phosphate dehydrogenase; glycolyt 1e-175
1cf2_P337 Protein (glyceraldehyde-3-phosphate dehydrogenase) 1e-124
2yyy_A343 Glyceraldehyde-3-phosphate dehydrogenase; glyceral 1e-108
2czc_A334 Glyceraldehyde-3-phosphate dehydrogenase; glycolys 3e-97
1b7g_O340 Protein (glyceraldehyde 3-phosphate dehydrogenase; 1e-60
>3h9e_O Glyceraldehyde-3-phosphate dehydrogenase, testis-; oxidoreductase, structural genomics, structural genomics CON SGC, glycolysis, NAD; HET: NAD; 1.72A {Homo sapiens} PDB: 3pfw_O* 2vyn_D* 2vyv_D* Length = 346 Back     alignment and structure
 Score =  677 bits (1749), Expect = 0.0
 Identities = 217/334 (64%), Positives = 266/334 (79%), Gaps = 1/334 (0%)

Query: 1   MAYKIGINGFGRIGRLVLREALHRNTPVVGINDPHLSVDYLAYMLKYDSTHGRFKGDVKT 60
               +GINGFGRIGRLVLR  + +   VV +NDP +  +Y+ YM KYDSTHGR+KG V+ 
Sbjct: 6   RELTVGINGFGRIGRLVLRACMEKGVKVVAVNDPFIDPEYMVYMFKYDSTHGRYKGSVEF 65

Query: 61  EGNNIVVNGKKIAVFQKMKPEEIPWSQTGAEYIVESTGVFKTKDTASAHLKGGAKKVIIT 120
               +VV+  +I+V+Q  +P++IPW   G+ Y+VESTGV+ +   AS H+  GA++V+I+
Sbjct: 66  RNGQLVVDNHEISVYQCKEPKQIPWRAVGSPYVVESTGVYLSIQAASDHISAGAQRVVIS 125

Query: 121 APSKDAPMFVCGVNLDKYDP-SHSVVSNASCTTNCLAPLAKVIHDNFEILEGLMTTVHAV 179
           APS DAPMFV GVN + Y+P S ++VSNASCTTNCLAPLAKVIH+ F I+EGLMTTVH+ 
Sbjct: 126 APSPDAPMFVMGVNENDYNPGSMNIVSNASCTTNCLAPLAKVIHERFGIVEGLMTTVHSY 185

Query: 180 TATQKTVDAPSKKMWRDGRGANQNIIPASTGAAKAVAKVIPDLEGKLTGMAFRVPVPNVS 239
           TATQKTVD PS+K WRDGRGA+QNIIPASTGAAKAV KVIP+L+GKLTGMAFRVP P+VS
Sbjct: 186 TATQKTVDGPSRKAWRDGRGAHQNIIPASTGAAKAVTKVIPELKGKLTGMAFRVPTPDVS 245

Query: 240 VVDLTVRLCCDVTYDEIKAKVKAASQGPMKGILGYTEDEVVSSDFNGEVCSSVFDAKAGI 299
           VVDLT RL     Y  IK  VKAA++GPM GIL YTEDEVVS+DF G+  SS+FDAKAGI
Sbjct: 246 VVDLTCRLAQPAPYSAIKEAVKAAAKGPMAGILAYTEDEVVSTDFLGDTHSSIFDAKAGI 305

Query: 300 ALNKNFVKLVTWYDNEYGYSCRVLDLIQYMKSKD 333
           ALN NFVKL++WYDNEYGYS RV+DL++YM S+D
Sbjct: 306 ALNDNFVKLISWYDNEYGYSHRVVDLLRYMFSRD 339
>3pym_A GAPDH 3, glyceraldehyde-3-phosphate dehydrogenase 3; NAD(P)-binding rossmann-fold domain, alpha and beta protein, oxidoreductase; HET: NAD; 2.00A {Saccharomyces cerevisiae} PDB: 2i5p_O* Length = 332 Back     alignment and structure
>3cps_A Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, glycolysis, malaria, structural genomics; HET: NAD; 1.90A {Cryptosporidium parvum iowa II} PDB: 1vsv_A* 1vsu_A* 3chz_A 3cie_A* 3cif_A* 3sth_A* Length = 354 Back     alignment and structure
>1u8f_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase, liver; rossmann fold, oxidoreductase, mammalian GAPDH; HET: NAD; 1.75A {Homo sapiens} SCOP: c.2.1.3 d.81.1.1 PDB: 1znq_O* 1j0x_O* 3gpd_R* 1dss_G* 1crw_G* 1szj_G* 1ihx_A* 1ihy_A* 1gpd_G* 4gpd_1 Length = 335 Back     alignment and structure
>3e5r_O PP38, glyceraldehyde-3-phosphate dehydrogenase, cytosolic; GAPDH, RICE, oxidoreductase, cytoplasm, glycolysis, NAD; HET: NAD; 2.30A {Oryza sativa subsp} PDB: 3e6a_O Length = 337 Back     alignment and structure
>2b4r_O Glyceraldehyde-3-phosphate dehydrogenase; SGPP, structural genomics, PSI, structural genomi pathogenic protozoa consortium; HET: NAD AES; 2.25A {Plasmodium falciparum} SCOP: c.2.1.3 d.81.1.1 PDB: 2b4t_O* 1ywg_O* Length = 345 Back     alignment and structure
>1gad_O D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehyde(D)-NAD+(A)); HET: NAD; 1.80A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1dc4_A* 1dc3_A 1dc6_A* 1dc5_A* 1s7c_A* 1gae_O* 2vyn_A* 2vyv_A* Length = 330 Back     alignment and structure
>3ids_C GAPDH, glyceraldehyde-3-phosphate dehydrogenase, glycoso; irreversible inhibitor, protein-ligand complex,X-RAY, glycol NAD, oxireductase; HET: NAD; 1.80A {Trypanosoma cruzi} PDB: 1ml3_A* 1qxs_C* 3dmt_A* 1k3t_A* 2x0n_A* 1gga_O* 1i32_A* 1a7k_A* 1i33_A* 1gyp_A* 1gyq_A* Length = 359 Back     alignment and structure
>3cmc_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; microspectrophotometry, reaction intermediate, dehydrogenase phosphate binding site; HET: G3H NAD; 1.77A {Bacillus stearothermophilus} SCOP: c.2.1.3 d.81.1.1 PDB: 2gd1_O 1gd1_O* 1npt_O* 1nqa_O* 1nqo_O* 1nq5_O* 2dbv_O* 1dbv_O* 3dbv_O* 4dbv_O* Length = 334 Back     alignment and structure
>3lvf_P GAPDH 1, glyceraldehyde-3-phosphate dehydrogenase 1; oxidoreductase, glycolysis, rossmann fold; HET: NAD; 1.70A {Staphylococcus aureus} PDB: 3l6o_Q 3k73_Q 3lc2_O* 3lc7_O 3lc1_P* 3hq4_R* 3kv3_O* 3l4s_Q* 3k9q_Q* 3ksd_Q* 3ksz_O* Length = 338 Back     alignment and structure
>2g82_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; G3PDH, glycolysis, oxidoreductase, NAD, rossmann fold; HET: NAD PGE; 1.65A {Thermus aquaticus} SCOP: c.2.1.3 d.81.1.1 PDB: 1cer_O* 1vc2_A* Length = 331 Back     alignment and structure
>4dib_A GAPDH, glyceraldehyde 3-phosphate dehydrogenase; niaid, structural genomics, national institute of allergy AN infectious diseases; 2.55A {Bacillus anthracis} Length = 345 Back     alignment and structure
>2d2i_A Glyceraldehyde 3-phosphate dehydrogenase; rossmann fold, protein-NADP+ complex, oxidoreductase; HET: NAP; 2.50A {Synechococcus SP} PDB: 2duu_A Length = 380 Back     alignment and structure
>3hja_A GAPDH, glyceraldehyde-3-phosphate dehydrogenase; niaid, ssgcid, decode, UW, SBRI, LYME disease, non-hodgkin lymphomas, cytoplasm; HET: NAD; 2.20A {Borrelia burgdorferi B31} Length = 356 Back     alignment and structure
>3b1j_A Glyceraldehyde 3-phosphate dehydrogenase (NADP+); alpha/beta fold, oxidoreductase-protein binding complex; HET: NAD; 2.20A {Synechococcus elongatus} PDB: 3b1k_A* 3b20_A* Length = 339 Back     alignment and structure
>1rm4_O Glyceraldehyde 3-phosphate dehydrogenase A; rossmann fold, GAPDH-NADP complex, oxidoreductase; HET: NDP; 2.00A {Spinacia oleracea} SCOP: c.2.1.3 d.81.1.1 PDB: 1nbo_O* 2hki_A 2pkq_P* 1rm5_O* 1rm3_O* 2pkr_O* 1jn0_O* 3qv1_A* 3k2b_A* 3rvd_A* 2pkq_O* Length = 337 Back     alignment and structure
>2ep7_A GAPDH, glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase, structural genomics, NPPSFA; HET: NAD; 2.30A {Aquifex aeolicus} Length = 342 Back     alignment and structure
>1hdg_O Holo-D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehy(D)-NAD(A)); HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 Length = 332 Back     alignment and structure
>3doc_A Glyceraldehyde 3-phosphate dehydrogenase; ssgcid, structural genomics, PSI, protein structure initiative; HET: NAD; 2.40A {Brucella melitensis biovar ABORTUS2308} PDB: 3l0d_A* Length = 335 Back     alignment and structure
>2x5j_O E4PDH, D-erythrose-4-phosphate dehydrogenase; oxidoreductase, hydride transfer, aldehyde dehydrogenase, PY biosynthesis; 2.30A {Escherichia coli} PDB: 2xf8_A* 2x5k_O* Length = 339 Back     alignment and structure
>1obf_O Glyceraldehyde 3-phosphate dehydrogenase; glycolytic pathway, oxidoreductase, free-NAD GAPDH; HET: PG4; 1.7A {Achromobacter xylosoxidans} SCOP: c.2.1.3 d.81.1.1 PDB: 3gnq_A* Length = 335 Back     alignment and structure
>1cf2_P Protein (glyceraldehyde-3-phosphate dehydrogenase); oxydoreductase, oxidoreductase; HET: NAP; 2.10A {Methanothermus fervidus} SCOP: c.2.1.3 d.81.1.1 Length = 337 Back     alignment and structure
>2yyy_A Glyceraldehyde-3-phosphate dehydrogenase; glyceraldehyde 3-phosphate binding, alpha and beta proteins (A/B) class, MJ1146; HET: NAP; 1.85A {Methanocaldococcus jannaschii} Length = 343 Back     alignment and structure
>2czc_A Glyceraldehyde-3-phosphate dehydrogenase; glycolysis, NAD, oxidoreductase, structural genomics; HET: NAD; 2.00A {Pyrococcus horikoshii} SCOP: c.2.1.3 d.81.1.1 Length = 334 Back     alignment and structure
>1b7g_O Protein (glyceraldehyde 3-phosphate dehydrogenase; archaea, hyperthermophIle, GAPDH, hyperthermophilic dehydrog oxidoreductase; 2.05A {Sulfolobus solfataricus} SCOP: c.2.1.3 d.81.1.1 Length = 340 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query364
3pym_A332 GAPDH 3, glyceraldehyde-3-phosphate dehydrogenase 100.0
3v1y_O337 PP38, glyceraldehyde-3-phosphate dehydrogenase, cy 100.0
3h9e_O346 Glyceraldehyde-3-phosphate dehydrogenase, testis-; 100.0
4dib_A345 GAPDH, glyceraldehyde 3-phosphate dehydrogenase; n 100.0
3doc_A335 Glyceraldehyde 3-phosphate dehydrogenase; ssgcid, 100.0
3ids_C359 GAPDH, glyceraldehyde-3-phosphate dehydrogenase, g 100.0
3lvf_P338 GAPDH 1, glyceraldehyde-3-phosphate dehydrogenase 100.0
3hja_A356 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; n 100.0
2b4r_O345 Glyceraldehyde-3-phosphate dehydrogenase; SGPP, st 100.0
1obf_O335 Glyceraldehyde 3-phosphate dehydrogenase; glycolyt 100.0
2ep7_A342 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; o 100.0
2g82_O331 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; G 100.0
2d2i_A380 Glyceraldehyde 3-phosphate dehydrogenase; rossmann 100.0
1rm4_O337 Glyceraldehyde 3-phosphate dehydrogenase A; rossma 100.0
3b1j_A339 Glyceraldehyde 3-phosphate dehydrogenase (NADP+); 100.0
3cmc_O334 GAPDH, glyceraldehyde-3-phosphate dehydrogenase; m 100.0
3cps_A354 Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, g 100.0
1hdg_O332 Holo-D-glyceraldehyde-3-phosphate dehydrogenase; o 100.0
3e5r_O337 PP38, glyceraldehyde-3-phosphate dehydrogenase, cy 100.0
1gad_O330 D-glyceraldehyde-3-phosphate dehydrogenase; oxidor 100.0
2x5j_O339 E4PDH, D-erythrose-4-phosphate dehydrogenase; oxid 100.0
1u8f_O335 GAPDH, glyceraldehyde-3-phosphate dehydrogenase, l 100.0
2yyy_A343 Glyceraldehyde-3-phosphate dehydrogenase; glyceral 100.0
2yv3_A331 Aspartate-semialdehyde dehydrogenase; aspartate pa 100.0
2hjs_A340 USG-1 protein homolog; aspartate-semialdehyde dehy 100.0
2r00_A336 Aspartate-semialdehyde dehydrogenase; conformation 100.0
1cf2_P337 Protein (glyceraldehyde-3-phosphate dehydrogenase) 100.0
1t4b_A367 Aspartate-semialdehyde dehydrogenase; asadh, HOSR, 100.0
1b7g_O340 Protein (glyceraldehyde 3-phosphate dehydrogenase; 100.0
2czc_A334 Glyceraldehyde-3-phosphate dehydrogenase; glycolys 100.0
2ep5_A350 350AA long hypothetical aspartate-semialdehyde deh 100.0
1xyg_A359 Putative N-acetyl-gamma-glutamyl-phosphate reduct; 100.0
1ys4_A354 Aspartate-semialdehyde dehydrogenase; oxidoreducta 100.0
2ozp_A345 N-acetyl-gamma-glutamyl-phosphate reductase; amino 100.0
3pwk_A366 Aspartate-semialdehyde dehydrogenase; NADP binding 100.0
4dpk_A359 Malonyl-COA/succinyl-COA reductase; dinucleotide b 100.0
4dpl_A359 Malonyl-COA/succinyl-COA reductase; dinucleotide b 100.0
3pzr_A370 Aspartate-semialdehyde dehydrogenase; NADP, oxidor 100.0
3uw3_A377 Aspartate-semialdehyde dehydrogenase; structural g 100.0
3tz6_A344 Aspartate-semialdehyde dehydrogenase; asadh, ASD, 100.0
3hsk_A381 Aspartate-semialdehyde dehydrogenase; candida albi 100.0
3dr3_A337 N-acetyl-gamma-glutamyl-phosphate reductase; csgid 100.0
2nqt_A352 N-acetyl-gamma-glutamyl-phosphate reductase; apopr 100.0
1vkn_A351 N-acetyl-gamma-glutamyl-phosphate reductase; TM178 99.96
1nvm_B312 Acetaldehyde dehydrogenase (acylating), 4-hydroxy- 98.71
1f06_A320 MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH 97.71
3ezy_A344 Dehydrogenase; structural genomics, unknown functi 97.51
4hkt_A331 Inositol 2-dehydrogenase; structural genomics, nys 97.5
3mz0_A344 Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; 97.46
3bio_A304 Oxidoreductase, GFO/IDH/MOCA family; structural ge 97.44
3e18_A359 Oxidoreductase; dehydrogenase, NAD-binding, struct 97.4
3i23_A349 Oxidoreductase, GFO/IDH/MOCA family; structural ge 97.36
3gdo_A358 Uncharacterized oxidoreductase YVAA; structural ge 97.3
3euw_A344 MYO-inositol dehydrogenase; protein structure init 97.3
2dc1_A236 L-aspartate dehydrogenase; NAD, oxidoreductase; HE 97.28
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 97.28
3ohs_X334 Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; d 97.28
3mtj_A444 Homoserine dehydrogenase; rossmann-fold, PSI, MCSG 97.23
3db2_A354 Putative NADPH-dependent oxidoreductase; two domai 97.17
3kux_A352 Putative oxidoreductase; oxidoreductase family, cs 97.16
3f4l_A345 Putative oxidoreductase YHHX; structural genomics, 97.15
1p9l_A245 Dihydrodipicolinate reductase; oxidoreductase, lys 97.15
4f3y_A272 DHPR, dihydrodipicolinate reductase; structural ge 97.13
3qy9_A243 DHPR, dihydrodipicolinate reductase; rossmann fold 97.1
3ec7_A357 Putative dehydrogenase; alpha-beta, structural gen 97.07
2ho3_A325 Oxidoreductase, GFO/IDH/MOCA family; streptococcus 97.07
2ejw_A332 HDH, homoserine dehydrogenase; NAD-dependent, oxid 97.06
3ing_A325 Homoserine dehydrogenase; NP_394635.1, structural 97.06
3e82_A364 Putative oxidoreductase; NAD, GFO/IDH/MOCA family, 97.05
3moi_A387 Probable dehydrogenase; structural genomics, PSI2, 97.04
3rc1_A350 Sugar 3-ketoreductase; sugar biosynthesis, TDP bin 97.01
3ijp_A288 DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, 97.0
3c1a_A315 Putative oxidoreductase; ZP_00056571.1, oxidoreduc 96.98
3cea_A346 MYO-inositol 2-dehydrogenase; NP_786804.1, oxidore 96.97
1xea_A323 Oxidoreductase, GFO/IDH/MOCA family; structural ge 96.95
4had_A350 Probable oxidoreductase protein; structural genomi 96.94
3e9m_A330 Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, 96.9
3uuw_A308 Putative oxidoreductase with NAD(P)-binding rossm 96.88
3evn_A329 Oxidoreductase, GFO/IDH/MOCA family; structural ge 96.86
3q2i_A354 Dehydrogenase; rossmann fold, UDP-sugar binding, N 96.86
1tlt_A319 Putative oxidoreductase (virulence factor MVIM HO; 96.85
2ixa_A444 Alpha-N-acetylgalactosaminidase; NAD, A-ECO conver 96.85
4h3v_A390 Oxidoreductase domain protein; structural genomics 96.82
1ydw_A362 AX110P-like protein; structural genomics, protein 96.81
4gqa_A412 NAD binding oxidoreductase; structural genomics, P 96.8
3c8m_A331 Homoserine dehydrogenase; structural genomics, APC 96.78
1j5p_A253 Aspartate dehydrogenase; TM1643, structural genomi 96.75
4ew6_A330 D-galactose-1-dehydrogenase protein; nysgrc, PSI-b 96.73
3fhl_A362 Putative oxidoreductase; NAD-binding domain, PSI-2 96.72
3do5_A327 HOM, homoserine dehydrogenase; NP_069768.1, putati 96.64
1h6d_A433 Precursor form of glucose-fructose oxidoreductase; 96.62
3m2t_A359 Probable dehydrogenase; PSI, SGXNY, structural gen 96.62
3upl_A446 Oxidoreductase; rossmann fold, NADPH binding; 1.50 96.6
4fb5_A393 Probable oxidoreductase protein; PSI-biology, nysg 96.42
1zh8_A340 Oxidoreductase; TM0312, structural genomics, JO ce 96.32
3u3x_A361 Oxidoreductase; structural genomics, PSI-biology, 96.23
2glx_A332 1,5-anhydro-D-fructose reductase; NADP(H) dependen 96.2
2p2s_A336 Putative oxidoreductase; YP_050235.1, structural g 96.18
1r0k_A388 1-deoxy-D-xylulose 5-phosphate reductoisomerase; N 96.15
3ip3_A337 Oxidoreductase, putative; structural genomics, PSI 96.14
1dih_A273 Dihydrodipicolinate reductase; oxidoreductase; HET 96.1
1lc0_A294 Biliverdin reductase A; oxidoreductase, tetrapyrro 96.04
3ius_A286 Uncharacterized conserved protein; APC63810, silic 95.98
3oa2_A318 WBPB; oxidoreductase, sugar biosynthesis, dehydrog 95.92
3o9z_A312 Lipopolysaccaride biosynthesis protein WBPB; oxido 95.88
3dty_A398 Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetram 95.72
1ebf_A358 Homoserine dehydrogenase; dinucleotide, NAD, dimer 95.71
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 95.68
3v5n_A417 Oxidoreductase; structural genomics, PSI-biology, 95.61
2dt5_A211 AT-rich DNA-binding protein; REX, NADH, NAD, rossm 95.6
1y81_A138 Conserved hypothetical protein; hyperthermophIle, 95.51
2vt3_A215 REX, redox-sensing transcriptional repressor REX; 95.4
3btv_A438 Galactose/lactose metabolism regulatory protein GA 95.28
3ggo_A314 Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-b 95.24
2nvw_A479 Galactose/lactose metabolism regulatory protein GA 95.17
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 95.08
2r6j_A318 Eugenol synthase 1; phenylpropene, PIP reductase, 95.0
4gmf_A372 Yersiniabactin biosynthetic protein YBTU; rossmann 94.91
2bma_A470 Glutamate dehydrogenase (NADP+); malaria, drug des 94.9
3m2p_A311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 94.88
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 94.88
1qyd_A313 Pinoresinol-lariciresinol reductase; NADPH-depende 94.86
3a06_A376 1-deoxy-D-xylulose 5-phosphate reductoisomerase; M 94.83
2duw_A145 Putative COA-binding protein; ligand binding prote 94.79
3keo_A212 Redox-sensing transcriptional repressor REX; DNA b 94.71
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 94.66
3abi_A365 Putative uncharacterized protein PH1688; L-lysine 94.65
3d1l_A266 Putative NADP oxidoreductase BF3122; structural ge 94.64
3e48_A289 Putative nucleoside-diphosphate-sugar epimerase; a 94.58
2nu8_A288 Succinyl-COA ligase [ADP-forming] subunit alpha; c 94.39
3c1o_A321 Eugenol synthase; phenylpropene, PIP reductase, sh 94.37
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 94.33
3g0o_A303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 94.29
2d59_A144 Hypothetical protein PH1109; COA binding, structur 94.27
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 94.09
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 94.06
1qyc_A308 Phenylcoumaran benzylic ether reductase PT1; NADPH 93.82
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 93.75
1iuk_A140 Hypothetical protein TT1466; structural genomics, 93.74
3oqb_A383 Oxidoreductase; structural genomics, protein struc 93.68
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 93.68
3i6i_A346 Putative leucoanthocyanidin reductase 1; rossmann 93.68
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 93.26
3ff4_A122 Uncharacterized protein; structural genomics, PSI- 93.25
2yfq_A421 Padgh, NAD-GDH, NAD-specific glutamate dehydrogena 93.22
3r3j_A456 Glutamate dehydrogenase; rossman fold, oxidoreduct 93.14
1vm6_A228 DHPR, dihydrodipicolinate reductase; TM1520, struc 93.11
2tmg_A415 Protein (glutamate dehydrogenase); metabolic role, 93.01
1zej_A293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 92.91
3b1f_A290 Putative prephenate dehydrogenase; enzyme, 4-hydro 92.82
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 92.76
2gas_A307 Isoflavone reductase; NADPH-dependent reductase, o 92.72
1e6u_A321 GDP-fucose synthetase; epimerase/reductase, SDR, R 92.67
1ur5_A309 Malate dehydrogenase; oxidoreductase, tricarboxyli 92.47
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 92.32
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 92.2
3ego_A307 Probable 2-dehydropantoate 2-reductase; structural 92.19
3mog_A 483 Probable 3-hydroxybutyryl-COA dehydrogenase; struc 91.86
3aog_A440 Glutamate dehydrogenase; NAD(H), oxidoreducta; HET 91.85
1oi7_A288 Succinyl-COA synthetase alpha chain; SCS, ligase, 91.77
4fcc_A450 Glutamate dehydrogenase; protein complex, rossmann 91.73
2x4g_A342 Nucleoside-diphosphate-sugar epimerase; isomerase; 91.73
3aoe_E419 Glutamate dehydrogenase; rossmann fold, NADH, oxid 91.56
1bgv_A449 Glutamate dehydrogenase; oxidoreductase; HET: GLU; 91.38
1lss_A140 TRK system potassium uptake protein TRKA homolog; 91.21
1vpd_A299 Tartronate semialdehyde reductase; structural geno 91.16
3gt0_A247 Pyrroline-5-carboxylate reductase; structural geno 91.07
3pp8_A315 Glyoxylate/hydroxypyruvate reductase A; structural 91.05
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 90.88
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 90.73
2wm3_A299 NMRA-like family domain containing protein 1; unkn 90.64
1id1_A153 Putative potassium channel protein; RCK domain, E. 90.63
4g2n_A345 D-isomer specific 2-hydroxyacid dehydrogenase, Na; 90.56
3st7_A369 Capsular polysaccharide synthesis enzyme CAP5F; ro 90.5
3k92_A424 NAD-GDH, NAD-specific glutamate dehydrogenase; ROC 90.49
3evt_A324 Phosphoglycerate dehydrogenase; structural genomic 90.44
2pi1_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 90.43
3mw9_A501 GDH 1, glutamate dehydrogenase 1; allostery, inhib 90.42
2hjr_A328 Malate dehydrogenase; malaria, structural genomics 90.27
1gtm_A419 Glutamate dehydrogenase; oxidoreductase, NAD, NADP 90.25
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 90.14
3hg7_A324 D-isomer specific 2-hydroxyacid dehydrogenase FAM 90.11
1qp8_A303 Formate dehydrogenase; oxidoreductase; HET: NDP; 2 90.08
1xdw_A331 NAD+-dependent (R)-2-hydroxyglutarate dehydrogenas 90.04
2yq5_A343 D-isomer specific 2-hydroxyacid dehydrogenase; oxi 89.98
3kb6_A334 D-lactate dehydrogenase; oxidoreductase, D-LDH, NA 89.82
1dxy_A333 D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxyc 89.77
2g76_A335 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidor 89.71
3gg9_A352 D-3-phosphoglycerate dehydrogenase oxidoreductase; 89.63
3jtm_A351 Formate dehydrogenase, mitochondrial; mitochondrio 89.6
4ezb_A317 Uncharacterized conserved protein; structural geno 89.58
4ina_A405 Saccharopine dehydrogenase; structural genomics, P 89.54
3k6j_A460 Protein F01G10.3, confirmed by transcript evidenc; 89.53
1c1d_A355 L-phenylalanine dehydrogenase; amino acid dehydrog 89.5
4hy3_A365 Phosphoglycerate oxidoreductase; PSI-biology, stru 89.45
4id9_A347 Short-chain dehydrogenase/reductase; putative dehy 89.43
1lld_A319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 89.43
4e5n_A330 Thermostable phosphite dehydrogenase; D-2-hydroxya 89.34
3ce6_A494 Adenosylhomocysteinase; protein-substrate complex, 89.32
1mx3_A347 CTBP1, C-terminal binding protein 1; nuclear prote 89.3
4dgs_A340 Dehydrogenase; structural genomics, PSI-biology, N 89.26
1gdh_A320 D-glycerate dehydrogenase; oxidoreductase(CHOH (D) 89.25
2c5a_A379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 89.23
3gvx_A290 Glycerate dehydrogenase related protein; NYSGXRC, 89.18
2yv1_A294 Succinyl-COA ligase [ADP-forming] subunit alpha; C 89.16
3hwr_A318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 89.08
2cuk_A311 Glycerate dehydrogenase/glyoxylate reductase; stru 89.0
2i76_A276 Hypothetical protein; NADP, dehydrogenase, TM1727, 88.93
1zcj_A463 Peroxisomal bifunctional enzyme; peroxisomal multi 88.88
3c85_A183 Putative glutathione-regulated potassium-efflux S 88.77
2wtb_A725 MFP2, fatty acid multifunctional protein (ATMFP2); 88.75
1wwk_A307 Phosphoglycerate dehydrogenase; riken structural g 88.72
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 88.7
3fpc_A352 NADP-dependent alcohol dehydrogenase; oxydoreducta 88.66
1j4a_A333 D-LDH, D-lactate dehydrogenase; NAD-dependent dehy 88.56
2gcg_A330 Glyoxylate reductase/hydroxypyruvate reductase; NA 88.51
2ew2_A316 2-dehydropantoate 2-reductase, putative; alpha-str 88.46
3l9w_A413 Glutathione-regulated potassium-efflux system Pro 88.38
3ba1_A333 HPPR, hydroxyphenylpyruvate reductase; two domain 88.36
2ekl_A313 D-3-phosphoglycerate dehydrogenase; structural gen 88.35
2z2v_A365 Hypothetical protein PH1688; L-lysine dehydrogenas 88.28
3qha_A296 Putative oxidoreductase; seattle structural genomi 88.26
3oet_A381 Erythronate-4-phosphate dehydrogenase; structural 88.24
2o4c_A380 Erythronate-4-phosphate dehydrogenase; erythronate 88.23
2yv2_A297 Succinyl-COA synthetase alpha chain; COA-binding d 88.23
2w2k_A348 D-mandelate dehydrogenase; 2-hydroxyacid dehydroge 88.17
1y1p_A342 ARII, aldehyde reductase II; rossmann fold, short 88.14
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 88.03
1sc6_A404 PGDH, D-3-phosphoglycerate dehydrogenase; alloster 87.93
2d0i_A333 Dehydrogenase; structural genomics, NPPSFA, nation 87.73
2v6b_A304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 87.66
1yqd_A366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 87.65
2dbq_A334 Glyoxylate reductase; D-3-phosphoglycerate dehydro 87.57
2zcu_A286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 87.55
2nac_A393 NAD-dependent formate dehydrogenase; oxidoreductas 87.53
3oh8_A516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 87.45
3gg2_A450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 87.17
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 87.12
2j6i_A364 Formate dehydrogenase; oxidoreductase, D-specific- 87.06
3d0o_A317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 86.87
3d4o_A293 Dipicolinate synthase subunit A; NP_243269.1, stru 86.63
1yb4_A295 Tartronic semialdehyde reductase; structural genom 86.36
3l6d_A306 Putative oxidoreductase; structural genomics, prot 86.15
3k5p_A416 D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, 86.06
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 86.02
2ahr_A259 Putative pyrroline carboxylate reductase; pyrrolin 85.97
1guz_A310 Malate dehydrogenase; oxidoreductase, tricarboxyli 85.96
2jl1_A287 Triphenylmethane reductase; oxidoreductase, biorem 85.94
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 85.92
1t2d_A322 LDH-P, L-lactate dehydrogenase; ternary complex, o 85.88
1v9l_A421 Glutamate dehydrogenase; protein-NAD complex, oxid 85.82
2rir_A300 Dipicolinate synthase, A chain; structural genomic 85.8
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 85.78
2f1k_A279 Prephenate dehydrogenase; tyrosine synthesis, X-RA 85.76
4g65_A461 TRK system potassium uptake protein TRKA; structur 85.7
3i83_A320 2-dehydropantoate 2-reductase; structural genomics 85.66
4b4o_A298 Epimerase family protein SDR39U1; isomerase; HET: 85.49
3sc6_A287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 85.43
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 85.38
3cky_A301 2-hydroxymethyl glutarate dehydrogenase; rossmann 85.33
4gbj_A297 6-phosphogluconate dehydrogenase NAD-binding; stru 85.29
1y6j_A318 L-lactate dehydrogenase; southeast collaboratory f 85.25
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 84.8
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 84.7
2h78_A302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 84.58
1uuf_A369 YAHK, zinc-type alcohol dehydrogenase-like protein 84.56
3hn2_A312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 84.44
1z82_A335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 84.35
1ff9_A 450 Saccharopine reductase; lysine biosynthesis, alpha 84.27
3g17_A294 Similar to 2-dehydropantoate 2-reductase; structur 84.13
3p7m_A321 Malate dehydrogenase; putative dehydrogenase, enzy 84.07
3ip1_A404 Alcohol dehydrogenase, zinc-containing; structural 84.02
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 84.01
2pv7_A298 T-protein [includes: chorismate mutase (EC 5.4.99 83.98
3ktd_A341 Prephenate dehydrogenase; structural genomics, joi 83.79
3eag_A326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 83.68
3jv7_A345 ADH-A; dehydrogenase, nucleotide binding, rossmann 83.38
2axq_A 467 Saccharopine dehydrogenase; rossmann fold variant, 83.38
2gn4_A344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 83.31
2gf2_A296 Hibadh, 3-hydroxyisobutyrate dehydrogenase; struct 83.25
3uog_A363 Alcohol dehydrogenase; structural genomics, protei 83.23
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 83.16
4ej6_A370 Putative zinc-binding dehydrogenase; structural ge 83.14
1ygy_A529 PGDH, D-3-phosphoglycerate dehydrogenase; oxidored 82.97
2g5c_A281 Prephenate dehydrogenase; TYRA, oxidoreductase; HE 82.97
1bg6_A359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 82.81
2cvz_A289 Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; 82.78
1i36_A264 Conserved hypothetical protein MTH1747; NADP bindi 82.76
3vps_A321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 82.66
2x0j_A294 Malate dehydrogenase; oxidoreductase, hyperthermop 82.54
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 82.53
3dfu_A232 Uncharacterized protein from 6-phosphogluconate de 82.53
1wdk_A715 Fatty oxidation complex alpha subunit; alpha2BETA2 82.37
2rcy_A262 Pyrroline carboxylate reductase; malaria, structur 82.36
3g79_A478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 82.15
4e21_A358 6-phosphogluconate dehydrogenase (decarboxylating; 81.98
2ydy_A315 Methionine adenosyltransferase 2 subunit beta; oxi 81.93
2uyy_A316 N-PAC protein; long-chain dehydrogenase, cytokine; 81.92
2d8a_A348 PH0655, probable L-threonine 3-dehydrogenase; pyro 81.9
2yjz_A201 Metalloreductase steap4; oxidoreductase, metabolic 82.66
1ks9_A291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 81.81
1evy_A366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 81.75
1ldn_A316 L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA 81.7
3pdu_A287 3-hydroxyisobutyrate dehydrogenase family protein; 81.64
3d64_A494 Adenosylhomocysteinase; structural genomics, ssgci 81.17
1piw_A360 Hypothetical zinc-type alcohol dehydrogenase- like 81.12
3m6i_A363 L-arabinitol 4-dehydrogenase; medium chain dehydro 80.83
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 80.76
1leh_A364 Leucine dehydrogenase; oxidoreductase; 2.20A {Lysi 80.76
1yqg_A263 Pyrroline-5-carboxylate reductase; structural geno 80.31
2cf5_A357 Atccad5, CAD, cinnamyl alcohol dehydrogenase; lign 80.26
1np3_A338 Ketol-acid reductoisomerase; A DEEP figure-OF-eigh 80.22
2qyt_A317 2-dehydropantoate 2-reductase; APC81190, porphyrom 80.17
3nep_X314 Malate dehydrogenase; halophIle, molecular adpatat 80.11
>3pym_A GAPDH 3, glyceraldehyde-3-phosphate dehydrogenase 3; NAD(P)-binding rossmann-fold domain, alpha and beta protein, oxidoreductase; HET: NAD; 2.00A {Saccharomyces cerevisiae} PDB: 2i5p_O* Back     alignment and structure
Probab=100.00  E-value=3.6e-125  Score=918.50  Aligned_cols=329  Identities=64%  Similarity=1.030  Sum_probs=324.6

Q ss_pred             ceEEEEccChHHHHHHHHHhcC-CCcEEEEeCCCCCHHHHHHHhhcccccccCCcceeecCCeEEECCEEEEEEecCCCC
Q psy8544           3 YKIGINGFGRIGRLVLREALHR-NTPVVGINDPHLSVDYLAYMLKYDSTHGRFKGDVKTEGNNIVVNGKKIAVFQKMKPE   81 (364)
Q Consensus         3 irVaInG~G~IGr~vlr~l~~~-~~~ivaInd~~~~~~~~a~ll~ydS~~g~~~~~v~~~~~~l~i~gk~I~v~~~~~p~   81 (364)
                      +||||||||||||+++|+++++ +++||||||+++|+++++|||||||+||+|+++++.++++|.|||++|+++++++|+
T Consensus         2 ~kv~INGfGrIGr~v~R~~~~~~~~~ivaiNd~~~d~~~~a~l~kyDS~hG~f~~~v~~~~~~l~i~Gk~I~v~~e~dp~   81 (332)
T 3pym_A            2 VRVAINGFGRIGRLVMRIALSRPNVEVVALNDPFITNDYAAYMFKYDSTHGRYAGEVSHDDKHIIVDGKKIATYQERDPA   81 (332)
T ss_dssp             CEEEEECCSHHHHHHHHHHHHSTTCEEEEEECTTCCHHHHHHHHHCCTTTCSCSSCEEECSSEEEETTEEEEEECCSSGG
T ss_pred             eEEEEECCCcHHHHHHHHHHhCCCcEEEEEeCCCCCHHHHHHHhcccCCCCCCCCcEEEcCCEEEECCEEEEEEeecccc
Confidence            7999999999999999999998 999999999988999999999999999999999999999999999999999999999


Q ss_pred             CCCCcCCCccEEEeecCCCCCHhhHHHHHhCCCCEEEEeCCCCCCCeEEcccCccccCCCCCeEecCCchhhhHHhHHHH
Q psy8544          82 EIPWSQTGAEYIVESTGVFKTKDTASAHLKGGAKKVIITAPSKDAPMFVCGVNLDKYDPSHSVVSNASCTTNCLAPLAKV  161 (364)
Q Consensus        82 ~~~w~~~gvDiV~estG~f~s~e~a~~hl~aGakkVIIsaps~d~p~vV~gVN~~~~~~~~~IISnaSCTTn~Lap~lk~  161 (364)
                      +++|++.|+||||||||.|+++|+|+.|+++||||||||+|++|+||||||||++.|+++++||||||||||||+|++|+
T Consensus        82 ~i~w~~~gvDiVlesTG~f~s~e~a~~hl~aGAkkViIsaps~d~p~vV~gVN~~~~~~~~~IISnasCTTn~Lap~lkv  161 (332)
T 3pym_A           82 NLPWGSSNVDIAIDSTGVFKELDTAQKHIDAGAKKVVITAPSSTAPMFVMGVNEEKYTSDLKIVSNASCTTNCLAPLAKV  161 (332)
T ss_dssp             GSCTTTTTCSEEEECSSSSCSHHHHHHHHHTTCSEEEESSCCSSSCBCCTTTTGGGCCTTCCEEECCCHHHHHHHHHHHH
T ss_pred             cCCccccCccEEEEecccccCHHHHHHHHHcCCCEEEECCCCCCCCeEeeccchhhcCccccEEecCcchhhhhHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999998889999999999999999999


Q ss_pred             HhhhcCeeEEEEEeeeccccchhhhcCCCcccccccccccceeecCCCChHHHHHHHccCCCCceeeEEEeceeccceEE
Q psy8544         162 IHDNFEILEGLMTTVHAVTATQKTVDAPSKKMWRDGRGANQNIIPASTGAAKAVAKVIPDLEGKLTGMAFRVPVPNVSVV  241 (364)
Q Consensus       162 L~d~fGI~~~~~TTvha~t~~q~~~D~~~~~d~r~~r~~a~NIIP~~tGaak~~~kVlPeL~gki~~~avRVPv~~gs~~  241 (364)
                      |||+|||++++||||||+|++|+++|+|+++|||++|++++||||++||++|+++||||+|+||++|||+||||+++|++
T Consensus       162 L~d~fGI~~g~mTTvha~T~~Q~~vDg~~~kd~r~~r~aa~NiIP~~tGaakav~kVlPeL~gkltg~avRVPv~~~s~~  241 (332)
T 3pym_A          162 INDAFGIEEGLMTTVHSLTATQKTVDGPSHKDWRGGRTASGNIIPSSTGAAKAVGKVLPELQGKLTGMAFRVPTVDVSVV  241 (332)
T ss_dssp             HHHHHCEEEEEEEEEEECCTTSCSSSCCCTTCTGGGSCGGGCCEEEECSHHHHHHHHSGGGTTSEEEEEEEESCSSCEEE
T ss_pred             HHHhcCeEEEEEEEEeeccccchhccCCCcccCccccchhhcccCCCCChHHHHHHhhhhhcCCEEEEEEEcCCCCcEee
Confidence            99999999999999999999999999998899999999999999999999999999999999999999999999999999


Q ss_pred             EEEEEeccCCCHHHHHHHHHHccCCCCCccccccCCceEeecCCCCCceeEEecCCcceecCceEEEEEEecCCCcchhh
Q psy8544         242 DLTVRLCCDVTYDEIKAKVKAASQGPMKGILGYTEDEVVSSDFNGEVCSSVFDAKAGIALNKNFVKLVTWYDNEYGYSCR  321 (364)
Q Consensus       242 dl~~~l~k~~s~eei~~~l~~a~~~~lkgil~~~e~~~VS~df~~~~~s~i~d~~~~~~~~~~~~kl~~WyDNE~gys~r  321 (364)
                      ||+++|+|++++|||+++|++|+||+|||||+|+|+|+||+||+||+||||||+.+|++++++|+||++|||||||||||
T Consensus       242 dlt~~lek~~t~eei~~~lk~a~~g~lkgil~yte~~~VS~Df~~~~~ssi~d~~~~~~~~~~~vk~~~WYDNE~gys~r  321 (332)
T 3pym_A          242 DLTVKLNKETTYDEIKKVVKAAAEGKLKGVLGYTEDAVVSSDFLGDSHSSIFDASAGIQLSPKFVKLVSWYDNEYGYSTR  321 (332)
T ss_dssp             EEEEEESSCCCHHHHHHHHHHHHHTTTTTTEEEECSCCCGGGGTTCCCSEEEEGGGCEEEETTEEEEEEEECTTHHHHHH
T ss_pred             EEEEEECCcCCHHHHHHHHHHhccCccCceeEEEcCCeEeeccCCCCcceEEccccccccCCCEEEEEEEECCccchHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhHHHHHHhc
Q psy8544         322 VLDLIQYMKS  331 (364)
Q Consensus       322 ~~dl~~~~~~  331 (364)
                      |+||+.||.+
T Consensus       322 ~~dl~~~~~~  331 (332)
T 3pym_A          322 VVDLVEHVAK  331 (332)
T ss_dssp             HHHHHHHHHH
T ss_pred             HHHHHHHHhc
Confidence            9999999975
>3v1y_O PP38, glyceraldehyde-3-phosphate dehydrogenase, cytosol; rossmann fold; HET: NAD; 1.86A {Oryza sativa japonica group} PDB: 3e5r_O* 3e6a_O Back     alignment and structure
>3h9e_O Glyceraldehyde-3-phosphate dehydrogenase, testis-; oxidoreductase, structural genomics, structural genomics CON SGC, glycolysis, NAD; HET: NAD; 1.72A {Homo sapiens} PDB: 3pfw_O* 2vyn_D* 2vyv_D* Back     alignment and structure
>4dib_A GAPDH, glyceraldehyde 3-phosphate dehydrogenase; niaid, structural genomics, national institute of allergy AN infectious diseases; 2.55A {Bacillus anthracis} Back     alignment and structure
>3doc_A Glyceraldehyde 3-phosphate dehydrogenase; ssgcid, structural genomics, PSI, protein structure initiative; HET: NAD; 2.40A {Brucella melitensis biovar ABORTUS2308} PDB: 3l0d_A* Back     alignment and structure
>3ids_C GAPDH, glyceraldehyde-3-phosphate dehydrogenase, glycoso; irreversible inhibitor, protein-ligand complex,X-RAY, glycol NAD, oxireductase; HET: NAD; 1.80A {Trypanosoma cruzi} PDB: 1ml3_A* 1qxs_C* 3dmt_A* 1k3t_A* 2x0n_A* 1gga_O* 1i32_A* 1a7k_A* 1i33_A* 1gyp_A* 1gyq_A* Back     alignment and structure
>3lvf_P GAPDH 1, glyceraldehyde-3-phosphate dehydrogenase 1; oxidoreductase, glycolysis, rossmann fold; HET: NAD; 1.70A {Staphylococcus aureus} PDB: 3vaz_P* 3l6o_Q 3k73_Q 3lc2_O* 3lc7_O 3lc1_P* 3hq4_R* 3kv3_O* 3l4s_Q* 3k9q_Q* 3ksd_Q* 3ksz_O* Back     alignment and structure
>3hja_A GAPDH, glyceraldehyde-3-phosphate dehydrogenase; niaid, ssgcid, decode, UW, SBRI, LYME disease, non-hodgkin lymphomas, cytoplasm; HET: NAD; 2.20A {Borrelia burgdorferi B31} Back     alignment and structure
>2b4r_O Glyceraldehyde-3-phosphate dehydrogenase; SGPP, structural genomics, PSI, structural genomi pathogenic protozoa consortium; HET: NAD AES; 2.25A {Plasmodium falciparum} SCOP: c.2.1.3 d.81.1.1 PDB: 2b4t_O* 1ywg_O* Back     alignment and structure
>1obf_O Glyceraldehyde 3-phosphate dehydrogenase; glycolytic pathway, oxidoreductase, free-NAD GAPDH; HET: PG4; 1.7A {Achromobacter xylosoxidans} SCOP: c.2.1.3 d.81.1.1 PDB: 3gnq_A* Back     alignment and structure
>2ep7_A GAPDH, glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase, structural genomics, NPPSFA; HET: NAD; 2.30A {Aquifex aeolicus} Back     alignment and structure
>2g82_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; G3PDH, glycolysis, oxidoreductase, NAD, rossmann fold; HET: NAD PGE; 1.65A {Thermus aquaticus} SCOP: c.2.1.3 d.81.1.1 PDB: 1cer_O* 1vc2_A* Back     alignment and structure
>2d2i_A Glyceraldehyde 3-phosphate dehydrogenase; rossmann fold, protein-NADP+ complex, oxidoreductase; HET: NAP; 2.50A {Synechococcus SP} PDB: 2duu_A Back     alignment and structure
>1rm4_O Glyceraldehyde 3-phosphate dehydrogenase A; rossmann fold, GAPDH-NADP complex, oxidoreductase; HET: NDP; 2.00A {Spinacia oleracea} SCOP: c.2.1.3 d.81.1.1 PDB: 1nbo_O* 2hki_A 2pkq_P* 1rm5_O* 1rm3_O* 2pkr_O* 1jn0_O* 3qv1_A* 3k2b_A* 3rvd_A* 2pkq_O* Back     alignment and structure
>3b1j_A Glyceraldehyde 3-phosphate dehydrogenase (NADP+); alpha/beta fold, oxidoreductase-protein binding complex; HET: NAD; 2.20A {Synechococcus elongatus} PDB: 3b1k_A* 3b20_A* Back     alignment and structure
>3cmc_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase; microspectrophotometry, reaction intermediate, dehydrogenase phosphate binding site; HET: G3H NAD; 1.77A {Bacillus stearothermophilus} SCOP: c.2.1.3 d.81.1.1 PDB: 2gd1_O 1gd1_O* 1npt_O* 1nqa_O* 1nqo_O* 1nq5_O* 2dbv_O* 1dbv_O* 3dbv_O* 4dbv_O* Back     alignment and structure
>3cps_A Glyceraldehyde 3-phosphate dehydrogenase; GAPDH, glycolysis, malaria, structural genomics; HET: NAD; 1.90A {Cryptosporidium parvum iowa II} PDB: 1vsv_A* 1vsu_A* 3chz_A 3cie_A* 3cif_A* 3sth_A* Back     alignment and structure
>1hdg_O Holo-D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehy(D)-NAD(A)); HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>3e5r_O PP38, glyceraldehyde-3-phosphate dehydrogenase, cytosolic; GAPDH, RICE, oxidoreductase, cytoplasm, glycolysis, NAD; HET: NAD; 2.30A {Oryza sativa subsp} PDB: 3e6a_O Back     alignment and structure
>1gad_O D-glyceraldehyde-3-phosphate dehydrogenase; oxidoreductase (aldehyde(D)-NAD+(A)); HET: NAD; 1.80A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1dc4_A* 1dc3_A 1dc6_A* 1dc5_A* 1s7c_A* 1gae_O* 2vyn_A* 2vyv_A* Back     alignment and structure
>2x5j_O E4PDH, D-erythrose-4-phosphate dehydrogenase; oxidoreductase, hydride transfer, aldehyde dehydrogenase, PY biosynthesis; 2.30A {Escherichia coli} PDB: 2xf8_A* 2x5k_O* Back     alignment and structure
>1u8f_O GAPDH, glyceraldehyde-3-phosphate dehydrogenase, liver; rossmann fold, oxidoreductase, mammalian GAPDH; HET: NAD; 1.75A {Homo sapiens} SCOP: c.2.1.3 d.81.1.1 PDB: 1znq_O* 1j0x_O* 3gpd_R* 1dss_G* 1crw_G* 1szj_G* 1ihx_A* 1ihy_A* 1gpd_G* 4gpd_1 Back     alignment and structure
>2yyy_A Glyceraldehyde-3-phosphate dehydrogenase; glyceraldehyde 3-phosphate binding, alpha and beta proteins (A/B) class, MJ1146; HET: NAP; 1.85A {Methanocaldococcus jannaschii} Back     alignment and structure
>2yv3_A Aspartate-semialdehyde dehydrogenase; aspartate pathway, structural genomics; 2.70A {Thermus thermophilus} Back     alignment and structure
>2hjs_A USG-1 protein homolog; aspartate-semialdehyde dehydrogenase, probable hydrolase, PS aeruginosa, structurual genomics; 2.20A {Pseudomonas aeruginosa} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>2r00_A Aspartate-semialdehyde dehydrogenase; conformational change, half-OF-sites-reactivity, protein evolution, sequence homology; HET: HTI; 2.03A {Vibrio cholerae} PDB: 2qz9_A* 2r00_C* Back     alignment and structure
>1cf2_P Protein (glyceraldehyde-3-phosphate dehydrogenase); oxydoreductase, oxidoreductase; HET: NAP; 2.10A {Methanothermus fervidus} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>1t4b_A Aspartate-semialdehyde dehydrogenase; asadh, HOSR, lysine biosynthesis, NADP+ oxidoreductase (phosphorylating), domain movement; 1.60A {Escherichia coli} SCOP: c.2.1.3 d.81.1.1 PDB: 1t4d_A 1brm_A 1gl3_A* 1nwc_A 1ta4_A 1tb4_A 1ps8_A 1pr3_A 1oza_A 1pqu_A* 1pqp_A 1nwh_A* 1nx6_A* 1pu2_A* 1q2x_A* Back     alignment and structure
>1b7g_O Protein (glyceraldehyde 3-phosphate dehydrogenase; archaea, hyperthermophIle, GAPDH, hyperthermophilic dehydrog oxidoreductase; 2.05A {Sulfolobus solfataricus} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>2czc_A Glyceraldehyde-3-phosphate dehydrogenase; glycolysis, NAD, oxidoreductase, structural genomics; HET: NAD; 2.00A {Pyrococcus horikoshii} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>2ep5_A 350AA long hypothetical aspartate-semialdehyde dehydrogenase; oxidoreductase, structural genomics, NPPSFA; 2.40A {Sulfolobus tokodaii} Back     alignment and structure
>1xyg_A Putative N-acetyl-gamma-glutamyl-phosphate reduct; structural genomics, protein structure initiative, CENT eukaryotic structural genomics; 2.19A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.1 PDB: 2q49_A 2cvo_A Back     alignment and structure
>1ys4_A Aspartate-semialdehyde dehydrogenase; oxidoreductase, asadh; HET: NAP; 2.29A {Methanocaldococcus jannaschii} Back     alignment and structure
>2ozp_A N-acetyl-gamma-glutamyl-phosphate reductase; amino acid biosynthesis, structural genomics, riken structur genomics/proteomics initiative; 2.01A {Thermus thermophilus} Back     alignment and structure
>3pwk_A Aspartate-semialdehyde dehydrogenase; NADP binding, oxidoreductase-oxidoreductase I complex; HET: 25A L14; 1.50A {Streptococcus pneumoniae} PDB: 2gyy_A* 2gz2_A* 2gz3_A* 2gz1_A* 3pws_A* 3pyl_A 3pyx_A* 3pzb_A* 3q11_A* 3q1l_A Back     alignment and structure
>4dpk_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; 2.05A {Sulfolobus tokodaii} PDB: 4dpm_A* Back     alignment and structure
>4dpl_A Malonyl-COA/succinyl-COA reductase; dinucleotide binding, dimerization domain, NADP, oxidoreductase; HET: NAP; 1.90A {Sulfolobus tokodaii} PDB: 4dpk_A* 4dpm_A* Back     alignment and structure
>3pzr_A Aspartate-semialdehyde dehydrogenase; NADP, oxidoreductase-oxidoreductase inhibitor complex; HET: NAP; 1.75A {Vibrio cholerae} PDB: 1mc4_A 1mb4_A* 3q0e_A Back     alignment and structure
>3uw3_A Aspartate-semialdehyde dehydrogenase; structural genomics, seattle structural genomics center for infectious disease (ssgcid); 1.55A {Burkholderia thailandensis} Back     alignment and structure
>3tz6_A Aspartate-semialdehyde dehydrogenase; asadh, ASD, ASA, amino-acid biosynthesis, diaminopimelate biosynthesis, lysine biosynthesis; HET: SO4; 1.95A {Mycobacterium tuberculosis} PDB: 3vos_A* 3kub_A 3llg_A Back     alignment and structure
>3hsk_A Aspartate-semialdehyde dehydrogenase; candida albicans NADP complex, amino-acid biosynthesis; HET: NAP; 2.20A {Candida albicans} Back     alignment and structure
>3dr3_A N-acetyl-gamma-glutamyl-phosphate reductase; csgid target, ARGC, essential gene, amino-acid biosynthesis, arginine biosynthesis, cytoplasm; HET: MLT; 2.00A {Shigella flexneri} PDB: 2g17_A Back     alignment and structure
>2nqt_A N-acetyl-gamma-glutamyl-phosphate reductase; apoprotein, dimer, rossmann fold, structural genomics, PSI, protein structure initiative; 1.58A {Mycobacterium tuberculosis} PDB: 2i3a_A* 2i3g_A Back     alignment and structure
>1vkn_A N-acetyl-gamma-glutamyl-phosphate reductase; TM1782, structu genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; 1.80A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>1nvm_B Acetaldehyde dehydrogenase (acylating), 4-hydroxy-2-oxovalerate aldolase; sequestered tunnel, substrate channeling; HET: NAD; 1.70A {Pseudomonas SP} SCOP: c.2.1.3 d.81.1.1 Back     alignment and structure
>1f06_A MESO-diaminopimelate D-dehydrogenase; enzyme-NADPH-inhibitor ternary complex, oxidoreductase; HET: NDP 2NP; 2.10A {Corynebacterium glutamicum} SCOP: c.2.1.3 d.81.1.3 PDB: 1dap_A* 2dap_A* 3dap_A* Back     alignment and structure
>3ezy_A Dehydrogenase; structural genomics, unknown function, PSI-2, protein structure initiative; 2.04A {Thermotoga maritima} Back     alignment and structure
>4hkt_A Inositol 2-dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium, oxidoreductase; HET: MSE; 2.00A {Sinorhizobium meliloti} Back     alignment and structure
>3mz0_A Inositol 2-dehydrogenase/D-chiro-inositol 3-dehyd; MYO-inositol dehydrogenase, bsidh, oxidoreductase; HET: MSE PGE; 1.54A {Bacillus subtilis} PDB: 3nt2_A* 3nt4_A* 3nt5_A* 3nto_A* 3ntq_A* 3ntr_A* Back     alignment and structure
>3bio_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, MCSG, PSI-2, GFO/IDH/MO family, protein structure initiative; HET: MSE EPE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>3e18_A Oxidoreductase; dehydrogenase, NAD-binding, structural genom protein structure initiative, PSI, NEW YORK structural GENO research consortium; HET: NAD; 1.95A {Listeria innocua} Back     alignment and structure
>3i23_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium; 2.30A {Enterococcus faecalis} PDB: 3fd8_A* 3hnp_A Back     alignment and structure
>3gdo_A Uncharacterized oxidoreductase YVAA; structural genomics, putative oxidoreductase YVAA, oxidoredu PSI-2, protein structure initiative; 2.03A {Bacillus subtilis subsp} PDB: 3gfg_A Back     alignment and structure
>3euw_A MYO-inositol dehydrogenase; protein structure initiative II (PSI II), NYSGXRC, MYO-inosi dehydrogenase, oxidoreductase, tetramer; 2.30A {Corynebacterium glutamicum} Back     alignment and structure
>2dc1_A L-aspartate dehydrogenase; NAD, oxidoreductase; HET: CIT NAD; 1.90A {Archaeoglobus fulgidus} Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>3ohs_X Trans-1,2-dihydrobenzene-1,2-DIOL dehydrogenase; dimeric dihydrodiol dehydrogenase, MDD, oxidoreductase; 1.90A {Macaca fascicularis} PDB: 2o48_X 2poq_X* 2o4u_X Back     alignment and structure
>3mtj_A Homoserine dehydrogenase; rossmann-fold, PSI, MCSG, structural genomics, midwest cente structural genomics; 2.15A {Thiobacillus denitrificans} Back     alignment and structure
>3db2_A Putative NADPH-dependent oxidoreductase; two domain protein, rossman fold, putative dehydrogenase, ST genomics; 1.70A {Desulfitobacterium hafniense dcb-2} Back     alignment and structure
>3kux_A Putative oxidoreductase; oxidoreductase family, csgid, structural genomics, center FO structural genomics of infectious diseases; HET: MSE; 2.75A {Yersinia pestis} Back     alignment and structure
>3f4l_A Putative oxidoreductase YHHX; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.00A {Escherichia coli k-12} Back     alignment and structure
>1p9l_A Dihydrodipicolinate reductase; oxidoreductase, lysine biosynthesis, NADH binding specificity, TB structural genomics consortium; HET: NAD PDC PG4; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.3 d.81.1.3 PDB: 1c3v_A* 1yl5_A 1yl7_A* 1yl6_A* Back     alignment and structure
>4f3y_A DHPR, dihydrodipicolinate reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Burkholderia thailandensis} Back     alignment and structure
>3qy9_A DHPR, dihydrodipicolinate reductase; rossmann fold, NADH, NADPH, oxidoreductase; 1.80A {Staphylococcus aureus} Back     alignment and structure
>3ec7_A Putative dehydrogenase; alpha-beta, structural genomics, PSI-2, protein structure in midwest center for structural genomics, MCSG; HET: MSE NAD EPE; 2.15A {Salmonella typhimurium} Back     alignment and structure
>2ejw_A HDH, homoserine dehydrogenase; NAD-dependent, oxidoreductase; 1.70A {Thermus thermophilus} Back     alignment and structure
>3ing_A Homoserine dehydrogenase; NP_394635.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: NDP; 1.95A {Thermoplasma acidophilum} Back     alignment and structure
>3e82_A Putative oxidoreductase; NAD, GFO/IDH/MOCA family, PSI-2, NYSGXRC, 11136F, structural genomics, protein structure initiative; 2.04A {Klebsiella pneumoniae subsp} Back     alignment and structure
>3moi_A Probable dehydrogenase; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics; 2.50A {Bordetella bronchiseptica} Back     alignment and structure
>3rc1_A Sugar 3-ketoreductase; sugar biosynthesis, TDP binding, NADP binding binding protein; HET: TLO NAP; 1.71A {Actinomadura kijaniata} PDB: 3rbv_A* 3rc2_A* 3rcb_A* 3rc7_A* 3rc9_A* Back     alignment and structure
>3ijp_A DHPR, dihydrodipicolinate reductase; ssgcid, SBRI, decode biostructures, niaid, amino-acid biosynthesis, cytoplasm; HET: NAP; 2.30A {Bartonella henselae} Back     alignment and structure
>3c1a_A Putative oxidoreductase; ZP_00056571.1, oxidoreductase FAM binding rossmann fold, structural genomics; HET: MSE PG4 PGE; 1.85A {Magnetospirillum magnetotacticum} Back     alignment and structure
>3cea_A MYO-inositol 2-dehydrogenase; NP_786804.1, oxidoreductase FA NAD-binding rossmann fold, structural genomics; HET: NAD; 2.40A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>1xea_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics, protein structure initiative, NYSGXRC, VCA1048, GFO/IDH/MOCA family oxidoreductase; 2.65A {Vibrio cholerae} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>4had_A Probable oxidoreductase protein; structural genomics, protein structure initiative, nysgrc, PSI-biology; 2.00A {Rhizobium etli} Back     alignment and structure
>3e9m_A Oxidoreductase, GFO/IDH/MOCA family; GFO/LDH/MOCA, PSI-II, dimeric dihydodiol dehydrogenase, structural genomics; 2.70A {Enterococcus faecalis} Back     alignment and structure
>3uuw_A Putative oxidoreductase with NAD(P)-binding rossm domain; structural genomics, center for structural genomics of infec diseases, csgid; HET: 1PE PGE; 1.63A {Clostridium difficile} Back     alignment and structure
>3evn_A Oxidoreductase, GFO/IDH/MOCA family; structural genomics; 2.00A {Streptococcus agalactiae serogroup V} Back     alignment and structure
>3q2i_A Dehydrogenase; rossmann fold, UDP-sugar binding, NAD binding oxidoreductase; HET: NAD HP7; 1.50A {Chromobacterium violaceum} PDB: 3q2k_A* Back     alignment and structure
>1tlt_A Putative oxidoreductase (virulence factor MVIM HO; structural genomics, NYSGXRC, PSI, protein structure initiative; 2.70A {Escherichia coli} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>2ixa_A Alpha-N-acetylgalactosaminidase; NAD, A-ECO conversion, hydrolase; HET: NAD; 2.3A {Flavobacterium meningosepticum} PDB: 2ixb_A* Back     alignment and structure
>4h3v_A Oxidoreductase domain protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MSE; 1.68A {Kribbella flavida} Back     alignment and structure
>1ydw_A AX110P-like protein; structural genomics, protein structure initiative, center for eukaryotic structural genomics, CESG, AT4G09670; 2.49A {Arabidopsis thaliana} SCOP: c.2.1.3 d.81.1.5 PDB: 2q4e_A Back     alignment and structure
>4gqa_A NAD binding oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: MSE; 2.42A {Klebsiella pneumoniae} Back     alignment and structure
>3c8m_A Homoserine dehydrogenase; structural genomics, APC89447, PS protein structure initiative, midwest center for structural genomics; HET: MSE; 1.90A {Thermoplasma volcanium GSS1} PDB: 3jsa_A* Back     alignment and structure
>1j5p_A Aspartate dehydrogenase; TM1643, structural genomics, JCSG, protein structure initiative, joint center for structural G oxidoreductase; HET: NAD; 1.90A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.3 PDB: 1h2h_A* Back     alignment and structure
>4ew6_A D-galactose-1-dehydrogenase protein; nysgrc, PSI-biology, structural genomics, NEW YORK structura genomics research consortium, two domain; 2.30A {Rhizobium etli} Back     alignment and structure
>3fhl_A Putative oxidoreductase; NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 1.93A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>3do5_A HOM, homoserine dehydrogenase; NP_069768.1, putative homoserine dehydrogenase, structural G joint center for structural genomics, JCSG; 2.20A {Archaeoglobus fulgidus} Back     alignment and structure
>1h6d_A Precursor form of glucose-fructose oxidoreductase; protein translocation, periplasmic oxidoreductase, signal peptide, ligand binding,; HET: NDP; 2.05A {Zymomonas mobilis} SCOP: c.2.1.3 d.81.1.5 PDB: 1h6b_A* 1h6a_A* 1h6c_A* 1ryd_A* 1rye_A* 1ofg_A* 1evj_A* Back     alignment and structure
>3m2t_A Probable dehydrogenase; PSI, SGXNY, structural genomics, protein structure initiative; HET: NAD; 2.30A {Chromobacterium violaceum} Back     alignment and structure
>3upl_A Oxidoreductase; rossmann fold, NADPH binding; 1.50A {Brucella melitensis biovar abortus 230ORGANISM_TAXID} PDB: 3upy_A* Back     alignment and structure
>4fb5_A Probable oxidoreductase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, GFO/IDH/MOCA family; 2.61A {Rhizobium etli} Back     alignment and structure
>1zh8_A Oxidoreductase; TM0312, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI; HET: MSE NAP; 2.50A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.5 Back     alignment and structure
>3u3x_A Oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.79A {Sinorhizobium meliloti} Back     alignment and structure
>2glx_A 1,5-anhydro-D-fructose reductase; NADP(H) dependent reductase, rossmann-fold, sugar metabolism, 1,5-anhydro-D-mannitol, oxidoreductase; HET: NDP; 2.20A {Ensifer adhaerens} Back     alignment and structure
>2p2s_A Putative oxidoreductase; YP_050235.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.25A {Pectobacterium atrosepticum SCRI1043} Back     alignment and structure
>1r0k_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; NADPH dependent, fosmidomycin, non- mevalonate pathway, oxidoreductase; 1.91A {Zymomonas mobilis} SCOP: a.69.3.1 c.2.1.3 d.81.1.3 PDB: 1r0l_A* Back     alignment and structure
>3ip3_A Oxidoreductase, putative; structural genomics, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.14A {Thermotoga maritima} Back     alignment and structure
>1dih_A Dihydrodipicolinate reductase; oxidoreductase; HET: NDP; 2.20A {Escherichia coli} SCOP: c.2.1.3 d.81.1.3 PDB: 1arz_A* 1dru_A* 1drv_A* 1drw_A* Back     alignment and structure
>1lc0_A Biliverdin reductase A; oxidoreductase, tetrapyrrole, bIle pigment, heme, bilirubin, NADH; 1.20A {Rattus norvegicus} SCOP: c.2.1.3 d.81.1.4 PDB: 1lc3_A* 1gcu_A 2h63_A* Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>3oa2_A WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD; 1.50A {Pseudomonas aeruginosa} Back     alignment and structure
>3o9z_A Lipopolysaccaride biosynthesis protein WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD AKG; 1.45A {Thermus thermophilus} PDB: 3oa0_A* Back     alignment and structure
>3dty_A Oxidoreductase, GFO/IDH/MOCA family; MGCL2, tetramer, PSI-2, 11131, NYSGXRC, structural genomics, protein structure initiative; 2.04A {Pseudomonas syringae PV} Back     alignment and structure
>1ebf_A Homoserine dehydrogenase; dinucleotide, NAD, dimer, oxidoreductase; HET: NAD; 2.30A {Saccharomyces cerevisiae} SCOP: c.2.1.3 d.81.1.2 PDB: 1ebu_A* 1tve_A* 1q7g_A* Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>3v5n_A Oxidoreductase; structural genomics, PSI-biology, protein structure initiati nysgrc, NEW YORK structural genomics research consortium; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>2dt5_A AT-rich DNA-binding protein; REX, NADH, NAD, rossmann fold, redox sensing, winged helix, themophilus; HET: NAD; 2.16A {Thermus thermophilus} SCOP: a.4.5.38 c.2.1.12 PDB: 1xcb_A* 3ikt_A* 3ikv_A 3il2_A* Back     alignment and structure
>1y81_A Conserved hypothetical protein; hyperthermophIle, structural genomics, PSI, protein structure initiative; HET: COA; 1.70A {Pyrococcus furiosus} SCOP: c.2.1.8 Back     alignment and structure
>2vt3_A REX, redox-sensing transcriptional repressor REX; transcriptional regulation, redox poise; HET: ATP; 2.0A {Bacillus subtilis} PDB: 2vt2_A* Back     alignment and structure
>3btv_A Galactose/lactose metabolism regulatory protein GAL80; eukaryotic transcription repressor, acetylation, carbohydrate metabolism; 2.10A {Saccharomyces cerevisiae} PDB: 3bts_A 3v2u_A* 3btu_A Back     alignment and structure
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A* Back     alignment and structure
>2nvw_A Galactose/lactose metabolism regulatory protein GAL80; transcription, galactose metabolism, repressor; 2.10A {Kluyveromyces lactis} SCOP: c.2.1.3 d.81.1.5 PDB: 3e1k_A Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>4gmf_A Yersiniabactin biosynthetic protein YBTU; rossmann fold, NADPH dependent thiazoline reductase, oxidore; HET: EPE; 1.85A {Yersinia enterocolitica subsp} PDB: 4gmg_A* Back     alignment and structure
>2bma_A Glutamate dehydrogenase (NADP+); malaria, drug design, analysis, oligomer organization, oxidoreductase; 2.7A {Plasmodium falciparum} Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>3a06_A 1-deoxy-D-xylulose 5-phosphate reductoisomerase; MEP pathway, isoprene biosynthesis, metal- NADP, oxidoreductase; HET: NDP; 2.00A {Thermotoga maritima} PDB: 3a14_A* Back     alignment and structure
>2duw_A Putative COA-binding protein; ligand binding protein; NMR {Klebsiella pneumoniae} Back     alignment and structure
>3keo_A Redox-sensing transcriptional repressor REX; DNA binding protein, winged helix, rossmann fold, NAD+; HET: NAD; 1.50A {Streptococcus agalactiae serogroup iiiorganism_taxid} PDB: 3keq_A* 3ket_A* Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>3d1l_A Putative NADP oxidoreductase BF3122; structural genomics, PSI-2, protein structure initiative, M center for structural genomics, MCSG; 2.19A {Bacteroides fragilis} Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>2nu8_A Succinyl-COA ligase [ADP-forming] subunit alpha; citric acid cycle, heterotetramer, ligase, ATP-grAsp fold, R fold; HET: COA; 2.15A {Escherichia coli} SCOP: c.2.1.8 c.23.4.1 PDB: 2nu9_A* 2nu7_A* 2nua_A* 2nu6_A* 2scu_A* 1jll_A* 1scu_A* 1jkj_A* 1cqj_A* 1cqi_A* Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>2d59_A Hypothetical protein PH1109; COA binding, structural genomics; 1.65A {Pyrococcus horikoshii} SCOP: c.2.1.8 PDB: 2d5a_A* 2e6u_X* 3qa9_A 3q9n_A* 3q9u_A* Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>1iuk_A Hypothetical protein TT1466; structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 1.70A {Thermus thermophilus} SCOP: c.2.1.8 PDB: 1iul_A Back     alignment and structure
>3oqb_A Oxidoreductase; structural genomics, protein structure INI NEW YORK structural genomix research consortium, NYSGXRC, PSI-2; 2.60A {Bradyrhizobium japonicum} Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>3ff4_A Uncharacterized protein; structural genomics, PSI- protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>2yfq_A Padgh, NAD-GDH, NAD-specific glutamate dehydrogenase; oxidoreductase; 2.94A {Peptoniphilus asaccharolyticus} Back     alignment and structure
>3r3j_A Glutamate dehydrogenase; rossman fold, oxidoreductase, apicoplast; 3.10A {Plasmodium falciparum} Back     alignment and structure
>1vm6_A DHPR, dihydrodipicolinate reductase; TM1520, structural genomics, protein structure initiative, PSI, joint center for structu genomics; HET: NAD PG4; 2.27A {Thermotoga maritima} SCOP: c.2.1.3 d.81.1.3 Back     alignment and structure
>2tmg_A Protein (glutamate dehydrogenase); metabolic role, mutant, oxidoreductase; 2.90A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.1 PDB: 1b26_A 1b3b_A Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>3b1f_A Putative prephenate dehydrogenase; enzyme, 4-hydroxyphenylpyruvate, oxidative decarboxylation pathway, tyrosine biosynthesis, oxidoreduct; HET: NAD; 2.10A {Streptococcus mutans} PDB: 3dzb_A Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Back     alignment and structure
>3aog_A Glutamate dehydrogenase; NAD(H), oxidoreducta; HET: GLU; 2.10A {Thermus thermophilus HB27} PDB: 3aoe_A Back     alignment and structure
>1oi7_A Succinyl-COA synthetase alpha chain; SCS, ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 1.23A {Thermus thermophilus} SCOP: c.2.1.8 c.23.4.1 Back     alignment and structure
>4fcc_A Glutamate dehydrogenase; protein complex, rossmann fold, metabolic role, NAD, NADP, oxidoreductase; 2.00A {Escherichia coli O157} PDB: 4fhn_X 2yfg_A 3sbo_A 2yfg_E Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>3aoe_E Glutamate dehydrogenase; rossmann fold, NADH, oxidoreductase; 2.60A {Thermus thermophilus} Back     alignment and structure
>1bgv_A Glutamate dehydrogenase; oxidoreductase; HET: GLU; 1.90A {Clostridium symbiosum} SCOP: c.2.1.7 c.58.1.1 PDB: 1hrd_A 1k89_A 1aup_A 2yfh_A Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>3pp8_A Glyoxylate/hydroxypyruvate reductase A; structural genomics, center for structural genomics of infec diseases, csgid; 2.10A {Salmonella enterica subsp} PDB: 3kbo_A Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>4g2n_A D-isomer specific 2-hydroxyacid dehydrogenase, Na; structural genomics, protein structure initiative, nysgrc, P biology; 1.70A {Polaromonas SP} Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Back     alignment and structure
>3k92_A NAD-GDH, NAD-specific glutamate dehydrogenase; ROCG, oxidoreductase; 2.30A {Bacillus subtilis} PDB: 3k8z_A Back     alignment and structure
>3evt_A Phosphoglycerate dehydrogenase; structural genomics, PSI-2, protein structure initiative; 2.20A {Lactobacillus plantarum} Back     alignment and structure
>3mw9_A GDH 1, glutamate dehydrogenase 1; allostery, inhibition, oxidoreducta; HET: GLU GTP NAD; 2.40A {Bos taurus} SCOP: c.2.1.7 c.58.1.1 PDB: 3mvo_A* 3mvq_A* 3qmu_A* 3etd_A* 3ete_A* 3etg_A* 1l1f_A 1nr1_A 1nr7_A 1nqt_A 1hwx_A* 1hwy_A* 1hwz_A* Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>1gtm_A Glutamate dehydrogenase; oxidoreductase, NAD, NADP; 2.20A {Pyrococcus furiosus} SCOP: c.2.1.7 c.58.1.1 PDB: 1bvu_A 1euz_A Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>3hg7_A D-isomer specific 2-hydroxyacid dehydrogenase FAM protein; structural genomics; 1.80A {Aeromonas salmonicida subsp} Back     alignment and structure
>1qp8_A Formate dehydrogenase; oxidoreductase; HET: NDP; 2.80A {Pyrobaculum aerophilum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans} Back     alignment and structure
>2yq5_A D-isomer specific 2-hydroxyacid dehydrogenase; oxidoreductase; HET: NAD; 2.75A {Lactobacillus delbrueckii subsp} PDB: 2yq4_A* Back     alignment and structure
>3kb6_A D-lactate dehydrogenase; oxidoreductase, D-LDH, NAD, structural genomics, NPPSFA, NAT project on protein structural and functional analyses; HET: MSE NAD 1PE; 2.12A {Aquifex aeolicus} Back     alignment and structure
>1dxy_A D-2-hydroxyisocaproate dehydrogenase; D-2-hydroxycarboxylate dehydrogenase, D-lactate dehydrogenas oxidoreductase; HET: NAD; 1.86A {Lactobacillus casei} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>2g76_A 3-PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, phosphoglycerate dehydrogenase deficiency, S metabolism, 2-hydroxyacid dehydrogenases; HET: NAD; 1.70A {Homo sapiens} Back     alignment and structure
>3gg9_A D-3-phosphoglycerate dehydrogenase oxidoreductase; structural genomics, PSI-2, P structure initiative; 1.90A {Ralstonia solanacearum} Back     alignment and structure
>3jtm_A Formate dehydrogenase, mitochondrial; mitochondrion, NAD, oxidoreductase, T peptide; 1.30A {Arabidopsis thaliana} PDB: 3n7u_A* 3naq_A Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>1c1d_A L-phenylalanine dehydrogenase; amino acid dehydrogenase, oxidative deamination mechanism, oxidoreductase; HET: PHE NAD; 1.25A {Rhodococcus SP} SCOP: c.2.1.7 c.58.1.1 PDB: 1bw9_A* 1c1x_A* 1bw9_B* 1c1d_B* 1c1x_B* 1bxg_B* 1bxg_A* Back     alignment and structure
>4hy3_A Phosphoglycerate oxidoreductase; PSI-biology, structural genomics, protein structure initiati acid transport and metabolism, NAD binding domain.; 2.80A {Rhizobium etli} Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>4e5n_A Thermostable phosphite dehydrogenase; D-2-hydroxyacid dehydrogenase, oxidoreductase; HET: NAD; 1.70A {Pseudomonas stutzeri} PDB: 4e5k_A* 4ebf_A* 4e5p_A* 4e5m_A* Back     alignment and structure
>3ce6_A Adenosylhomocysteinase; protein-substrate complex, dimer of dimers, NAD binding DOMA amino acid insertional region, hydrolase; HET: ADN NAD; 1.60A {Mycobacterium tuberculosis} PDB: 3dhy_A* 2zj0_A* 2ziz_A* 2zj1_A* Back     alignment and structure
>1mx3_A CTBP1, C-terminal binding protein 1; nuclear protein, phosphorylation, transcriptional corepresso transcription repressor; HET: NAD; 1.95A {Homo sapiens} SCOP: c.2.1.4 c.23.12.1 PDB: 1hku_A* 1hl3_A* 2hu2_A* 3ga0_A 2ome_A* Back     alignment and structure
>4dgs_A Dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>1gdh_A D-glycerate dehydrogenase; oxidoreductase(CHOH (D)-NAD(P)+ (A)); 2.40A {Hyphomicrobium methylovorum} SCOP: c.2.1.4 c.23.12.1 Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>3gvx_A Glycerate dehydrogenase related protein; NYSGXRC, PSI-II, 11143J, structural genomics, protein structure initiative; 2.20A {Thermoplasma acidophilum} Back     alignment and structure
>2yv1_A Succinyl-COA ligase [ADP-forming] subunit alpha; COA-binding domain, structural genomics, NPPSFA; 1.70A {Methanocaldococcus jannaschii} Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>2cuk_A Glycerate dehydrogenase/glyoxylate reductase; structural genomics, riken structur genomics/proteomics initiative, RSGI, NPPSFA; HET: NHE; 2.00A {Thermus thermophilus} Back     alignment and structure
>2i76_A Hypothetical protein; NADP, dehydrogenase, TM1727, structural genomics, PSI-2, protein structure initiative; HET: NDP; 3.00A {Thermotoga maritima} SCOP: a.100.1.10 c.2.1.6 Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>1wwk_A Phosphoglycerate dehydrogenase; riken structural genomics/proteomics initiative, RSGI, structural genomics, oxidoreductase; HET: NAD; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A Back     alignment and structure
>1j4a_A D-LDH, D-lactate dehydrogenase; NAD-dependent dehydrogenase, reversible interconversion of pyruvate INTO D-lactate; 1.90A {Lactobacillus delbrueckii subsp} SCOP: c.2.1.4 c.23.12.1 PDB: 1j49_A* 2dld_A* Back     alignment and structure
>2gcg_A Glyoxylate reductase/hydroxypyruvate reductase; NAD(P) rossmann fold, formate/glycerate dehydrogenase substr binding domain, oxidoreductase; HET: NDP; 2.20A {Homo sapiens} PDB: 2wwr_A 2h1s_A 2q50_A Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>3ba1_A HPPR, hydroxyphenylpyruvate reductase; two domain protein, substrate binding domain, cofactor bindi domain, oxidoreductase; 1.47A {Solenostemon scutellarioides} PDB: 3baz_A* Back     alignment and structure
>2ekl_A D-3-phosphoglycerate dehydrogenase; structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: NAD; 1.77A {Sulfolobus tokodaii} Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>3oet_A Erythronate-4-phosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.36A {Salmonella enterica subsp} Back     alignment and structure
>2o4c_A Erythronate-4-phosphate dehydrogenase; erythronate-4-phsphate, NAD, tartrate, phosph oxidoreductase; HET: NAD TLA; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>2yv2_A Succinyl-COA synthetase alpha chain; COA-binding domain, ligase, structural genomics, NPPSFA; 2.20A {Aeropyrum pernix} Back     alignment and structure
>2w2k_A D-mandelate dehydrogenase; 2-hydroxyacid dehydrogenase, oxidoreductase; 1.85A {Rhodotorula graminis} PDB: 2w2l_A* 2w2l_D* 2w2k_B Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>1sc6_A PGDH, D-3-phosphoglycerate dehydrogenase; allosteric regulation phosphoglycerate dehydrogenase PGDH, oxidoreductase; HET: NAD; 2.09A {Escherichia coli} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 PDB: 1psd_A* 1yba_A* 2p9c_A* 2p9e_A* 2pa3_A* 2p9g_A* Back     alignment and structure
>2d0i_A Dehydrogenase; structural genomics, NPPSFA, national project protein structural and functional analyses; 1.95A {Pyrococcus horikoshii} Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Back     alignment and structure
>2dbq_A Glyoxylate reductase; D-3-phosphoglycerate dehydrogenase, ST genomics, NPPSFA; HET: NAP; 1.70A {Pyrococcus horikoshii} PDB: 2dbr_A* 2dbz_A* Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>2nac_A NAD-dependent formate dehydrogenase; oxidoreductase(aldehyde(D),NAD+(A)); 1.80A {Pseudomonas SP} SCOP: c.2.1.4 c.23.12.1 PDB: 2nad_A* 2go1_A 2gug_A* 2gsd_A* 3fn4_A Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>2j6i_A Formate dehydrogenase; oxidoreductase, D-specific-2- hydroxy acid dehydrogenase, cofactor regenerator, yeast, CBFDH; HET: PG4; 1.55A {Candida boidinii} PDB: 2fss_A Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Back     alignment and structure
>3d4o_A Dipicolinate synthase subunit A; NP_243269.1, structural GEN joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: MSE TAR; 2.10A {Bacillus halodurans} Back     alignment and structure
>1yb4_A Tartronic semialdehyde reductase; structural genomics, oxidoreductase, salmonella typhimurium LT2, PSI, protein ST initiative; 2.40A {Salmonella typhimurium} Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>3k5p_A D-3-phosphoglycerate dehydrogenase; niaid, ssgcid, seattle structural genomics center for infect disease, brucellosis; 2.15A {Brucella melitensis biovar abortus} Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>2ahr_A Putative pyrroline carboxylate reductase; pyrroline reductase, proline biosynthesis, NAD(P protein, rossmann fold, doain swapping; HET: NAP; 2.15A {Streptococcus pyogenes} SCOP: a.100.1.10 c.2.1.6 PDB: 2amf_A Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>1v9l_A Glutamate dehydrogenase; protein-NAD complex, oxidoreductase; HET: NAD; 2.80A {Pyrobaculum islandicum} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>2rir_A Dipicolinate synthase, A chain; structural genomics, APC1343, PSI-2, structure initiative; HET: MSE NAP; 2.79A {Bacillus subtilis} Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>2f1k_A Prephenate dehydrogenase; tyrosine synthesis, X-RA crystallography structure, oxidoreductase; HET: OMT NAP; 1.55A {Synechocystis SP} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>4gbj_A 6-phosphogluconate dehydrogenase NAD-binding; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; 2.05A {Dyadobacter fermentans} Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99 and prephenate dehydrogenase (EC...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>2gf2_A Hibadh, 3-hydroxyisobutyrate dehydrogenase; structural genomics, structural genomics consortium, SGC, oxidoreductase; 2.38A {Homo sapiens} PDB: 2i9p_A* Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Back     alignment and structure
>1ygy_A PGDH, D-3-phosphoglycerate dehydrogenase; oxidoreductase, serine biosy structural genomics, PSI, protein structure initiative; HET: TAR; 2.30A {Mycobacterium tuberculosis} SCOP: c.2.1.4 c.23.12.1 d.58.18.1 d.81.2.2 PDB: 3dc2_A* 3ddn_A* Back     alignment and structure
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus} SCOP: a.100.1.12 c.2.1.6 Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>2cvz_A Dehydrogenase, 3-hydroxyisobutyrate dehydrogenase; valine catabolism, NADP+, structural GEN riken structural genomics/proteomics initiative; HET: NDP; 1.80A {Thermus thermophilus} SCOP: a.100.1.1 c.2.1.6 PDB: 1wp4_A* Back     alignment and structure
>1i36_A Conserved hypothetical protein MTH1747; NADP binding domain, protein NADP complex, structural genomics, PSI; HET: NAP; 2.00A {Methanothermobacterthermautotrophicus} SCOP: a.100.1.8 c.2.1.6 Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>2x0j_A Malate dehydrogenase; oxidoreductase, hyperthermophilic, tricarboxylic acid cycle; HET: ENA; 2.79A {Archaeoglobus fulgidus dsm 4304} PDB: 2x0i_A* Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3dfu_A Uncharacterized protein from 6-phosphogluconate dehydrogenase-like family; putative rossmann-like dehydrogenase, structural genomics; HET: MSE; 2.07A {Corynebacterium glutamicum} Back     alignment and structure
>1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* Back     alignment and structure
>2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Back     alignment and structure
>2yjz_A Metalloreductase steap4; oxidoreductase, metabolic syndrome; HET: NAP; 2.20A {Rattus norvegicus} Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Back     alignment and structure
>1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>3d64_A Adenosylhomocysteinase; structural genomics, ssgcid, S-adenosyl-L-homocysteine hydro NAD, one-carbon metabolism; HET: NAD; 2.30A {Burkholderia pseudomallei} PDB: 3glq_A* Back     alignment and structure
>1piw_A Hypothetical zinc-type alcohol dehydrogenase- like protein in PRE5-FET4 intergenic...; ADH topology, NADP(H)dependent, oxidoreductase; HET: NAP; 3.00A {Saccharomyces cerevisiae} SCOP: b.35.1.2 c.2.1.1 PDB: 1ps0_A* 1q1n_A Back     alignment and structure
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>1leh_A Leucine dehydrogenase; oxidoreductase; 2.20A {Lysinibacillus sphaericus} SCOP: c.2.1.7 c.58.1.1 Back     alignment and structure
>1yqg_A Pyrroline-5-carboxylate reductase; structural genomics, PSI, structure initiative, midwest center for structural genomic oxidoreductase; 1.90A {Neisseria meningitidis} SCOP: a.100.1.10 c.2.1.6 PDB: 2ag8_A* Back     alignment and structure
>2cf5_A Atccad5, CAD, cinnamyl alcohol dehydrogenase; lignin biosynthesis, metal-binding, NADP, oxidoreductase, zinc; 2.0A {Arabidopsis thaliana} PDB: 2cf6_A* Back     alignment and structure
>1np3_A Ketol-acid reductoisomerase; A DEEP figure-OF-eight knot, C-terminal alpha-helical domain oxidoreductase; 2.00A {Pseudomonas aeruginosa} SCOP: a.100.1.2 c.2.1.6 Back     alignment and structure
>2qyt_A 2-dehydropantoate 2-reductase; APC81190, porphyromonas gingi W83, structural genomics, PSI-2; HET: MSE; 2.15A {Porphyromonas gingivalis} Back     alignment and structure
>3nep_X Malate dehydrogenase; halophIle, molecular adpatation, NAD, oxidoreductase, tricarboxylic acid cycle; 1.55A {Salinibacter ruber} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 364
d1u8fo2164 d.81.1.1 (O:152-315) Glyceraldehyde-3-phosphate de 2e-86
d3cmco2163 d.81.1.1 (O:149-312) Glyceraldehyde-3-phosphate de 4e-84
d1rm4a2163 d.81.1.1 (A:149-312) Glyceraldehyde-3-phosphate de 1e-82
d1dssg1169 c.2.1.3 (G:1-148,G:313-334) Glyceraldehyde-3-phosp 2e-75
d1obfo2162 d.81.1.1 (O:153-314) Glyceraldehyde-3-phosphate de 4e-75
d2g82a2162 d.81.1.1 (A:149-310) Glyceraldehyde-3-phosphate de 5e-71
d1u8fo1169 c.2.1.3 (O:3-151,O:316-335) Glyceraldehyde-3-phosp 4e-70
d1k3ta2169 d.81.1.1 (A:165-333) Glyceraldehyde-3-phosphate de 1e-69
d1hdgo1169 c.2.1.3 (O:1-148,O:313-331) Glyceraldehyde-3-phosp 1e-65
d1rm4a1172 c.2.1.3 (A:1-148,A:313-333) Glyceraldehyde-3-phosp 1e-64
d1gado1166 c.2.1.3 (O:0-148,O:313-330) Glyceraldehyde-3-phosp 1e-63
d1k3ta1190 c.2.1.3 (A:1-164,A:334-359) Glyceraldehyde-3-phosp 5e-58
d2b4ro1166 c.2.1.3 (O:4-152,O:319-335) Glyceraldehyde-3-phosp 1e-56
d3cmco1171 c.2.1.3 (O:0-148,O:313-333) Glyceraldehyde-3-phosp 2e-55
d1obfo1173 c.2.1.3 (O:1-152,O:315-335) Glyceraldehyde-3-phosp 9e-51
d2g82a1168 c.2.1.3 (A:1-148,A:311-330) Glyceraldehyde-3-phosp 1e-50
d1cf2o1171 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosp 3e-47
d2czca2172 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosp 2e-42
d1b7go1178 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosp 6e-40
d1b7go2162 d.81.1.1 (O:139-300) Glyceraldehyde-3-phosphate de 3e-35
d1cf2o2165 d.81.1.1 (O:139-303) Glyceraldehyde-3-phosphate de 3e-34
d2czca1162 d.81.1.1 (A:140-301) Glyceraldehyde-3-phosphate de 4e-05
>d1u8fo2 d.81.1.1 (O:152-315) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human(Homo sapiens), liver isoform [TaxId: 9606]} Length = 164 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: FwdE/GAPDH domain-like
superfamily: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain
family: GAPDH-like
domain: Glyceraldehyde-3-phosphate dehydrogenase (GAPDH)
species: Human(Homo sapiens), liver isoform [TaxId: 9606]

 Score =  256 bits (656), Expect = 2e-86
 Identities = 128/164 (78%), Positives = 140/164 (85%)

Query: 150 CTTNCLAPLAKVIHDNFEILEGLMTTVHAVTATQKTVDAPSKKMWRDGRGANQNIIPAST 209
           CTTNCLAPLAKVIHDNF I+EGLMTTVHA+TATQKTVD PS K+WRDGRGA QNIIPAST
Sbjct: 1   CTTNCLAPLAKVIHDNFGIVEGLMTTVHAITATQKTVDGPSGKLWRDGRGALQNIIPAST 60

Query: 210 GAAKAVAKVIPDLEGKLTGMAFRVPVPNVSVVDLTVRLCCDVTYDEIKAKVKAASQGPMK 269
           GAAKAV KVIP+L GKLTGMAFRVP  NVSVVDLT RL     YD+IK  VK AS+GP+K
Sbjct: 61  GAAKAVGKVIPELNGKLTGMAFRVPTANVSVVDLTCRLEKPAKYDDIKKVVKQASEGPLK 120

Query: 270 GILGYTEDEVVSSDFNGEVCSSVFDAKAGIALNKNFVKLVTWYD 313
           GILGYTE +VVSSDFN +  SS FDA AGIALN +FVKL++WYD
Sbjct: 121 GILGYTEHQVVSSDFNSDTHSSTFDAGAGIALNDHFVKLISWYD 164
>d3cmco2 d.81.1.1 (O:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]} Length = 163 Back     information, alignment and structure
>d1rm4a2 d.81.1.1 (A:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]} Length = 163 Back     information, alignment and structure
>d1dssg1 c.2.1.3 (G:1-148,G:313-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {South China Sea lobster (Palinurus versicolor) [TaxId: 150436]} Length = 169 Back     information, alignment and structure
>d1obfo2 d.81.1.1 (O:153-314) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Achromobacter xylosoxidans [TaxId: 85698]} Length = 162 Back     information, alignment and structure
>d2g82a2 d.81.1.1 (A:149-310) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]} Length = 162 Back     information, alignment and structure
>d1u8fo1 c.2.1.3 (O:3-151,O:316-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human(Homo sapiens), liver isoform [TaxId: 9606]} Length = 169 Back     information, alignment and structure
>d1k3ta2 d.81.1.1 (A:165-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]} Length = 169 Back     information, alignment and structure
>d1hdgo1 c.2.1.3 (O:1-148,O:313-331) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermotoga maritima [TaxId: 2336]} Length = 169 Back     information, alignment and structure
>d1rm4a1 c.2.1.3 (A:1-148,A:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]} Length = 172 Back     information, alignment and structure
>d1gado1 c.2.1.3 (O:0-148,O:313-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli [TaxId: 562]} Length = 166 Back     information, alignment and structure
>d1k3ta1 c.2.1.3 (A:1-164,A:334-359) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]} Length = 190 Back     information, alignment and structure
>d2b4ro1 c.2.1.3 (O:4-152,O:319-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 166 Back     information, alignment and structure
>d3cmco1 c.2.1.3 (O:0-148,O:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]} Length = 171 Back     information, alignment and structure
>d1obfo1 c.2.1.3 (O:1-152,O:315-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Achromobacter xylosoxidans [TaxId: 85698]} Length = 173 Back     information, alignment and structure
>d2g82a1 c.2.1.3 (A:1-148,A:311-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]} Length = 168 Back     information, alignment and structure
>d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Length = 171 Back     information, alignment and structure
>d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 172 Back     information, alignment and structure
>d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 178 Back     information, alignment and structure
>d1b7go2 d.81.1.1 (O:139-300) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 162 Back     information, alignment and structure
>d1cf2o2 d.81.1.1 (O:139-303) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Length = 165 Back     information, alignment and structure
>d2czca1 d.81.1.1 (A:140-301) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 162 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query364
d3cmco2163 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d1u8fo2164 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d1rm4a2163 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d1k3ta2169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d2g82a2162 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d1obfo2162 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d1dssg1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d1gado1166 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d3cmco1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d1u8fo1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d1k3ta1190 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d2g82a1168 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d1rm4a1172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d2b4ro1166 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d1hdgo1169 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d1obfo1173 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d1b7go1178 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d2czca2172 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d1cf2o1171 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 100.0
d1cf2o2165 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.95
d1b7go2162 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.93
d1mb4a2222 Aspartate beta-semialdehyde dehydrogenase {Vibrio 99.9
d1t4ba2221 Aspartate beta-semialdehyde dehydrogenase {Escheri 99.89
d2hjsa2190 Usg-1 protein homolog PA3116 {Pseudomonas aerugino 99.87
d2gz1a2202 Aspartate beta-semialdehyde dehydrogenase {Strepto 99.83
d2gz1a1154 Aspartate beta-semialdehyde dehydrogenase {Strepto 99.8
d2hjsa1144 Usg-1 protein homolog PA3116 {Pseudomonas aerugino 99.78
d2czca1162 Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) { 99.72
d1nvmb1157 Acetaldehyde dehydrogenase (acylating) {Pseudomona 99.64
d1mb4a1147 Aspartate beta-semialdehyde dehydrogenase {Vibrio 99.58
d2cvoa1183 Putative semialdehyde dehydrogenase {Rice (Oryza s 99.49
d1t4ba1146 Aspartate beta-semialdehyde dehydrogenase {Escheri 99.49
d1vkna1176 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 99.48
d2g17a1179 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 99.43
d1f06a1170 Diaminopimelic acid dehydrogenase (DAPDH) {Coryneb 98.15
d1j5pa4132 Hypothetical protein TM1643 {Thermotoga maritima [ 97.77
d1ydwa1184 Probable oxidoreductase At4g09670 {Thale cress (Ar 97.44
d1zh8a1181 Hypothetical protein TM0312 {Thermotoga maritima [ 97.43
d1diha1162 Dihydrodipicolinate reductase {Escherichia coli [T 97.26
d1yl7a1135 Dihydrodipicolinate reductase {Mycobacterium tuber 97.2
d1vm6a3128 Dihydrodipicolinate reductase {Thermotoga maritima 97.12
d1h6da1221 Glucose-fructose oxidoreductase, N-terminal domain 97.1
d1tlta1164 Virulence factor MviM {Escherichia coli [TaxId: 56 96.96
d1xeaa1167 Putative oxidoreductase VCA1048 {Vibrio cholerae [ 96.62
d2g17a2155 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 96.62
d1ebfa1168 Homoserine dehydrogenase {Baker's yeast (Saccharom 96.61
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 96.31
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 96.11
d2nvwa1237 Galactose/lactose metabolism regulatory protein GA 95.85
d1r0ka2150 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Z 95.55
d1lc0a1172 Biliverdin reductase {Rat (Rattus norvegicus) [Tax 95.51
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 95.47
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 95.43
d2cvoa2165 Putative semialdehyde dehydrogenase {Rice (Oryza s 95.04
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 95.04
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 95.02
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 94.57
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 94.49
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 94.27
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 94.26
d1i36a2152 Conserved hypothetical protein MTH1747 {Archaeon M 94.16
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 93.99
d1dxya1199 D-2-hydroxyisocaproate dehydrogenase {Lactobacillu 93.96
d1j4aa1197 D-lactate dehydrogenase {Lactobacillus helveticus 93.74
d1mx3a1193 Transcription corepressor CtbP {Human (Homo sapien 93.46
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 93.34
d1bgva1255 Glutamate dehydrogenase {Clostridium symbiosum [Ta 93.29
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 93.28
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 92.89
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 92.85
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 92.75
d2dt5a2126 Transcriptional repressor Rex, C-terminal domain { 92.68
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 92.56
d1qp8a1181 Putative formate dehydrogenase {Archaeon Pyrobacul 92.4
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 92.16
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 92.11
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 91.99
d1q0qa2151 1-deoxy-D-xylulose-5-phosphate reductoisomerase {E 91.81
d1hwxa1293 Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 91.79
d2c5aa1363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 91.54
d2d59a1139 Hypothetical protein PH1109 {Pyrococcus horikoshii 91.25
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 91.23
d1gdha1191 D-glycerate dehydrogenase {Hyphomicrobium methylov 91.19
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 90.93
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 90.87
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 90.82
d1y81a1116 Hypothetical protein PF0725 {Pyrococcus furiosus [ 90.79
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 90.56
d2csua1129 Acetate-CoA ligase alpha chain, AcdA, N-terminal d 90.5
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 90.37
d1sc6a1188 Phosphoglycerate dehydrogenase {Escherichia coli [ 90.31
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 90.24
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 90.14
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 90.06
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 89.98
d2naca1188 Formate dehydrogenase {Pseudomonas sp., strain 101 89.79
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 89.76
d1vkna2163 N-acetyl-gamma-glutamyl-phosphate reductase ArgC { 89.76
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 89.51
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 89.47
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 89.13
d1y1pa1342 Aldehyde reductase II {Sporobolomyces salmonicolor 88.31
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 88.25
d1v9la1242 Glutamate dehydrogenase {Pyrobaculum islandicum [T 88.23
d1ygya1184 Phosphoglycerate dehydrogenase {Mycobacterium tube 88.02
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 87.67
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 87.52
d1yqga2152 Pyrroline-5-carboxylate reductase ProC {Neisseria 87.34
d1gtma1239 Glutamate dehydrogenase {Archaeon Pyrococcus furio 87.27
d1c1da1201 Phenylalanine dehydrogenase {Rhodococcus sp., M4 [ 87.2
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 87.2
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 87.15
d2cmda1145 Malate dehydrogenase {Escherichia coli [TaxId: 562 87.08
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 86.39
d2b69a1312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 86.21
d2ahra2152 Pyrroline-5-carboxylate reductase ProC {Streptococ 86.14
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 86.12
d1qyda_312 Pinoresinol-lariciresinol reductase {Giant arborvi 85.94
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 85.93
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 85.67
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 85.51
d1o6za1142 Malate dehydrogenase {Archaeon Haloarcula marismor 85.05
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 84.95
d1qyca_307 Phenylcoumaran benzylic ether reductase {Loblolly 84.92
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 84.87
d1b26a1234 Glutamate dehydrogenase {Thermotoga maritima [TaxI 84.4
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 83.18
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 82.7
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 82.36
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 82.05
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 81.83
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 80.99
d1ek6a_346 Uridine diphosphogalactose-4-epimerase (UDP-galact 80.81
d1iuka_136 Hypothetical protein TT1466 {Thermus thermophilus 80.42
>d3cmco2 d.81.1.1 (O:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: FwdE/GAPDH domain-like
superfamily: Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain
family: GAPDH-like
domain: Glyceraldehyde-3-phosphate dehydrogenase (GAPDH)
species: Bacillus stearothermophilus, nca 1503 [TaxId: 1422]

Probab=100.00  E-value=1.9e-63  Score=438.04  Aligned_cols=163  Identities=55%  Similarity=0.907  Sum_probs=161.8

Q ss_pred             chhhhHHhHHHHHhhhcCeeEEEEEeeeccccchhhhcCCCcccccccccccceeecCCCChHHHHHHHccCCCCceeeE
Q psy8544         150 CTTNCLAPLAKVIHDNFEILEGLMTTVHAVTATQKTVDAPSKKMWRDGRGANQNIIPASTGAAKAVAKVIPDLEGKLTGM  229 (364)
Q Consensus       150 CTTn~Lap~lk~L~d~fGI~~~~~TTvha~t~~q~~~D~~~~~d~r~~r~~a~NIIP~~tGaak~~~kVlPeL~gki~~~  229 (364)
                      ||||||||++|+|||+|||++++|||+||||++|+++|+|+ +||||+|++++||||++||++|++++|||+|+||++|+
T Consensus         1 CTTNclaP~~kvl~~~fgI~~g~mTTvHa~T~~Q~l~D~~~-~d~Rr~Raa~~niIPtsTgAakav~~vlP~L~gkl~g~   79 (163)
T d3cmco2           1 CTTNCLAPFAKVLHEQFGIVRGMMTTVHSYTNDQRILDLPH-KDLRRARAAAESIIPTTTGAAKAVALVLPELKGKLNGM   79 (163)
T ss_dssp             HHHHHHHHHHHHHHHHHCEEEEEEEEEEECCTTSBSSSCCC-SSTTTTSBTTTCCEEEECSHHHHHHHHCGGGTTTEEEE
T ss_pred             ChhHHHHHHHHHHHhhcCeeEEEEEeeccccCcccCCCCCC-cchhccchHhhCCCCccccHHHHHHHhhHHhCCCcceE
Confidence            99999999999999999999999999999999999999997 89999999999999999999999999999999999999


Q ss_pred             EEeceeccceEEEEEEEeccCCCHHHHHHHHHHccCCCCCccccccCCceEeecCCCCCceeEEecCCcceecCceEEEE
Q psy8544         230 AFRVPVPNVSVVDLTVRLCCDVTYDEIKAKVKAASQGPMKGILGYTEDEVVSSDFNGEVCSSVFDAKAGIALNKNFVKLV  309 (364)
Q Consensus       230 avRVPv~~gs~~dl~~~l~k~~s~eei~~~l~~a~~~~lkgil~~~e~~~VS~df~~~~~s~i~d~~~~~~~~~~~~kl~  309 (364)
                      ++||||++||++||+++++|++++||||++|+++++++|||||+|+|+|+||+||+|++||+|||+.++++++++++|++
T Consensus        80 a~RVPt~~vS~vDlt~~l~k~~t~e~in~~~k~as~~~lkgil~~t~~plVSsDf~g~~~SsI~D~~~t~v~~~~~vKv~  159 (163)
T d3cmco2          80 AMRVPTPNVSVVDLVAELEKEVTVEEVNAALKAAAEGELKGILAYSEEPLVSRDYNGSTVSSTIDALSTMVIDGKMVKVV  159 (163)
T ss_dssp             EEEESCSSCEEEEEEEEESSCCCHHHHHHHHHHHHHTTTTTTEEEECSCCCGGGGTTCCSSEEEEGGGCEEETTTEEEEE
T ss_pred             EEecCCCcceeEEEEEEecCcCCHHHHHHHHHHHhcCCccCcceeeecccchhhccCCCccEEEEcccCEEECCCEEEEE
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEec
Q psy8544         310 TWYD  313 (364)
Q Consensus       310 ~WyD  313 (364)
                      +|||
T Consensus       160 aWYD  163 (163)
T d3cmco2         160 SWYD  163 (163)
T ss_dssp             EEEC
T ss_pred             EEeC
Confidence            9998
>d1u8fo2 d.81.1.1 (O:152-315) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human(Homo sapiens), liver isoform [TaxId: 9606]} Back     information, alignment and structure
>d1rm4a2 d.81.1.1 (A:149-312) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1k3ta2 d.81.1.1 (A:165-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2g82a2 d.81.1.1 (A:149-310) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1obfo2 d.81.1.1 (O:153-314) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Achromobacter xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1dssg1 c.2.1.3 (G:1-148,G:313-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {South China Sea lobster (Palinurus versicolor) [TaxId: 150436]} Back     information, alignment and structure
>d1gado1 c.2.1.3 (O:0-148,O:313-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3cmco1 c.2.1.3 (O:0-148,O:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Bacillus stearothermophilus, nca 1503 [TaxId: 1422]} Back     information, alignment and structure
>d1u8fo1 c.2.1.3 (O:3-151,O:316-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Human(Homo sapiens), liver isoform [TaxId: 9606]} Back     information, alignment and structure
>d1k3ta1 c.2.1.3 (A:1-164,A:334-359) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2g82a1 c.2.1.3 (A:1-148,A:311-330) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1rm4a1 c.2.1.3 (A:1-148,A:313-333) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d2b4ro1 c.2.1.3 (O:4-152,O:319-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1hdgo1 c.2.1.3 (O:1-148,O:313-331) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1obfo1 c.2.1.3 (O:1-152,O:315-335) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Achromobacter xylosoxidans [TaxId: 85698]} Back     information, alignment and structure
>d1b7go1 c.2.1.3 (O:1-138,O:301-340) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2czca2 c.2.1.3 (A:1-139,A:302-334) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1cf2o1 c.2.1.3 (O:1-138,O:304-336) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Back     information, alignment and structure
>d1cf2o2 d.81.1.1 (O:139-303) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Methanothermus fervidus [TaxId: 2180]} Back     information, alignment and structure
>d1b7go2 d.81.1.1 (O:139-300) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1mb4a2 d.81.1.1 (A:133-354) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1t4ba2 d.81.1.1 (A:134-354) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hjsa2 d.81.1.1 (A:130-319) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2gz1a2 d.81.1.1 (A:128-329) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2gz1a1 c.2.1.3 (A:2-127,A:330-357) Aspartate beta-semialdehyde dehydrogenase {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2hjsa1 c.2.1.3 (A:3-129,A:320-336) Usg-1 protein homolog PA3116 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2czca1 d.81.1.1 (A:140-301) Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1nvmb1 c.2.1.3 (B:1-131,B:287-312) Acetaldehyde dehydrogenase (acylating) {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1mb4a1 c.2.1.3 (A:1-132,A:355-369) Aspartate beta-semialdehyde dehydrogenase {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2cvoa1 c.2.1.3 (A:68-218,A:384-415) Putative semialdehyde dehydrogenase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1t4ba1 c.2.1.3 (A:1-133,A:355-367) Aspartate beta-semialdehyde dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vkna1 c.2.1.3 (A:1-144,A:308-339) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2g17a1 c.2.1.3 (A:1-153,A:309-334) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1f06a1 c.2.1.3 (A:1-118,A:269-320) Diaminopimelic acid dehydrogenase (DAPDH) {Corynebacterium glutamicum [TaxId: 1718]} Back     information, alignment and structure
>d1ydwa1 c.2.1.3 (A:6-133,A:305-360) Probable oxidoreductase At4g09670 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1zh8a1 c.2.1.3 (A:4-131,A:276-328) Hypothetical protein TM0312 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1diha1 c.2.1.3 (A:2-130,A:241-273) Dihydrodipicolinate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yl7a1 c.2.1.3 (A:2-105,A:215-245) Dihydrodipicolinate reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vm6a3 c.2.1.3 (A:1-96,A:183-214) Dihydrodipicolinate reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1h6da1 c.2.1.3 (A:51-212,A:375-433) Glucose-fructose oxidoreductase, N-terminal domain {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1tlta1 c.2.1.3 (A:5-127,A:268-308) Virulence factor MviM {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xeaa1 c.2.1.3 (A:2-122,A:267-312) Putative oxidoreductase VCA1048 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2g17a2 d.81.1.1 (A:154-308) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ebfa1 c.2.1.3 (A:2-150,A:341-359) Homoserine dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2nvwa1 c.2.1.3 (A:2-154,A:374-457) Galactose/lactose metabolism regulatory protein GAL80 {Yeast (Kluyveromyces lactis) [TaxId: 28985]} Back     information, alignment and structure
>d1r0ka2 c.2.1.3 (A:3-126,A:265-290) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Zymomonas mobilis [TaxId: 542]} Back     information, alignment and structure
>d1lc0a1 c.2.1.3 (A:2-128,A:247-291) Biliverdin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d2cvoa2 d.81.1.1 (A:219-383) Putative semialdehyde dehydrogenase {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1i36a2 c.2.1.6 (A:1-152) Conserved hypothetical protein MTH1747 {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1dxya1 c.2.1.4 (A:101-299) D-2-hydroxyisocaproate dehydrogenase {Lactobacillus casei [TaxId: 1582]} Back     information, alignment and structure
>d1j4aa1 c.2.1.4 (A:104-300) D-lactate dehydrogenase {Lactobacillus helveticus [TaxId: 1587]} Back     information, alignment and structure
>d1mx3a1 c.2.1.4 (A:126-318) Transcription corepressor CtbP {Human (Homo sapiens), Ctbp1 [TaxId: 9606]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bgva1 c.2.1.7 (A:195-449) Glutamate dehydrogenase {Clostridium symbiosum [TaxId: 1512]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2dt5a2 c.2.1.12 (A:78-203) Transcriptional repressor Rex, C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1qp8a1 c.2.1.4 (A:83-263) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1q0qa2 c.2.1.3 (A:1-125,A:275-300) 1-deoxy-D-xylulose-5-phosphate reductoisomerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hwxa1 c.2.1.7 (A:209-501) Glutamate dehydrogenase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2d59a1 c.2.1.8 (A:4-142) Hypothetical protein PH1109 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1gdha1 c.2.1.4 (A:101-291) D-glycerate dehydrogenase {Hyphomicrobium methylovorum [TaxId: 84]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y81a1 c.2.1.8 (A:6-121) Hypothetical protein PF0725 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d2csua1 c.2.1.8 (A:1-129) Acetate-CoA ligase alpha chain, AcdA, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1sc6a1 c.2.1.4 (A:108-295) Phosphoglycerate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d2naca1 c.2.1.4 (A:148-335) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1vkna2 d.81.1.1 (A:145-307) N-acetyl-gamma-glutamyl-phosphate reductase ArgC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1v9la1 c.2.1.7 (A:180-421) Glutamate dehydrogenase {Pyrobaculum islandicum [TaxId: 2277]} Back     information, alignment and structure
>d1ygya1 c.2.1.4 (A:99-282) Phosphoglycerate dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1yqga2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Neisseria meningitidis, serogroup B [TaxId: 487]} Back     information, alignment and structure
>d1gtma1 c.2.1.7 (A:181-419) Glutamate dehydrogenase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1c1da1 c.2.1.7 (A:149-349) Phenylalanine dehydrogenase {Rhodococcus sp., M4 [TaxId: 1831]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2cmda1 c.2.1.5 (A:1-145) Malate dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ahra2 c.2.1.6 (A:1-152) Pyrroline-5-carboxylate reductase ProC {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1o6za1 c.2.1.5 (A:22-162) Malate dehydrogenase {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b26a1 c.2.1.7 (A:179-412) Glutamate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iuka_ c.2.1.8 (A:) Hypothetical protein TT1466 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure