Psyllid ID: psy8569
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 85 | ||||||
| 270015463 | 389 | hypothetical protein TcasGA2_TC004068 [T | 0.494 | 0.107 | 0.690 | 9e-11 | |
| 242016344 | 178 | unc-13, putative [Pediculus humanus corp | 0.494 | 0.235 | 0.666 | 8e-10 | |
| 340714749 | 2550 | PREDICTED: protein unc-13 homolog B-like | 0.529 | 0.017 | 0.577 | 8e-10 | |
| 350414989 | 191 | PREDICTED: phorbol ester/diacylglycerol- | 0.494 | 0.219 | 0.619 | 3e-09 | |
| 383855782 | 1503 | PREDICTED: uncharacterized protein LOC10 | 0.529 | 0.029 | 0.555 | 4e-09 | |
| 307214946 | 211 | Phorbol ester/diacylglycerol-binding pro | 0.470 | 0.189 | 0.625 | 6e-09 | |
| 307173526 | 1373 | Phorbol ester/diacylglycerol-binding pro | 0.470 | 0.029 | 0.625 | 1e-08 | |
| 332022807 | 223 | Phorbol ester/diacylglycerol-binding pro | 0.470 | 0.179 | 0.6 | 2e-08 | |
| 328701429 | 843 | PREDICTED: hypothetical protein LOC10057 | 0.482 | 0.048 | 0.634 | 2e-07 | |
| 324500257 | 1800 | Phorbol ester/diacylglycerol-binding pro | 0.517 | 0.024 | 0.477 | 5e-07 |
| >gi|270015463|gb|EFA11911.1| hypothetical protein TcasGA2_TC004068 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
Score = 70.9 bits (172), Expect = 9e-11, Method: Composition-based stats.
Identities = 29/42 (69%), Positives = 36/42 (85%)
Query: 28 ETNDVNQGLLIEVWDKGIIWDRAIGYHYLPLPQVAFSNEVGS 69
ETND+N GLLIEVW KG+IWDRA+GYH++PL V +SNE G+
Sbjct: 86 ETNDLNTGLLIEVWSKGMIWDRAMGYHWIPLQTVQYSNEEGN 127
|
Source: Tribolium castaneum Species: Tribolium castaneum Genus: Tribolium Family: Tenebrionidae Order: Coleoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|242016344|ref|XP_002428789.1| unc-13, putative [Pediculus humanus corporis] gi|212513474|gb|EEB16051.1| unc-13, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
| >gi|340714749|ref|XP_003395887.1| PREDICTED: protein unc-13 homolog B-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|350414989|ref|XP_003490496.1| PREDICTED: phorbol ester/diacylglycerol-binding protein unc-13-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|383855782|ref|XP_003703389.1| PREDICTED: uncharacterized protein LOC100882622 [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|307214946|gb|EFN89791.1| Phorbol ester/diacylglycerol-binding protein unc-13 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|307173526|gb|EFN64436.1| Phorbol ester/diacylglycerol-binding protein unc-13 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|332022807|gb|EGI63080.1| Phorbol ester/diacylglycerol-binding protein unc-13 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|328701429|ref|XP_003241596.1| PREDICTED: hypothetical protein LOC100571379 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|324500257|gb|ADY40127.1| Phorbol ester/diacylglycerol-binding protein unc-13 [Ascaris suum] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 85 | ||||||
| WB|WBGene00006752 | 2155 | unc-13 [Caenorhabditis elegans | 0.494 | 0.019 | 0.476 | 2.2e-07 | |
| UNIPROTKB|F1P9E8 | 817 | UNC13A "Uncharacterized protei | 0.482 | 0.050 | 0.463 | 6.8e-05 | |
| ZFIN|ZDB-GENE-050208-748 | 1742 | si:dkey-110c1.7 "si:dkey-110c1 | 0.482 | 0.023 | 0.463 | 9.9e-05 | |
| UNIPROTKB|F8VZH8 | 1676 | UNC13A "Protein unc-13 homolog | 0.482 | 0.024 | 0.463 | 0.00016 | |
| UNIPROTKB|F8W0P6 | 1697 | UNC13A "Protein unc-13 homolog | 0.482 | 0.024 | 0.463 | 0.00016 | |
| UNIPROTKB|H7BXE5 | 1703 | UNC13A "Protein unc-13 homolog | 0.482 | 0.024 | 0.463 | 0.00016 | |
| UNIPROTKB|Q9UPW8 | 1703 | UNC13A "Protein unc-13 homolog | 0.482 | 0.024 | 0.463 | 0.00016 | |
| MGI|MGI:3051532 | 1712 | Unc13a "unc-13 homolog A (C. e | 0.482 | 0.023 | 0.463 | 0.00016 | |
| UNIPROTKB|F8W059 | 1722 | UNC13A "Protein unc-13 homolog | 0.482 | 0.023 | 0.463 | 0.00016 | |
| UNIPROTKB|F1MK99 | 1732 | UNC13A "Uncharacterized protei | 0.482 | 0.023 | 0.463 | 0.00016 |
| WB|WBGene00006752 unc-13 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
Score = 135 (52.6 bits), Expect = 2.2e-07, P = 2.2e-07
Identities = 20/42 (47%), Positives = 32/42 (76%)
Query: 28 ETNDVNQGLLIEVWDKGIIWDRAIGYHYLPLPQVAFSNEVGS 69
ETN + G+++E+W KG++WD+ IG HY+PL ++ +SN GS
Sbjct: 69 ETNRPDDGMVLELWAKGVLWDKLIGVHYMPLSEIRYSNAAGS 110
|
|
| UNIPROTKB|F1P9E8 UNC13A "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-050208-748 si:dkey-110c1.7 "si:dkey-110c1.7" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F8VZH8 UNC13A "Protein unc-13 homolog A" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F8W0P6 UNC13A "Protein unc-13 homolog A" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|H7BXE5 UNC13A "Protein unc-13 homolog A" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9UPW8 UNC13A "Protein unc-13 homolog A" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:3051532 Unc13a "unc-13 homolog A (C. elegans)" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F8W059 UNC13A "Protein unc-13 homolog A" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MK99 UNC13A "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 85 | |||
| cd08394 | 127 | cd08394, C2A_Munc13, C2 domain first repeat in Mun | 7e-12 |
| >gnl|CDD|176040 cd08394, C2A_Munc13, C2 domain first repeat in Munc13 (mammalian uncoordinated) proteins | Back alignment and domain information |
|---|
Score = 56.3 bits (136), Expect = 7e-12
Identities = 19/42 (45%), Positives = 29/42 (69%)
Query: 28 ETNDVNQGLLIEVWDKGIIWDRAIGYHYLPLPQVAFSNEVGS 69
E N ++ GL+IE+W+KG+IWD +G ++PL + SNE G
Sbjct: 52 EINRLDLGLVIELWNKGLIWDTLVGTVWIPLSTIRQSNEEGP 93
|
C2-like domains are thought to be involved in phospholipid binding in a Ca2+ independent manner in both Unc13 and Munc13. Caenorabditis elegans Unc13 has a central domain with sequence similarity to PKC, which includes C1 and C2-related domains. Unc13 binds phorbol esters and DAG with high affinity in a phospholipid manner. Mutations in Unc13 results in abnormal neuronal connections and impairment in cholinergic neurotransmission in the nematode. Munc13 is the mammalian homolog which are expressed in the brain. There are 3 isoforms (Munc13-1, -2, -3) and are thought to play a role in neurotransmitter release and are hypothesized to be high-affinity receptors for phorbol esters. Unc13 and Munc13 contain both C1 and C2 domains. There are two C2 related domains present, one central and one at the carboxyl end. Munc13-1 contains a third C2-like domain. Munc13 interacts with syntaxin, synaptobrevin, and synaptotagmin suggesting a role for these as scaffolding proteins. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins. Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin 1. However, there are a few exceptions to this including RIM isoforms and some splice variants of piccolo/aczonin and intersectin which only have a single C2 domain. C2 domains with a calcium binding region have negatively charged residues, primarily aspartates, that serve as ligands for calcium ions. This cd contains the first C2 repeat, C2A, and has a type-II topology. Length = 127 |
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 85 | |||
| cd08394 | 127 | C2A_Munc13 C2 domain first repeat in Munc13 (mamma | 99.71 | |
| cd08682 | 126 | C2_Rab11-FIP_classI C2 domain found in Rab11-famil | 99.03 | |
| cd04042 | 121 | C2A_MCTP_PRT C2 domain first repeat found in Multi | 99.0 | |
| cd04050 | 105 | C2B_Synaptotagmin-like C2 domain second repeat pre | 98.98 | |
| cd04016 | 121 | C2_Tollip C2 domain present in Toll-interacting pr | 98.97 | |
| cd08681 | 118 | C2_fungal_Inn1p-like C2 domain found in fungal Ing | 98.95 | |
| cd04052 | 111 | C2B_Tricalbin-like C2 domain second repeat present | 98.91 | |
| cd08378 | 121 | C2B_MCTP_PRT_plant C2 domain second repeat found i | 98.9 | |
| cd04022 | 127 | C2A_MCTP_PRT_plant C2 domain first repeat found in | 98.87 | |
| cd08376 | 116 | C2B_MCTP_PRT C2 domain second repeat found in Mult | 98.86 | |
| cd08379 | 126 | C2D_MCTP_PRT_plant C2 domain fourth repeat found i | 98.85 | |
| cd08690 | 155 | C2_Freud-1 C2 domain found in 5' repressor element | 98.85 | |
| cd08391 | 121 | C2A_C2C_Synaptotagmin_like C2 domain first and thi | 98.84 | |
| cd08381 | 122 | C2B_PI3K_class_II C2 domain second repeat present | 98.82 | |
| cd08678 | 126 | C2_C21orf25-like C2 domain found in the Human chro | 98.82 | |
| cd04011 | 111 | C2B_Ferlin C2 domain second repeat in Ferlin. Ferl | 98.82 | |
| cd04054 | 121 | C2A_Rasal1_RasA4 C2 domain first repeat present in | 98.81 | |
| cd04033 | 133 | C2_NEDD4_NEDD4L C2 domain present in the Human neu | 98.81 | |
| cd04043 | 126 | C2_Munc13_fungal C2 domain in Munc13 (mammalian un | 98.78 | |
| cd04024 | 128 | C2A_Synaptotagmin-like C2 domain first repeat pres | 98.78 | |
| cd04036 | 119 | C2_cPLA2 C2 domain present in cytosolic PhosphoLip | 98.77 | |
| cd04015 | 158 | C2_plant_PLD C2 domain present in plant phospholip | 98.77 | |
| cd08385 | 124 | C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repe | 98.76 | |
| cd08395 | 120 | C2C_Munc13 C2 domain third repeat in Munc13 (mamma | 98.74 | |
| cd08685 | 119 | C2_RGS-like C2 domain of the Regulator Of G-Protei | 98.73 | |
| cd08521 | 123 | C2A_SLP C2 domain first repeat present in Synaptot | 98.72 | |
| cd04048 | 120 | C2A_Copine C2 domain first repeat in Copine. There | 98.72 | |
| cd08400 | 126 | C2_Ras_p21A1 C2 domain present in RAS p21 protein | 98.72 | |
| cd04049 | 124 | C2_putative_Elicitor-responsive_gene C2 domain pre | 98.72 | |
| cd04031 | 125 | C2A_RIM1alpha C2 domain first repeat contained in | 98.71 | |
| cd04019 | 150 | C2C_MCTP_PRT_plant C2 domain third repeat found in | 98.71 | |
| cd08375 | 136 | C2_Intersectin C2 domain present in Intersectin. A | 98.71 | |
| cd04041 | 111 | C2A_fungal C2 domain first repeat; fungal group. C | 98.7 | |
| cd04010 | 148 | C2B_RasA3 C2 domain second repeat present in RAS p | 98.7 | |
| cd08377 | 119 | C2C_MCTP_PRT C2 domain third repeat found in Multi | 98.69 | |
| cd08676 | 153 | C2A_Munc13-like C2 domain first repeat in Munc13 ( | 98.69 | |
| cd04046 | 126 | C2_Calpain C2 domain present in Calpain proteins. | 98.68 | |
| smart00239 | 101 | C2 Protein kinase C conserved region 2 (CalB). Ca2 | 98.68 | |
| cd08392 | 128 | C2A_SLP-3 C2 domain first repeat present in Synapt | 98.68 | |
| cd08401 | 121 | C2A_RasA2_RasA3 C2 domain first repeat present in | 98.67 | |
| cd08390 | 123 | C2A_Synaptotagmin-15-17 C2A domain first repeat pr | 98.66 | |
| cd04018 | 151 | C2C_Ferlin C2 domain third repeat in Ferlin. Ferli | 98.66 | |
| cd08688 | 110 | C2_KIAA0528-like C2 domain found in the Human KIAA | 98.66 | |
| cd04032 | 127 | C2_Perforin C2 domain of Perforin. Perforin contai | 98.66 | |
| cd04051 | 125 | C2_SRC2_like C2 domain present in Soybean genes Re | 98.65 | |
| cd08387 | 124 | C2A_Synaptotagmin-8 C2A domain first repeat presen | 98.65 | |
| cd04025 | 123 | C2B_RasA1_RasA4 C2 domain second repeat present in | 98.64 | |
| cd04027 | 127 | C2B_Munc13 C2 domain second repeat in Munc13 (mamm | 98.63 | |
| cd04044 | 124 | C2A_Tricalbin-like C2 domain first repeat present | 98.62 | |
| cd04029 | 125 | C2A_SLP-4_5 C2 domain first repeat present in Syna | 98.62 | |
| cd08382 | 123 | C2_Smurf-like C2 domain present in Smad ubiquitina | 98.61 | |
| cd08675 | 137 | C2B_RasGAP C2 domain second repeat of Ras GTPase a | 98.6 | |
| cd08393 | 125 | C2A_SLP-1_2 C2 domain first repeat present in Syna | 98.59 | |
| cd04030 | 127 | C2C_KIAA1228 C2 domain third repeat present in unc | 98.58 | |
| cd08389 | 124 | C2A_Synaptotagmin-14_16 C2A domain first repeat pr | 98.57 | |
| cd04014 | 132 | C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) | 98.54 | |
| cd04045 | 120 | C2C_Tricalbin-like C2 domain third repeat present | 98.54 | |
| cd00030 | 102 | C2 C2 domain. The C2 domain was first identified i | 98.53 | |
| cd08373 | 127 | C2A_Ferlin C2 domain first repeat in Ferlin. Ferli | 98.51 | |
| cd04020 | 162 | C2B_SLP_1-2-3-4 C2 domain second repeat present in | 98.49 | |
| cd04037 | 124 | C2E_Ferlin C2 domain fifth repeat in Ferlin. Ferli | 98.47 | |
| cd04047 | 110 | C2B_Copine C2 domain second repeat in Copine. Ther | 98.47 | |
| cd04039 | 108 | C2_PSD C2 domain present in Phosphatidylserine dec | 98.47 | |
| cd08386 | 125 | C2A_Synaptotagmin-7 C2A domain first repeat presen | 98.47 | |
| cd04040 | 115 | C2D_Tricalbin-like C2 domain fourth repeat present | 98.46 | |
| cd00276 | 134 | C2B_Synaptotagmin C2 domain second repeat present | 98.44 | |
| cd04017 | 135 | C2D_Ferlin C2 domain fourth repeat in Ferlin. Ferl | 98.39 | |
| cd08388 | 128 | C2A_Synaptotagmin-4-11 C2A domain first repeat pre | 98.39 | |
| cd04009 | 133 | C2B_Munc13-like C2 domain second repeat in Munc13 | 98.38 | |
| cd08403 | 134 | C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repe | 98.37 | |
| cd04038 | 145 | C2_ArfGAP C2 domain present in Arf GTPase Activati | 98.35 | |
| cd08691 | 137 | C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-li | 98.33 | |
| cd08405 | 136 | C2B_Synaptotagmin-7 C2 domain second repeat presen | 98.3 | |
| cd08383 | 117 | C2A_RasGAP C2 domain (first repeat) of Ras GTPase | 98.29 | |
| cd04021 | 125 | C2_E3_ubiquitin_ligase C2 domain present in E3 ubi | 98.25 | |
| cd04026 | 131 | C2_PKC_alpha_gamma C2 domain in Protein Kinase C ( | 98.24 | |
| cd08384 | 133 | C2B_Rabphilin_Doc2 C2 domain second repeat present | 98.24 | |
| cd04028 | 146 | C2B_RIM1alpha C2 domain second repeat contained in | 98.23 | |
| cd04035 | 123 | C2A_Rabphilin_Doc2 C2 domain first repeat present | 98.23 | |
| cd08402 | 136 | C2B_Synaptotagmin-1 C2 domain second repeat presen | 98.21 | |
| cd00275 | 128 | C2_PLC_like C2 domain present in Phosphoinositide- | 98.21 | |
| cd08404 | 136 | C2B_Synaptotagmin-4 C2 domain second repeat presen | 98.11 | |
| cd08680 | 124 | C2_Kibra C2 domain found in Human protein Kibra. K | 98.1 | |
| PLN03008 | 868 | Phospholipase D delta | 97.99 | |
| cd08677 | 118 | C2A_Synaptotagmin-13 C2 domain. Synaptotagmin is a | 97.97 | |
| cd08692 | 135 | C2B_Tac2-N C2 domain second repeat found in Tac2-N | 97.97 | |
| cd04013 | 146 | C2_SynGAP_like C2 domain present in Ras GTPase act | 97.93 | |
| cd08409 | 137 | C2B_Synaptotagmin-15 C2 domain second repeat prese | 97.92 | |
| PF00168 | 85 | C2: C2 domain; InterPro: IPR000008 The C2 domain i | 97.89 | |
| cd08686 | 118 | C2_ABR C2 domain in the Active BCR (Breakpoint clu | 97.88 | |
| cd08410 | 135 | C2B_Synaptotagmin-17 C2 domain second repeat prese | 97.88 | |
| cd08406 | 136 | C2B_Synaptotagmin-12 C2 domain second repeat prese | 97.78 | |
| cd08407 | 138 | C2B_Synaptotagmin-13 C2 domain second repeat prese | 97.77 | |
| KOG1030|consensus | 168 | 97.73 | ||
| cd08408 | 138 | C2B_Synaptotagmin-14_16 C2 domain second repeat pr | 97.7 | |
| PLN03200 | 2102 | cellulose synthase-interactive protein; Provisiona | 97.65 | |
| cd08374 | 133 | C2F_Ferlin C2 domain sixth repeat in Ferlin. Ferli | 97.58 | |
| PLN02223 | 537 | phosphoinositide phospholipase C | 97.32 | |
| PLN02952 | 599 | phosphoinositide phospholipase C | 97.26 | |
| PLN02222 | 581 | phosphoinositide phospholipase C 2 | 97.1 | |
| PLN02230 | 598 | phosphoinositide phospholipase C 4 | 97.03 | |
| KOG0169|consensus | 746 | 96.68 | ||
| cd08689 | 109 | C2_fungal_Pkc1p C2 domain found in protein kinase | 96.65 | |
| PLN02228 | 567 | Phosphoinositide phospholipase C | 96.5 | |
| KOG1028|consensus | 421 | 95.95 | ||
| KOG2059|consensus | 800 | 95.82 | ||
| COG5038 | 1227 | Ca2+-dependent lipid-binding protein, contains C2 | 95.14 | |
| KOG1328|consensus | 1103 | 94.88 | ||
| KOG0696|consensus | 683 | 94.88 | ||
| KOG1028|consensus | 421 | 93.89 | ||
| PLN02270 | 808 | phospholipase D alpha | 93.54 | |
| KOG1264|consensus | 1267 | 93.41 | ||
| KOG2059|consensus | 800 | 91.2 | ||
| COG5038 | 1227 | Ca2+-dependent lipid-binding protein, contains C2 | 91.16 | |
| PF15625 | 168 | CC2D2AN-C2: CC2D2A N-terminal C2 domain | 88.48 | |
| KOG1011|consensus | 1283 | 87.8 | ||
| cd08679 | 178 | C2_DOCK180_related C2 domains found in Dedicator O | 86.88 | |
| PF14429 | 184 | DOCK-C2: C2 domain in Dock180 and Zizimin proteins | 83.09 | |
| KOG1031|consensus | 1169 | 81.95 |
| >cd08394 C2A_Munc13 C2 domain first repeat in Munc13 (mammalian uncoordinated) proteins | Back alignment and domain information |
|---|
Probab=99.71 E-value=1.6e-17 Score=116.27 Aligned_cols=67 Identities=34% Similarity=0.648 Sum_probs=64.0
Q ss_pred eeeeeecCceeeeeccccceeeEeeeccCCCCceEEEEeeCCeeeeceeeEEEeecCCeeeecCcCCCceeEee
Q psy8569 3 KESNVIGSNFRWSVFSVKTRFEVPSETNDVNQGLLIEVWDKGIIWDRAIGYHYLPLPQVAFSNEVGSRKTAGVK 76 (85)
Q Consensus 3 ~~~~v~g~~P~W~~~~~~~~~~f~fet~d~~~gL~vEVWnKgviwDdLLG~~~lPL~~v~~s~e~g~g~W~~l~ 76 (85)
++-.++|+||+||| +|.|...+.++.|.|||||||++.||+||.+.|||++|.+++..++++|+.|+
T Consensus 34 kT~v~~~~nP~WnE-------~F~F~~~~~~~~L~v~V~dkd~~~DD~lG~v~i~L~~v~~~~~~~~~~Wy~L~ 100 (127)
T cd08394 34 TTIAVRGSQPCWEQ-------DFMFEINRLDLGLVIELWNKGLIWDTLVGTVWIPLSTIRQSNEEGPGEWLTLD 100 (127)
T ss_pred EeeECCCCCCceee-------EEEEEEcCCCCEEEEEEEeCCCcCCCceEEEEEEhHHcccCCCCCCCccEecC
Confidence 67788999999999 99999999999999999999999999999999999999999999999999986
|
C2-like domains are thought to be involved in phospholipid binding in a Ca2+ independent manner in both Unc13 and Munc13. Caenorabditis elegans Unc13 has a central domain with sequence similarity to PKC, which includes C1 and C2-related domains. Unc13 binds phorbol esters and DAG with high affinity in a phospholipid manner. Mutations in Unc13 results in abnormal neuronal connections and impairment in cholinergic neurotransmission in the nematode. Munc13 is the mammalian homolog which are expressed in the brain. There are 3 isoforms (Munc13-1, -2, -3) and are thought to play a role in neurotransmitter release and are hypothesized to be high-affinity receptors for phorbol esters. Unc13 and Munc13 contain both C1 and C2 domains. There are two C2 related domains present, one central and one at the carboxyl end. Munc13-1 contains a third C2-like domain. Munc13 interacts with syntaxin, synaptobrevi |
| >cd08682 C2_Rab11-FIP_classI C2 domain found in Rab11-family interacting proteins (FIP) class I | Back alignment and domain information |
|---|
| >cd04042 C2A_MCTP_PRT C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) | Back alignment and domain information |
|---|
| >cd04050 C2B_Synaptotagmin-like C2 domain second repeat present in Synaptotagmin-like proteins | Back alignment and domain information |
|---|
| >cd04016 C2_Tollip C2 domain present in Toll-interacting protein (Tollip) | Back alignment and domain information |
|---|
| >cd08681 C2_fungal_Inn1p-like C2 domain found in fungal Ingression 1 (Inn1) proteins | Back alignment and domain information |
|---|
| >cd04052 C2B_Tricalbin-like C2 domain second repeat present in Tricalbin-like proteins | Back alignment and domain information |
|---|
| >cd08378 C2B_MCTP_PRT_plant C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset | Back alignment and domain information |
|---|
| >cd04022 C2A_MCTP_PRT_plant C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset | Back alignment and domain information |
|---|
| >cd08376 C2B_MCTP_PRT C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) | Back alignment and domain information |
|---|
| >cd08379 C2D_MCTP_PRT_plant C2 domain fourth repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset | Back alignment and domain information |
|---|
| >cd08690 C2_Freud-1 C2 domain found in 5' repressor element under dual repression binding protein-1 (Freud-1) | Back alignment and domain information |
|---|
| >cd08391 C2A_C2C_Synaptotagmin_like C2 domain first and third repeat in Synaptotagmin-like proteins | Back alignment and domain information |
|---|
| >cd08381 C2B_PI3K_class_II C2 domain second repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) | Back alignment and domain information |
|---|
| >cd08678 C2_C21orf25-like C2 domain found in the Human chromosome 21 open reading frame 25 (C21orf25) protein | Back alignment and domain information |
|---|
| >cd04011 C2B_Ferlin C2 domain second repeat in Ferlin | Back alignment and domain information |
|---|
| >cd04054 C2A_Rasal1_RasA4 C2 domain first repeat present in RasA1 and RasA4 | Back alignment and domain information |
|---|
| >cd04033 C2_NEDD4_NEDD4L C2 domain present in the Human neural precursor cell-expressed, developmentally down-regulated 4 (NEDD4) and NEDD4-like (NEDD4L/NEDD42) | Back alignment and domain information |
|---|
| >cd04043 C2_Munc13_fungal C2 domain in Munc13 (mammalian uncoordinated) proteins; fungal group | Back alignment and domain information |
|---|
| >cd04024 C2A_Synaptotagmin-like C2 domain first repeat present in Synaptotagmin-like proteins | Back alignment and domain information |
|---|
| >cd04036 C2_cPLA2 C2 domain present in cytosolic PhosphoLipase A2 (cPLA2) | Back alignment and domain information |
|---|
| >cd04015 C2_plant_PLD C2 domain present in plant phospholipase D (PLD) | Back alignment and domain information |
|---|
| >cd08385 C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repeat present in Synaptotagmins 1, 5, 6, 9, and 10 | Back alignment and domain information |
|---|
| >cd08395 C2C_Munc13 C2 domain third repeat in Munc13 (mammalian uncoordinated) proteins | Back alignment and domain information |
|---|
| >cd08685 C2_RGS-like C2 domain of the Regulator Of G-Protein Signaling (RGS) family | Back alignment and domain information |
|---|
| >cd08521 C2A_SLP C2 domain first repeat present in Synaptotagmin-like proteins | Back alignment and domain information |
|---|
| >cd04048 C2A_Copine C2 domain first repeat in Copine | Back alignment and domain information |
|---|
| >cd08400 C2_Ras_p21A1 C2 domain present in RAS p21 protein activator 1 (RasA1) | Back alignment and domain information |
|---|
| >cd04049 C2_putative_Elicitor-responsive_gene C2 domain present in the putative elicitor-responsive gene | Back alignment and domain information |
|---|
| >cd04031 C2A_RIM1alpha C2 domain first repeat contained in Rab3-interacting molecule (RIM) proteins | Back alignment and domain information |
|---|
| >cd04019 C2C_MCTP_PRT_plant C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset | Back alignment and domain information |
|---|
| >cd08375 C2_Intersectin C2 domain present in Intersectin | Back alignment and domain information |
|---|
| >cd04041 C2A_fungal C2 domain first repeat; fungal group | Back alignment and domain information |
|---|
| >cd04010 C2B_RasA3 C2 domain second repeat present in RAS p21 protein activator 3 (RasA3) | Back alignment and domain information |
|---|
| >cd08377 C2C_MCTP_PRT C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) | Back alignment and domain information |
|---|
| >cd08676 C2A_Munc13-like C2 domain first repeat in Munc13 (mammalian uncoordinated)-like proteins | Back alignment and domain information |
|---|
| >cd04046 C2_Calpain C2 domain present in Calpain proteins | Back alignment and domain information |
|---|
| >smart00239 C2 Protein kinase C conserved region 2 (CalB) | Back alignment and domain information |
|---|
| >cd08392 C2A_SLP-3 C2 domain first repeat present in Synaptotagmin-like protein 3 | Back alignment and domain information |
|---|
| >cd08401 C2A_RasA2_RasA3 C2 domain first repeat present in RasA2 and RasA3 | Back alignment and domain information |
|---|
| >cd08390 C2A_Synaptotagmin-15-17 C2A domain first repeat present in Synaptotagmins 15 and 17 | Back alignment and domain information |
|---|
| >cd04018 C2C_Ferlin C2 domain third repeat in Ferlin | Back alignment and domain information |
|---|
| >cd08688 C2_KIAA0528-like C2 domain found in the Human KIAA0528 cDNA clone | Back alignment and domain information |
|---|
| >cd04032 C2_Perforin C2 domain of Perforin | Back alignment and domain information |
|---|
| >cd04051 C2_SRC2_like C2 domain present in Soybean genes Regulated by Cold 2 (SRC2)-like proteins | Back alignment and domain information |
|---|
| >cd08387 C2A_Synaptotagmin-8 C2A domain first repeat present in Synaptotagmin 8 | Back alignment and domain information |
|---|
| >cd04025 C2B_RasA1_RasA4 C2 domain second repeat present in RasA1 and RasA4 | Back alignment and domain information |
|---|
| >cd04027 C2B_Munc13 C2 domain second repeat in Munc13 (mammalian uncoordinated) proteins | Back alignment and domain information |
|---|
| >cd04044 C2A_Tricalbin-like C2 domain first repeat present in Tricalbin-like proteins | Back alignment and domain information |
|---|
| >cd04029 C2A_SLP-4_5 C2 domain first repeat present in Synaptotagmin-like proteins 4 and 5 | Back alignment and domain information |
|---|
| >cd08382 C2_Smurf-like C2 domain present in Smad ubiquitination-related factor (Smurf)-like proteins | Back alignment and domain information |
|---|
| >cd08675 C2B_RasGAP C2 domain second repeat of Ras GTPase activating proteins (GAPs) | Back alignment and domain information |
|---|
| >cd08393 C2A_SLP-1_2 C2 domain first repeat present in Synaptotagmin-like proteins 1 and 2 | Back alignment and domain information |
|---|
| >cd04030 C2C_KIAA1228 C2 domain third repeat present in uncharacterized human KIAA1228-like proteins | Back alignment and domain information |
|---|
| >cd08389 C2A_Synaptotagmin-14_16 C2A domain first repeat present in Synaptotagmins 14 and 16 | Back alignment and domain information |
|---|
| >cd04014 C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) epsilon | Back alignment and domain information |
|---|
| >cd04045 C2C_Tricalbin-like C2 domain third repeat present in Tricalbin-like proteins | Back alignment and domain information |
|---|
| >cd00030 C2 C2 domain | Back alignment and domain information |
|---|
| >cd08373 C2A_Ferlin C2 domain first repeat in Ferlin | Back alignment and domain information |
|---|
| >cd04020 C2B_SLP_1-2-3-4 C2 domain second repeat present in Synaptotagmin-like proteins 1-4 | Back alignment and domain information |
|---|
| >cd04037 C2E_Ferlin C2 domain fifth repeat in Ferlin | Back alignment and domain information |
|---|
| >cd04047 C2B_Copine C2 domain second repeat in Copine | Back alignment and domain information |
|---|
| >cd04039 C2_PSD C2 domain present in Phosphatidylserine decarboxylase (PSD) | Back alignment and domain information |
|---|
| >cd08386 C2A_Synaptotagmin-7 C2A domain first repeat present in Synaptotagmin 7 | Back alignment and domain information |
|---|
| >cd04040 C2D_Tricalbin-like C2 domain fourth repeat present in Tricalbin-like proteins | Back alignment and domain information |
|---|
| >cd00276 C2B_Synaptotagmin C2 domain second repeat present in Synaptotagmin | Back alignment and domain information |
|---|
| >cd04017 C2D_Ferlin C2 domain fourth repeat in Ferlin | Back alignment and domain information |
|---|
| >cd08388 C2A_Synaptotagmin-4-11 C2A domain first repeat present in Synaptotagmins 4 and 11 | Back alignment and domain information |
|---|
| >cd04009 C2B_Munc13-like C2 domain second repeat in Munc13 (mammalian uncoordinated)-like proteins | Back alignment and domain information |
|---|
| >cd08403 C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repeat present in Synaptotagmins 3, 5, 6, 9, and 10 | Back alignment and domain information |
|---|
| >cd04038 C2_ArfGAP C2 domain present in Arf GTPase Activating Proteins (GAP) | Back alignment and domain information |
|---|
| >cd08691 C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-like ubiquitin protein ligase-1) | Back alignment and domain information |
|---|
| >cd08405 C2B_Synaptotagmin-7 C2 domain second repeat present in Synaptotagmin 7 | Back alignment and domain information |
|---|
| >cd08383 C2A_RasGAP C2 domain (first repeat) of Ras GTPase activating proteins (GAPs) | Back alignment and domain information |
|---|
| >cd04021 C2_E3_ubiquitin_ligase C2 domain present in E3 ubiquitin ligase | Back alignment and domain information |
|---|
| >cd04026 C2_PKC_alpha_gamma C2 domain in Protein Kinase C (PKC) alpha and gamma | Back alignment and domain information |
|---|
| >cd08384 C2B_Rabphilin_Doc2 C2 domain second repeat present in Rabphilin and Double C2 domain | Back alignment and domain information |
|---|
| >cd04028 C2B_RIM1alpha C2 domain second repeat contained in Rab3-interacting molecule (RIM) proteins | Back alignment and domain information |
|---|
| >cd04035 C2A_Rabphilin_Doc2 C2 domain first repeat present in Rabphilin and Double C2 domain | Back alignment and domain information |
|---|
| >cd08402 C2B_Synaptotagmin-1 C2 domain second repeat present in Synaptotagmin 1 | Back alignment and domain information |
|---|
| >cd00275 C2_PLC_like C2 domain present in Phosphoinositide-specific phospholipases C (PLC) | Back alignment and domain information |
|---|
| >cd08404 C2B_Synaptotagmin-4 C2 domain second repeat present in Synaptotagmin 4 | Back alignment and domain information |
|---|
| >cd08680 C2_Kibra C2 domain found in Human protein Kibra | Back alignment and domain information |
|---|
| >PLN03008 Phospholipase D delta | Back alignment and domain information |
|---|
| >cd08677 C2A_Synaptotagmin-13 C2 domain | Back alignment and domain information |
|---|
| >cd08692 C2B_Tac2-N C2 domain second repeat found in Tac2-N (Tandem C2 protein in Nucleus) | Back alignment and domain information |
|---|
| >cd04013 C2_SynGAP_like C2 domain present in Ras GTPase activating protein (GAP) family | Back alignment and domain information |
|---|
| >cd08409 C2B_Synaptotagmin-15 C2 domain second repeat present in Synaptotagmin 15 | Back alignment and domain information |
|---|
| >PF00168 C2: C2 domain; InterPro: IPR000008 The C2 domain is a Ca2+-dependent membrane-targeting module found in many cellular proteins involved in signal transduction or membrane trafficking | Back alignment and domain information |
|---|
| >cd08686 C2_ABR C2 domain in the Active BCR (Breakpoint cluster region) Related protein | Back alignment and domain information |
|---|
| >cd08410 C2B_Synaptotagmin-17 C2 domain second repeat present in Synaptotagmin 17 | Back alignment and domain information |
|---|
| >cd08406 C2B_Synaptotagmin-12 C2 domain second repeat present in Synaptotagmin 12 | Back alignment and domain information |
|---|
| >cd08407 C2B_Synaptotagmin-13 C2 domain second repeat present in Synaptotagmin 13 | Back alignment and domain information |
|---|
| >KOG1030|consensus | Back alignment and domain information |
|---|
| >cd08408 C2B_Synaptotagmin-14_16 C2 domain second repeat present in Synaptotagmins 14 and 16 | Back alignment and domain information |
|---|
| >PLN03200 cellulose synthase-interactive protein; Provisional | Back alignment and domain information |
|---|
| >cd08374 C2F_Ferlin C2 domain sixth repeat in Ferlin | Back alignment and domain information |
|---|
| >PLN02223 phosphoinositide phospholipase C | Back alignment and domain information |
|---|
| >PLN02952 phosphoinositide phospholipase C | Back alignment and domain information |
|---|
| >PLN02222 phosphoinositide phospholipase C 2 | Back alignment and domain information |
|---|
| >PLN02230 phosphoinositide phospholipase C 4 | Back alignment and domain information |
|---|
| >KOG0169|consensus | Back alignment and domain information |
|---|
| >cd08689 C2_fungal_Pkc1p C2 domain found in protein kinase C (Pkc1p) in Saccharomyces cerevisiae | Back alignment and domain information |
|---|
| >PLN02228 Phosphoinositide phospholipase C | Back alignment and domain information |
|---|
| >KOG1028|consensus | Back alignment and domain information |
|---|
| >KOG2059|consensus | Back alignment and domain information |
|---|
| >COG5038 Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1328|consensus | Back alignment and domain information |
|---|
| >KOG0696|consensus | Back alignment and domain information |
|---|
| >KOG1028|consensus | Back alignment and domain information |
|---|
| >PLN02270 phospholipase D alpha | Back alignment and domain information |
|---|
| >KOG1264|consensus | Back alignment and domain information |
|---|
| >KOG2059|consensus | Back alignment and domain information |
|---|
| >COG5038 Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] | Back alignment and domain information |
|---|
| >PF15625 CC2D2AN-C2: CC2D2A N-terminal C2 domain | Back alignment and domain information |
|---|
| >KOG1011|consensus | Back alignment and domain information |
|---|
| >cd08679 C2_DOCK180_related C2 domains found in Dedicator Of CytoKinesis 1 (DOCK 180) and related proteins | Back alignment and domain information |
|---|
| >PF14429 DOCK-C2: C2 domain in Dock180 and Zizimin proteins; PDB: 3L4C_A | Back alignment and domain information |
|---|
| >KOG1031|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 85 | ||||
| 2cjt_A | 131 | Structural Basis For A Munc13-1 Dimeric - Munc13-1 | 2e-05 | ||
| 2cjs_A | 167 | Structural Basis For A Munc13-1 Dimeric - Munc13-1 | 2e-05 |
| >pdb|2CJT|A Chain A, Structural Basis For A Munc13-1 Dimeric - Munc13-1 - Rim Heterodimer Switch: C2-Domains As Versatile Protein- Protein Interaction Modules Length = 131 | Back alignment and structure |
|
| >pdb|2CJS|A Chain A, Structural Basis For A Munc13-1 Dimeric - Munc13-1 - Rim Heterodimer Switch: C2-domains As Versatile Protein- Protein Interaction Modules Length = 167 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 85 | |||
| 2cjs_A | 167 | UNC-13 homolog A, MUNC13-1; neurotransmitter trans | 2e-12 | |
| 2cjt_A | 131 | UNC-13 homolog A, MUNC13-1; phorbol-ester binding, | 2e-10 |
| >2cjs_A UNC-13 homolog A, MUNC13-1; neurotransmitter transport, zinc finger, synapto phorbol-ester binding; 1.78A {Rattus norvegicus} SCOP: b.7.1.1 Length = 167 | Back alignment and structure |
|---|
Score = 58.1 bits (140), Expect = 2e-12
Identities = 19/44 (43%), Positives = 29/44 (65%)
Query: 28 ETNDVNQGLLIEVWDKGIIWDRAIGYHYLPLPQVAFSNEVGSRK 71
E N ++ GL +EVW+KG+IWD +G ++PL + SNE G +
Sbjct: 64 EINRLDLGLTVEVWNKGLIWDTMVGTVWIPLRTIRQSNEEGPGE 107
|
| >2cjt_A UNC-13 homolog A, MUNC13-1; phorbol-ester binding, neurotransmitter release, RIM, MUNC13 domains, exocytosis, metal-binding; 1.44A {Rattus norvegicus} SCOP: b.7.1.1 Length = 131 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 85 | |||
| 2cjt_A | 131 | UNC-13 homolog A, MUNC13-1; phorbol-ester binding, | 99.42 | |
| 2cjs_A | 167 | UNC-13 homolog A, MUNC13-1; neurotransmitter trans | 99.38 | |
| 1rlw_A | 126 | Phospholipase A2, CALB domain; hydrolase, C2 domai | 99.11 | |
| 2bwq_A | 129 | Regulating synaptic membrane exocytosis protein 2; | 99.06 | |
| 2dmh_A | 140 | Myoferlin; beta-sandwich, FER-1-like protein 3, mu | 99.03 | |
| 1wfj_A | 136 | Putative elicitor-responsive gene; C2 domain, rike | 99.02 | |
| 3b7y_A | 153 | E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL- | 99.01 | |
| 3kwu_A | 148 | MUNC13-1; calcium binding protein, phospholipid bi | 99.01 | |
| 1gmi_A | 136 | Protein kinase C, epsilon type; PKC, C2 domain, X- | 98.99 | |
| 3m7f_B | 176 | E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB1 | 98.97 | |
| 2ep6_A | 133 | MCTP2 protein; beta sandwich, Ca2+ binding, membra | 98.96 | |
| 3pyc_A | 132 | E3 ubiquitin-protein ligase smurf1; phospholipid b | 98.94 | |
| 2q3x_A | 171 | Regulating synaptic membrane exocytosis protein 1; | 98.94 | |
| 1v27_A | 141 | Regulating synaptic membrane exocytosis protein 2; | 98.94 | |
| 1rh8_A | 142 | Piccolo protein; beta-sandwich, metal binding prot | 98.93 | |
| 3f04_A | 143 | Synaptotagmin-1; C2A, calcium, cell junction, cyto | 98.92 | |
| 2b3r_A | 134 | Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA | 98.92 | |
| 1rsy_A | 152 | Synaptotagmin I; calcium/phospholipid binding prot | 98.9 | |
| 1wfm_A | 138 | Synaptotagmin XIII; C2 domain, exocytosis, neurotr | 98.89 | |
| 2d8k_A | 141 | Synaptotagmin VII; exocytosis, calcium binding, ly | 98.89 | |
| 3fdw_A | 148 | Synaptotagmin-like protein 4; structural genomics, | 98.88 | |
| 1a25_A | 149 | CALB, protein kinase C (beta); calcium++/phospholi | 98.87 | |
| 2dmg_A | 142 | KIAA1228 protein; beta-sandwich, structural genomi | 98.84 | |
| 3fbk_A | 153 | RGS3, RGP3, regulator of G-protein signaling 3; al | 98.84 | |
| 2fk9_A | 157 | Protein kinase C, ETA type; ATP-binding, metal-bin | 98.81 | |
| 3rdl_A | 137 | Protein kinase C alpha type; protein kinase PKC, t | 98.81 | |
| 2enp_A | 147 | B/K protein; C2 type 1,beta sandwich, structural g | 98.78 | |
| 1ugk_A | 138 | Synaptotagmin IV, KIAA1342; beta sandwich, structu | 98.77 | |
| 2chd_A | 142 | Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium | 98.75 | |
| 2nq3_A | 173 | Itchy homolog E3 ubiquitin protein ligase; C2 doma | 98.71 | |
| 1tjx_A | 159 | Similar to synaptotagmini/P65; C2B domain, calcium | 98.71 | |
| 1w15_A | 153 | Synaptotagmin IV; metal binding protein, endocytos | 98.71 | |
| 3n5a_A | 138 | Synaptotagmin-7; calcium/phospholipid binding prot | 98.69 | |
| 2r83_A | 284 | Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel | 98.66 | |
| 2z0u_A | 155 | WW domain-containing protein 1; C2 domain, alterna | 98.59 | |
| 2cm5_A | 166 | Rabphilin-3A; protein transport, zinc-finger, Ca2+ | 98.55 | |
| 1cjy_A | 749 | CPLA2, protein (cytosolic phospholipase A2); lipid | 98.39 | |
| 2r83_A | 284 | Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel | 98.35 | |
| 3jzy_A | 510 | Intersectin 2; C2 domain, structural genomics cons | 98.33 | |
| 3bxj_A | 483 | RAS GTPase-activating protein syngap; GTPase activ | 98.21 | |
| 3nsj_A | 540 | Perforin-1; pore forming protein, immune system; H | 98.19 | |
| 1djx_A | 624 | PLC-D1, phosphoinositide-specific phospholipase C, | 98.06 | |
| 1dqv_A | 296 | Synaptotagmin III; beta sandwich, calcium ION, C2 | 97.96 | |
| 3ohm_B | 885 | 1-phosphatidylinositol-4,5-bisphosphate phosphodi | 97.93 | |
| 1dqv_A | 296 | Synaptotagmin III; beta sandwich, calcium ION, C2 | 97.92 | |
| 3qr0_A | 816 | Phospholipase C-beta (PLC-beta); PH domain, EF han | 97.8 | |
| 2zkm_X | 799 | 1-phosphatidylinositol-4,5-bisphosphate phosphodie | 97.63 | |
| 3pfq_A | 674 | PKC-B, PKC-beta, protein kinase C beta type; phosp | 97.54 | |
| 3l9b_A | 144 | Otoferlin; C2-domain, beta-sheets, cell membrane, | 96.66 | |
| 2enj_A | 138 | NPKC-theta, protein kinase C theta type; beta-sand | 89.75 | |
| 1yrk_A | 126 | NPKC-delta, protein kinase C, delta type; C2 domai | 89.45 |
| >2cjt_A UNC-13 homolog A, MUNC13-1; phorbol-ester binding, neurotransmitter release, RIM, MUNC13 domains, exocytosis, metal-binding; 1.44A {Rattus norvegicus} SCOP: b.7.1.1 | Back alignment and structure |
|---|
Probab=99.42 E-value=4.3e-13 Score=88.34 Aligned_cols=62 Identities=35% Similarity=0.686 Sum_probs=54.1
Q ss_pred ecCceeeeeccccceeeEeeeccCCCCceEEEEeeCCeeeeceeeEEEeecCCeeeecCcCCCceeEee
Q psy8569 8 IGSNFRWSVFSVKTRFEVPSETNDVNQGLLIEVWDKGIIWDRAIGYHYLPLPQVAFSNEVGSRKTAGVK 76 (85)
Q Consensus 8 ~g~~P~W~~~~~~~~~~f~fet~d~~~gL~vEVWnKgviwDdLLG~~~lPL~~v~~s~e~g~g~W~~l~ 76 (85)
++.||.||+ +|.|+..+.+..|.|+|||+|+..||+||.+.|||++|..+...+..+|..+.
T Consensus 42 ~t~nP~WnE-------~f~f~v~~~~~~L~~~V~D~d~~~dd~iG~~~i~l~~l~~~~~~~~~~~~~~~ 103 (131)
T 2cjt_A 42 RGSQPSWEQ-------DFMFEINRLDLGLTVEVWNKGLIWDTMVGTVWIPLRTIRQSNEEGPGEWLTLD 103 (131)
T ss_dssp ESSSCEEEE-------EEEEEECCCSSEEEEEEEECCSSCEEEEEEEEEEGGGSCBCSSCCCCEEEECB
T ss_pred CCCCceECC-------EEEEEEeCCCCeEEEEEEECCCCCCCeEEEEEEEHHHhhhcCCCCccccEEcc
Confidence 589999999 99999988878899999999988999999999999999887666666776543
|
| >2cjs_A UNC-13 homolog A, MUNC13-1; neurotransmitter transport, zinc finger, synapto phorbol-ester binding; 1.78A {Rattus norvegicus} SCOP: b.7.1.1 | Back alignment and structure |
|---|
| >1rlw_A Phospholipase A2, CALB domain; hydrolase, C2 domain; 2.40A {Homo sapiens} SCOP: b.7.1.1 | Back alignment and structure |
|---|
| >2bwq_A Regulating synaptic membrane exocytosis protein 2; C2 domain, neurotransmitter release, transport protein; 1.41A {Rattus norvegicus} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >2dmh_A Myoferlin; beta-sandwich, FER-1-like protein 3, muscular dystrophy, cardiomyopathy, membrane fusion, dystrophin, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1wfj_A Putative elicitor-responsive gene; C2 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, plant protein; NMR {Arabidopsis thaliana} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >3b7y_A E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-conjugation pathway, structural genomics consortium, SGC, cytoplasm; 1.80A {Homo sapiens} PDB: 2nsq_A | Back alignment and structure |
|---|
| >3kwu_A MUNC13-1; calcium binding protein, phospholipid binding protein, metal binding protein; HET: GOL; 1.37A {Rattus norvegicus} SCOP: b.7.1.0 PDB: 3kwt_A* | Back alignment and structure |
|---|
| >1gmi_A Protein kinase C, epsilon type; PKC, C2 domain, X-RAY, phospholipids, PKC epsilon.; 1.7A {Rattus rattus} SCOP: b.7.1.1 | Back alignment and structure |
|---|
| >3m7f_B E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB10, SH2 domain, phosphoprotein, conjugation pathway, signaling protein-ligase complex; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2ep6_A MCTP2 protein; beta sandwich, Ca2+ binding, membrane binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.7.1.1 | Back alignment and structure |
|---|
| >3pyc_A E3 ubiquitin-protein ligase smurf1; phospholipid binding, membrane associate, lipid binding PROT; 1.96A {Homo sapiens} PDB: 2jqz_A | Back alignment and structure |
|---|
| >2q3x_A Regulating synaptic membrane exocytosis protein 1; C2 domain dimer, neurotransmitter release, transport protein; HET: MSE; 1.73A {Rattus norvegicus} | Back alignment and structure |
|---|
| >1v27_A Regulating synaptic membrane exocytosis protein 2; RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >1rh8_A Piccolo protein; beta-sandwich, metal binding protein; NMR {Rattus norvegicus} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >3f04_A Synaptotagmin-1; C2A, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal- binding, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.7.1.2 PDB: 3f01_A 3f05_A 3f00_A 1byn_A 2k45_A 2k4a_A 2k8m_A 2ki6_A* | Back alignment and structure |
|---|
| >2b3r_A Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA containing alpha polypeptide; C2 domain, lipid binding, PI3-kinase, transferase; 2.30A {Mus musculus} | Back alignment and structure |
|---|
| >1rsy_A Synaptotagmin I; calcium/phospholipid binding protein; 1.90A {Rattus norvegicus} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >1wfm_A Synaptotagmin XIII; C2 domain, exocytosis, neurotransmitter release, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >2d8k_A Synaptotagmin VII; exocytosis, calcium binding, lysosome, C2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3fdw_A Synaptotagmin-like protein 4; structural genomics, phospholipid binding, alternative splicing, cell membrane, cytoplasmic vesicle, membrane; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1a25_A CALB, protein kinase C (beta); calcium++/phospholipid binding protein, calcium-binding protein; HET: PSE; 2.70A {Rattus norvegicus} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >2dmg_A KIAA1228 protein; beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3fbk_A RGS3, RGP3, regulator of G-protein signaling 3; all beta-sheet fold, structural genomics, PSI-2, protein structure initiative; 2.00A {Homo sapiens} SCOP: b.7.1.0 | Back alignment and structure |
|---|
| >2fk9_A Protein kinase C, ETA type; ATP-binding, metal-binding, nucleotide-binding, diacylglycerol binding, serine/threonine-protein kinase, transferase; 1.75A {Homo sapiens} | Back alignment and structure |
|---|
| >2enp_A B/K protein; C2 type 1,beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1ugk_A Synaptotagmin IV, KIAA1342; beta sandwich, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >2chd_A Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium binding, synaptic EXOC metal-binding, protein transport, synapse, transport, zinc-; 1.92A {Rattus norvegicus} PDB: 2k3h_A | Back alignment and structure |
|---|
| >2nq3_A Itchy homolog E3 ubiquitin protein ligase; C2 domain, UBL conjugation pathway, structural genomics consortium, SGC; 1.80A {Homo sapiens} SCOP: b.7.1.1 | Back alignment and structure |
|---|
| >1tjx_A Similar to synaptotagmini/P65; C2B domain, calcium binding, endocytosis-EX complex; HET: GOL; 1.04A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1tjm_A* 1uov_A 1uow_A 1k5w_A 2lha_A* | Back alignment and structure |
|---|
| >1w15_A Synaptotagmin IV; metal binding protein, endocytosis/exocytosis neurotransmitter release, transmembrane; 1.93A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1w16_A | Back alignment and structure |
|---|
| >3n5a_A Synaptotagmin-7; calcium/phospholipid binding protein, protein transport; 1.44A {Mus musculus} | Back alignment and structure |
|---|
| >2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >2z0u_A WW domain-containing protein 1; C2 domain, alternative splicing, coiled coil, cytoplasm, phosphorylation, polymorphism, lipid binding protein; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2cm5_A Rabphilin-3A; protein transport, zinc-finger, Ca2+ binding, metal-binding, synaptic exocytosis, C2A-C2B linker fragment, C2B, zinc, synapse; 1.28A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 2cm6_A 3rpb_A | Back alignment and structure |
|---|
| >1cjy_A CPLA2, protein (cytosolic phospholipase A2); lipid-binding, hydrolase; HET: MES; 2.50A {Homo sapiens} SCOP: b.7.1.1 c.19.1.2 PDB: 1bci_A | Back alignment and structure |
|---|
| >2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 | Back alignment and structure |
|---|
| >3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B | Back alignment and structure |
|---|
| >3bxj_A RAS GTPase-activating protein syngap; GTPase activation, membrane, phosphoprotein, SH3-binding, signaling protein; 3.00A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3nsj_A Perforin-1; pore forming protein, immune system; HET: NAG; 2.75A {Mus musculus} | Back alignment and structure |
|---|
| >1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A | Back alignment and structure |
|---|
| >1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A | Back alignment and structure |
|---|
| >3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A | Back alignment and structure |
|---|
| >3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A | Back alignment and structure |
|---|
| >2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B | Back alignment and structure |
|---|
| >3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A | Back alignment and structure |
|---|
| >3l9b_A Otoferlin; C2-domain, beta-sheets, cell membrane, synaptic V hearing, membrane, synapse, transmembrane, membrane protein; 1.95A {Rattus norvegicus} | Back alignment and structure |
|---|
| >2enj_A NPKC-theta, protein kinase C theta type; beta-sandwich, phosphotyrosine binding, TCR, T-cell, diacylglycerol, phorbol ester, structural genomics; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >1yrk_A NPKC-delta, protein kinase C, delta type; C2 domain, protein binding; HET: PTR; 1.70A {Homo sapiens} PDB: 1bdy_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
No hit with e-value below 0.005
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 85 | |||
| d2cjta1 | 128 | Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: | 99.67 | |
| d1rlwa_ | 126 | Domain from cytosolic phospholipase A2 {Human (Hom | 99.03 | |
| d2ep6a1 | 126 | Multiple C2 and transmembrane domain-containing pr | 98.96 | |
| d1gmia_ | 136 | Domain from protein kinase C epsilon {Rat (Rattus | 98.93 | |
| d1wfja_ | 136 | C2 domain protein At1g63220 {Thale cress (Arabidop | 98.92 | |
| d1a25a_ | 132 | C2 domain from protein kinase c (beta) {Rat (Rattu | 98.85 | |
| d1rh8a_ | 142 | Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} | 98.82 | |
| d1qasa2 | 131 | PI-specific phospholipase C isozyme D1 (PLC-D1), C | 98.82 | |
| d1dqva1 | 130 | Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: | 98.7 | |
| d1rsya_ | 143 | Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 | 98.66 | |
| d2nq3a1 | 133 | E3 ubiquitin-protein ligase Itchy {Human (Homo sap | 98.64 | |
| d1wfma_ | 138 | Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9 | 98.61 | |
| d2bwqa1 | 125 | Regulating synaptic membrane exocytosis protein, r | 98.59 | |
| d1ugka_ | 138 | Synaptotagmin IV {Human (Homo sapiens) [TaxId: 960 | 98.48 | |
| d1bdya_ | 123 | Domain from protein kinase C delta {Rat (Rattus no | 98.43 | |
| d1w15a_ | 138 | Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: | 98.42 | |
| d1uowa_ | 157 | Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 | 98.4 | |
| d2zkmx2 | 122 | Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI | 98.38 | |
| d2cm5a1 | 137 | C2b-domain of rabphilin {Rat (Rattus norvegicus) [ | 98.23 | |
| d1dqva2 | 145 | Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: | 97.96 |
| >d2cjta1 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: C2 domain-like superfamily: C2 domain (Calcium/lipid-binding domain, CaLB) family: PLC-like (P variant) domain: Unc-13 homolog A species: Rat (Rattus norvegicus) [TaxId: 10116]
Probab=99.67 E-value=4.4e-17 Score=107.91 Aligned_cols=69 Identities=33% Similarity=0.624 Sum_probs=65.0
Q ss_pred ceeeeeecCceeeeeccccceeeEeeeccCCCCceEEEEeeCCeeeeceeeEEEeecCCeeeecCcCCCceeEeec
Q psy8569 2 RKESNVIGSNFRWSVFSVKTRFEVPSETNDVNQGLLIEVWDKGIIWDRAIGYHYLPLPQVAFSNEVGSRKTAGVKG 77 (85)
Q Consensus 2 ~~~~~v~g~~P~W~~~~~~~~~~f~fet~d~~~gL~vEVWnKgviwDdLLG~~~lPL~~v~~s~e~g~g~W~~l~~ 77 (85)
.+|..++|+||.|++ +|.|.+.+.+..|.|+|||++.+.|++||.+.|||++|..+++.++++|+.|..
T Consensus 33 ~~T~~~k~~nP~Wne-------~f~f~v~~~~~~L~v~V~d~~~~~d~~lG~~~I~L~~l~~~~~~~~~~W~~L~~ 101 (128)
T d2cjta1 33 STTIAVRGSQPSWEQ-------DFMFEINRLDLGLTVEVWNKGLIWDTMVGTVWIPLRTIRQSNEEGPGEWLTLDS 101 (128)
T ss_dssp EECCCEESSSCEEEE-------EEEEEECCCSSEEEEEEEECCSSCEEEEEEEEEEGGGSCBCSSCCCCEEEECBC
T ss_pred EEEEEecCCCCeEEE-------EEEEeeccccceEEEEEEeCCCcCCcceEEEEEEehhhccCCCCCCCeeEECCc
Confidence 467888999999999 999999999889999999999999999999999999999999999999999953
|
| >d1rlwa_ b.7.1.1 (A:) Domain from cytosolic phospholipase A2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ep6a1 b.7.1.1 (A:92-217) Multiple C2 and transmembrane domain-containing protein 2, MCTP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1gmia_ b.7.1.1 (A:) Domain from protein kinase C epsilon {Rat (Rattus rattus) [TaxId: 10117]} | Back information, alignment and structure |
|---|
| >d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1a25a_ b.7.1.2 (A:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1rh8a_ b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1qasa2 b.7.1.1 (A:626-756) PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1dqva1 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1rsya_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2nq3a1 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itchy {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wfma_ b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bwqa1 b.7.1.2 (A:729-853) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ugka_ b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bdya_ b.7.1.1 (A:) Domain from protein kinase C delta {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1w15a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1uowa_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d2zkmx2 b.7.1.1 (X:678-799) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2cm5a1 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1dqva2 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|