Psyllid ID: psy8569


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80-----
MRKESNVIGSNFRWSVFSVKTRFEVPSETNDVNQGLLIEVWDKGIIWDRAIGYHYLPLPQVAFSNEVGSRKTAGVKGLFSPIRAG
cccccccccccEEEEEEEEEEEcccccccccccccEEEEEEEccEEEEEEcEEEEEEcccccccccccccccccccccccccccc
ccccccEEccccEEEEEEEEEEcEcccccccccccEEEEEEcccEEEHHEEEEEEEEcccEEEEccccccccccccccccccccc
mrkesnvigsnfrwsvfsvktrfevpsetndvnqgLLIEVWDKgiiwdraigyhylplpqvafsnevgsrktagvkglfspirag
mrkesnvigsnfrwsvfsvktrfevpsetndvnqglLIEVWDKGIIWDRAIGYHYLPLPQVAFSnevgsrktagvkglfspirag
MRKESNVIGSNFRWSVFSVKTRFEVPSETNDVNQGLLIEVWDKGIIWDRAIGYHYLPLPQVAFSNEVGSRKTAGVKGLFSPIRAG
******VIGSNFRWSVFSVKTRFEVPSETNDVNQGLLIEVWDKGIIWDRAIGYHYLPLPQVAFSNEV******************
******V**SNFRWSVFSVKTRFEVPSETNDVNQGLLIEVWDKGIIWDRAIGYHYLPLP******************LFSPI***
********GSNFRWSVFSVKTRFEVPSETNDVNQGLLIEVWDKGIIWDRAIGYHYLPLPQVAFSNEVGSRKTAGVKGLFSPIRAG
*****NVIGSNFRWSVFSVKTRFEVPSETNDVNQGLLIEVWDKGIIWDRAIGYHYLPLPQVAFSNE*******************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRKESNVIGSNFRWSVFSVKTRFEVPSETNDVNQGLLIEVWDKGIIWDRAIGYHYLPLPQVAFSNEVGSRKTAGVKGLFSPIRAG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query85 2.2.26 [Sep-21-2011]
P27715 2155 Phorbol ester/diacylglyce no N/A 0.494 0.019 0.476 3e-08
Q9UPW8 1703 Protein unc-13 homolog A yes N/A 0.482 0.024 0.463 5e-05
Q62768 1735 Protein unc-13 homolog A yes N/A 0.482 0.023 0.463 5e-05
Q4KUS2 1712 Protein unc-13 homolog A yes N/A 0.482 0.023 0.463 5e-05
>sp|P27715|UNC13_CAEEL Phorbol ester/diacylglycerol-binding protein unc-13 OS=Caenorhabditis elegans GN=unc-13 PE=1 SV=4 Back     alignment and function desciption
 Score = 57.4 bits (137), Expect = 3e-08,   Method: Composition-based stats.
 Identities = 20/42 (47%), Positives = 32/42 (76%)

Query: 28  ETNDVNQGLLIEVWDKGIIWDRAIGYHYLPLPQVAFSNEVGS 69
           ETN  + G+++E+W KG++WD+ IG HY+PL ++ +SN  GS
Sbjct: 69  ETNRPDDGMVLELWAKGVLWDKLIGVHYMPLSEIRYSNAAGS 110




May form part of a signal transduction pathway, transducing the signal from diacylglycerol to effector functions. One such function could be the release of neurotransmitter from neurons.
Caenorhabditis elegans (taxid: 6239)
>sp|Q9UPW8|UN13A_HUMAN Protein unc-13 homolog A OS=Homo sapiens GN=UNC13A PE=2 SV=4 Back     alignment and function description
>sp|Q62768|UN13A_RAT Protein unc-13 homolog A OS=Rattus norvegicus GN=Unc13a PE=1 SV=1 Back     alignment and function description
>sp|Q4KUS2|UN13A_MOUSE Protein unc-13 homolog A OS=Mus musculus GN=Unc13a PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query85
270015463 389 hypothetical protein TcasGA2_TC004068 [T 0.494 0.107 0.690 9e-11
242016344178 unc-13, putative [Pediculus humanus corp 0.494 0.235 0.666 8e-10
340714749 2550 PREDICTED: protein unc-13 homolog B-like 0.529 0.017 0.577 8e-10
350414989 191 PREDICTED: phorbol ester/diacylglycerol- 0.494 0.219 0.619 3e-09
383855782 1503 PREDICTED: uncharacterized protein LOC10 0.529 0.029 0.555 4e-09
307214946 211 Phorbol ester/diacylglycerol-binding pro 0.470 0.189 0.625 6e-09
307173526 1373 Phorbol ester/diacylglycerol-binding pro 0.470 0.029 0.625 1e-08
332022807 223 Phorbol ester/diacylglycerol-binding pro 0.470 0.179 0.6 2e-08
328701429 843 PREDICTED: hypothetical protein LOC10057 0.482 0.048 0.634 2e-07
324500257 1800 Phorbol ester/diacylglycerol-binding pro 0.517 0.024 0.477 5e-07
>gi|270015463|gb|EFA11911.1| hypothetical protein TcasGA2_TC004068 [Tribolium castaneum] Back     alignment and taxonomy information
 Score = 70.9 bits (172), Expect = 9e-11,   Method: Composition-based stats.
 Identities = 29/42 (69%), Positives = 36/42 (85%)

Query: 28  ETNDVNQGLLIEVWDKGIIWDRAIGYHYLPLPQVAFSNEVGS 69
           ETND+N GLLIEVW KG+IWDRA+GYH++PL  V +SNE G+
Sbjct: 86  ETNDLNTGLLIEVWSKGMIWDRAMGYHWIPLQTVQYSNEEGN 127




Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|242016344|ref|XP_002428789.1| unc-13, putative [Pediculus humanus corporis] gi|212513474|gb|EEB16051.1| unc-13, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|340714749|ref|XP_003395887.1| PREDICTED: protein unc-13 homolog B-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350414989|ref|XP_003490496.1| PREDICTED: phorbol ester/diacylglycerol-binding protein unc-13-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|383855782|ref|XP_003703389.1| PREDICTED: uncharacterized protein LOC100882622 [Megachile rotundata] Back     alignment and taxonomy information
>gi|307214946|gb|EFN89791.1| Phorbol ester/diacylglycerol-binding protein unc-13 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|307173526|gb|EFN64436.1| Phorbol ester/diacylglycerol-binding protein unc-13 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|332022807|gb|EGI63080.1| Phorbol ester/diacylglycerol-binding protein unc-13 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|328701429|ref|XP_003241596.1| PREDICTED: hypothetical protein LOC100571379 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|324500257|gb|ADY40127.1| Phorbol ester/diacylglycerol-binding protein unc-13 [Ascaris suum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query85
WB|WBGene00006752 2155 unc-13 [Caenorhabditis elegans 0.494 0.019 0.476 2.2e-07
UNIPROTKB|F1P9E8 817 UNC13A "Uncharacterized protei 0.482 0.050 0.463 6.8e-05
ZFIN|ZDB-GENE-050208-748 1742 si:dkey-110c1.7 "si:dkey-110c1 0.482 0.023 0.463 9.9e-05
UNIPROTKB|F8VZH8 1676 UNC13A "Protein unc-13 homolog 0.482 0.024 0.463 0.00016
UNIPROTKB|F8W0P6 1697 UNC13A "Protein unc-13 homolog 0.482 0.024 0.463 0.00016
UNIPROTKB|H7BXE5 1703 UNC13A "Protein unc-13 homolog 0.482 0.024 0.463 0.00016
UNIPROTKB|Q9UPW8 1703 UNC13A "Protein unc-13 homolog 0.482 0.024 0.463 0.00016
MGI|MGI:3051532 1712 Unc13a "unc-13 homolog A (C. e 0.482 0.023 0.463 0.00016
UNIPROTKB|F8W059 1722 UNC13A "Protein unc-13 homolog 0.482 0.023 0.463 0.00016
UNIPROTKB|F1MK99 1732 UNC13A "Uncharacterized protei 0.482 0.023 0.463 0.00016
WB|WBGene00006752 unc-13 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
 Score = 135 (52.6 bits), Expect = 2.2e-07, P = 2.2e-07
 Identities = 20/42 (47%), Positives = 32/42 (76%)

Query:    28 ETNDVNQGLLIEVWDKGIIWDRAIGYHYLPLPQVAFSNEVGS 69
             ETN  + G+++E+W KG++WD+ IG HY+PL ++ +SN  GS
Sbjct:    69 ETNRPDDGMVLELWAKGVLWDKLIGVHYMPLSEIRYSNAAGS 110




GO:0040010 "positive regulation of growth rate" evidence=IMP
GO:0007411 "axon guidance" evidence=IMP
GO:0040011 "locomotion" evidence=IMP
GO:0046662 "regulation of oviposition" evidence=IGI;IMP
GO:0043051 "regulation of pharyngeal pumping" evidence=IGI;IMP
GO:0045202 "synapse" evidence=IDA
GO:0048786 "presynaptic active zone" evidence=IDA
UNIPROTKB|F1P9E8 UNC13A "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050208-748 si:dkey-110c1.7 "si:dkey-110c1.7" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F8VZH8 UNC13A "Protein unc-13 homolog A" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F8W0P6 UNC13A "Protein unc-13 homolog A" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|H7BXE5 UNC13A "Protein unc-13 homolog A" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q9UPW8 UNC13A "Protein unc-13 homolog A" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:3051532 Unc13a "unc-13 homolog A (C. elegans)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F8W059 UNC13A "Protein unc-13 homolog A" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1MK99 UNC13A "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query85
cd08394127 cd08394, C2A_Munc13, C2 domain first repeat in Mun 7e-12
>gnl|CDD|176040 cd08394, C2A_Munc13, C2 domain first repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
 Score = 56.3 bits (136), Expect = 7e-12
 Identities = 19/42 (45%), Positives = 29/42 (69%)

Query: 28 ETNDVNQGLLIEVWDKGIIWDRAIGYHYLPLPQVAFSNEVGS 69
          E N ++ GL+IE+W+KG+IWD  +G  ++PL  +  SNE G 
Sbjct: 52 EINRLDLGLVIELWNKGLIWDTLVGTVWIPLSTIRQSNEEGP 93


C2-like domains are thought to be involved in phospholipid binding in a Ca2+ independent manner in both Unc13 and Munc13. Caenorabditis elegans Unc13 has a central domain with sequence similarity to PKC, which includes C1 and C2-related domains. Unc13 binds phorbol esters and DAG with high affinity in a phospholipid manner. Mutations in Unc13 results in abnormal neuronal connections and impairment in cholinergic neurotransmission in the nematode. Munc13 is the mammalian homolog which are expressed in the brain. There are 3 isoforms (Munc13-1, -2, -3) and are thought to play a role in neurotransmitter release and are hypothesized to be high-affinity receptors for phorbol esters. Unc13 and Munc13 contain both C1 and C2 domains. There are two C2 related domains present, one central and one at the carboxyl end. Munc13-1 contains a third C2-like domain. Munc13 interacts with syntaxin, synaptobrevin, and synaptotagmin suggesting a role for these as scaffolding proteins. C2 domains fold into an 8-standed beta-sandwich that can adopt 2 structural arrangements: Type I and Type II, distinguished by a circular permutation involving their N- and C-terminal beta strands. Many C2 domains are Ca2+-dependent membrane-targeting modules that bind a wide variety of substances including bind phospholipids, inositol polyphosphates, and intracellular proteins. Most C2 domain proteins are either signal transduction enzymes that contain a single C2 domain, such as protein kinase C, or membrane trafficking proteins which contain at least two C2 domains, such as synaptotagmin 1. However, there are a few exceptions to this including RIM isoforms and some splice variants of piccolo/aczonin and intersectin which only have a single C2 domain. C2 domains with a calcium binding region have negatively charged residues, primarily aspartates, that serve as ligands for calcium ions. This cd contains the first C2 repeat, C2A, and has a type-II topology. Length = 127

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 85
cd08394127 C2A_Munc13 C2 domain first repeat in Munc13 (mamma 99.71
cd08682126 C2_Rab11-FIP_classI C2 domain found in Rab11-famil 99.03
cd04042121 C2A_MCTP_PRT C2 domain first repeat found in Multi 99.0
cd04050105 C2B_Synaptotagmin-like C2 domain second repeat pre 98.98
cd04016121 C2_Tollip C2 domain present in Toll-interacting pr 98.97
cd08681118 C2_fungal_Inn1p-like C2 domain found in fungal Ing 98.95
cd04052111 C2B_Tricalbin-like C2 domain second repeat present 98.91
cd08378121 C2B_MCTP_PRT_plant C2 domain second repeat found i 98.9
cd04022127 C2A_MCTP_PRT_plant C2 domain first repeat found in 98.87
cd08376116 C2B_MCTP_PRT C2 domain second repeat found in Mult 98.86
cd08379126 C2D_MCTP_PRT_plant C2 domain fourth repeat found i 98.85
cd08690155 C2_Freud-1 C2 domain found in 5' repressor element 98.85
cd08391121 C2A_C2C_Synaptotagmin_like C2 domain first and thi 98.84
cd08381122 C2B_PI3K_class_II C2 domain second repeat present 98.82
cd08678126 C2_C21orf25-like C2 domain found in the Human chro 98.82
cd04011111 C2B_Ferlin C2 domain second repeat in Ferlin. Ferl 98.82
cd04054121 C2A_Rasal1_RasA4 C2 domain first repeat present in 98.81
cd04033133 C2_NEDD4_NEDD4L C2 domain present in the Human neu 98.81
cd04043126 C2_Munc13_fungal C2 domain in Munc13 (mammalian un 98.78
cd04024128 C2A_Synaptotagmin-like C2 domain first repeat pres 98.78
cd04036119 C2_cPLA2 C2 domain present in cytosolic PhosphoLip 98.77
cd04015158 C2_plant_PLD C2 domain present in plant phospholip 98.77
cd08385124 C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repe 98.76
cd08395120 C2C_Munc13 C2 domain third repeat in Munc13 (mamma 98.74
cd08685119 C2_RGS-like C2 domain of the Regulator Of G-Protei 98.73
cd08521123 C2A_SLP C2 domain first repeat present in Synaptot 98.72
cd04048120 C2A_Copine C2 domain first repeat in Copine. There 98.72
cd08400126 C2_Ras_p21A1 C2 domain present in RAS p21 protein 98.72
cd04049124 C2_putative_Elicitor-responsive_gene C2 domain pre 98.72
cd04031125 C2A_RIM1alpha C2 domain first repeat contained in 98.71
cd04019150 C2C_MCTP_PRT_plant C2 domain third repeat found in 98.71
cd08375136 C2_Intersectin C2 domain present in Intersectin. A 98.71
cd04041111 C2A_fungal C2 domain first repeat; fungal group. C 98.7
cd04010148 C2B_RasA3 C2 domain second repeat present in RAS p 98.7
cd08377119 C2C_MCTP_PRT C2 domain third repeat found in Multi 98.69
cd08676153 C2A_Munc13-like C2 domain first repeat in Munc13 ( 98.69
cd04046126 C2_Calpain C2 domain present in Calpain proteins. 98.68
smart00239101 C2 Protein kinase C conserved region 2 (CalB). Ca2 98.68
cd08392128 C2A_SLP-3 C2 domain first repeat present in Synapt 98.68
cd08401121 C2A_RasA2_RasA3 C2 domain first repeat present in 98.67
cd08390123 C2A_Synaptotagmin-15-17 C2A domain first repeat pr 98.66
cd04018151 C2C_Ferlin C2 domain third repeat in Ferlin. Ferli 98.66
cd08688110 C2_KIAA0528-like C2 domain found in the Human KIAA 98.66
cd04032127 C2_Perforin C2 domain of Perforin. Perforin contai 98.66
cd04051125 C2_SRC2_like C2 domain present in Soybean genes Re 98.65
cd08387124 C2A_Synaptotagmin-8 C2A domain first repeat presen 98.65
cd04025123 C2B_RasA1_RasA4 C2 domain second repeat present in 98.64
cd04027127 C2B_Munc13 C2 domain second repeat in Munc13 (mamm 98.63
cd04044124 C2A_Tricalbin-like C2 domain first repeat present 98.62
cd04029125 C2A_SLP-4_5 C2 domain first repeat present in Syna 98.62
cd08382123 C2_Smurf-like C2 domain present in Smad ubiquitina 98.61
cd08675137 C2B_RasGAP C2 domain second repeat of Ras GTPase a 98.6
cd08393125 C2A_SLP-1_2 C2 domain first repeat present in Syna 98.59
cd04030127 C2C_KIAA1228 C2 domain third repeat present in unc 98.58
cd08389124 C2A_Synaptotagmin-14_16 C2A domain first repeat pr 98.57
cd04014132 C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) 98.54
cd04045120 C2C_Tricalbin-like C2 domain third repeat present 98.54
cd00030102 C2 C2 domain. The C2 domain was first identified i 98.53
cd08373127 C2A_Ferlin C2 domain first repeat in Ferlin. Ferli 98.51
cd04020162 C2B_SLP_1-2-3-4 C2 domain second repeat present in 98.49
cd04037124 C2E_Ferlin C2 domain fifth repeat in Ferlin. Ferli 98.47
cd04047110 C2B_Copine C2 domain second repeat in Copine. Ther 98.47
cd04039108 C2_PSD C2 domain present in Phosphatidylserine dec 98.47
cd08386125 C2A_Synaptotagmin-7 C2A domain first repeat presen 98.47
cd04040115 C2D_Tricalbin-like C2 domain fourth repeat present 98.46
cd00276134 C2B_Synaptotagmin C2 domain second repeat present 98.44
cd04017135 C2D_Ferlin C2 domain fourth repeat in Ferlin. Ferl 98.39
cd08388128 C2A_Synaptotagmin-4-11 C2A domain first repeat pre 98.39
cd04009133 C2B_Munc13-like C2 domain second repeat in Munc13 98.38
cd08403134 C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repe 98.37
cd04038145 C2_ArfGAP C2 domain present in Arf GTPase Activati 98.35
cd08691137 C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-li 98.33
cd08405136 C2B_Synaptotagmin-7 C2 domain second repeat presen 98.3
cd08383117 C2A_RasGAP C2 domain (first repeat) of Ras GTPase 98.29
cd04021125 C2_E3_ubiquitin_ligase C2 domain present in E3 ubi 98.25
cd04026131 C2_PKC_alpha_gamma C2 domain in Protein Kinase C ( 98.24
cd08384133 C2B_Rabphilin_Doc2 C2 domain second repeat present 98.24
cd04028146 C2B_RIM1alpha C2 domain second repeat contained in 98.23
cd04035123 C2A_Rabphilin_Doc2 C2 domain first repeat present 98.23
cd08402136 C2B_Synaptotagmin-1 C2 domain second repeat presen 98.21
cd00275128 C2_PLC_like C2 domain present in Phosphoinositide- 98.21
cd08404136 C2B_Synaptotagmin-4 C2 domain second repeat presen 98.11
cd08680124 C2_Kibra C2 domain found in Human protein Kibra. K 98.1
PLN03008 868 Phospholipase D delta 97.99
cd08677118 C2A_Synaptotagmin-13 C2 domain. Synaptotagmin is a 97.97
cd08692135 C2B_Tac2-N C2 domain second repeat found in Tac2-N 97.97
cd04013146 C2_SynGAP_like C2 domain present in Ras GTPase act 97.93
cd08409137 C2B_Synaptotagmin-15 C2 domain second repeat prese 97.92
PF0016885 C2: C2 domain; InterPro: IPR000008 The C2 domain i 97.89
cd08686118 C2_ABR C2 domain in the Active BCR (Breakpoint clu 97.88
cd08410135 C2B_Synaptotagmin-17 C2 domain second repeat prese 97.88
cd08406136 C2B_Synaptotagmin-12 C2 domain second repeat prese 97.78
cd08407138 C2B_Synaptotagmin-13 C2 domain second repeat prese 97.77
KOG1030|consensus168 97.73
cd08408138 C2B_Synaptotagmin-14_16 C2 domain second repeat pr 97.7
PLN032002102 cellulose synthase-interactive protein; Provisiona 97.65
cd08374133 C2F_Ferlin C2 domain sixth repeat in Ferlin. Ferli 97.58
PLN02223537 phosphoinositide phospholipase C 97.32
PLN02952599 phosphoinositide phospholipase C 97.26
PLN02222581 phosphoinositide phospholipase C 2 97.1
PLN02230598 phosphoinositide phospholipase C 4 97.03
KOG0169|consensus746 96.68
cd08689109 C2_fungal_Pkc1p C2 domain found in protein kinase 96.65
PLN02228567 Phosphoinositide phospholipase C 96.5
KOG1028|consensus 421 95.95
KOG2059|consensus 800 95.82
COG5038 1227 Ca2+-dependent lipid-binding protein, contains C2 95.14
KOG1328|consensus 1103 94.88
KOG0696|consensus 683 94.88
KOG1028|consensus421 93.89
PLN02270 808 phospholipase D alpha 93.54
KOG1264|consensus1267 93.41
KOG2059|consensus 800 91.2
COG50381227 Ca2+-dependent lipid-binding protein, contains C2 91.16
PF15625168 CC2D2AN-C2: CC2D2A N-terminal C2 domain 88.48
KOG1011|consensus 1283 87.8
cd08679178 C2_DOCK180_related C2 domains found in Dedicator O 86.88
PF14429184 DOCK-C2: C2 domain in Dock180 and Zizimin proteins 83.09
KOG1031|consensus 1169 81.95
>cd08394 C2A_Munc13 C2 domain first repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
Probab=99.71  E-value=1.6e-17  Score=116.27  Aligned_cols=67  Identities=34%  Similarity=0.648  Sum_probs=64.0

Q ss_pred             eeeeeecCceeeeeccccceeeEeeeccCCCCceEEEEeeCCeeeeceeeEEEeecCCeeeecCcCCCceeEee
Q psy8569           3 KESNVIGSNFRWSVFSVKTRFEVPSETNDVNQGLLIEVWDKGIIWDRAIGYHYLPLPQVAFSNEVGSRKTAGVK   76 (85)
Q Consensus         3 ~~~~v~g~~P~W~~~~~~~~~~f~fet~d~~~gL~vEVWnKgviwDdLLG~~~lPL~~v~~s~e~g~g~W~~l~   76 (85)
                      ++-.++|+||+|||       +|.|...+.++.|.|||||||++.||+||.+.|||++|.+++..++++|+.|+
T Consensus        34 kT~v~~~~nP~WnE-------~F~F~~~~~~~~L~v~V~dkd~~~DD~lG~v~i~L~~v~~~~~~~~~~Wy~L~  100 (127)
T cd08394          34 TTIAVRGSQPCWEQ-------DFMFEINRLDLGLVIELWNKGLIWDTLVGTVWIPLSTIRQSNEEGPGEWLTLD  100 (127)
T ss_pred             EeeECCCCCCceee-------EEEEEEcCCCCEEEEEEEeCCCcCCCceEEEEEEhHHcccCCCCCCCccEecC
Confidence            67788999999999       99999999999999999999999999999999999999999999999999986



C2-like domains are thought to be involved in phospholipid binding in a Ca2+ independent manner in both Unc13 and Munc13. Caenorabditis elegans Unc13 has a central domain with sequence similarity to PKC, which includes C1 and C2-related domains. Unc13 binds phorbol esters and DAG with high affinity in a phospholipid manner. Mutations in Unc13 results in abnormal neuronal connections and impairment in cholinergic neurotransmission in the nematode. Munc13 is the mammalian homolog which are expressed in the brain. There are 3 isoforms (Munc13-1, -2, -3) and are thought to play a role in neurotransmitter release and are hypothesized to be high-affinity receptors for phorbol esters. Unc13 and Munc13 contain both C1 and C2 domains. There are two C2 related domains present, one central and one at the carboxyl end. Munc13-1 contains a third C2-like domain. Munc13 interacts with syntaxin, synaptobrevi

>cd08682 C2_Rab11-FIP_classI C2 domain found in Rab11-family interacting proteins (FIP) class I Back     alignment and domain information
>cd04042 C2A_MCTP_PRT C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd04050 C2B_Synaptotagmin-like C2 domain second repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd04016 C2_Tollip C2 domain present in Toll-interacting protein (Tollip) Back     alignment and domain information
>cd08681 C2_fungal_Inn1p-like C2 domain found in fungal Ingression 1 (Inn1) proteins Back     alignment and domain information
>cd04052 C2B_Tricalbin-like C2 domain second repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd08378 C2B_MCTP_PRT_plant C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd04022 C2A_MCTP_PRT_plant C2 domain first repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd08376 C2B_MCTP_PRT C2 domain second repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd08379 C2D_MCTP_PRT_plant C2 domain fourth repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd08690 C2_Freud-1 C2 domain found in 5' repressor element under dual repression binding protein-1 (Freud-1) Back     alignment and domain information
>cd08391 C2A_C2C_Synaptotagmin_like C2 domain first and third repeat in Synaptotagmin-like proteins Back     alignment and domain information
>cd08381 C2B_PI3K_class_II C2 domain second repeat present in class II phosphatidylinositol 3-kinases (PI3Ks) Back     alignment and domain information
>cd08678 C2_C21orf25-like C2 domain found in the Human chromosome 21 open reading frame 25 (C21orf25) protein Back     alignment and domain information
>cd04011 C2B_Ferlin C2 domain second repeat in Ferlin Back     alignment and domain information
>cd04054 C2A_Rasal1_RasA4 C2 domain first repeat present in RasA1 and RasA4 Back     alignment and domain information
>cd04033 C2_NEDD4_NEDD4L C2 domain present in the Human neural precursor cell-expressed, developmentally down-regulated 4 (NEDD4) and NEDD4-like (NEDD4L/NEDD42) Back     alignment and domain information
>cd04043 C2_Munc13_fungal C2 domain in Munc13 (mammalian uncoordinated) proteins; fungal group Back     alignment and domain information
>cd04024 C2A_Synaptotagmin-like C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd04036 C2_cPLA2 C2 domain present in cytosolic PhosphoLipase A2 (cPLA2) Back     alignment and domain information
>cd04015 C2_plant_PLD C2 domain present in plant phospholipase D (PLD) Back     alignment and domain information
>cd08385 C2A_Synaptotagmin-1-5-6-9-10 C2A domain first repeat present in Synaptotagmins 1, 5, 6, 9, and 10 Back     alignment and domain information
>cd08395 C2C_Munc13 C2 domain third repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd08685 C2_RGS-like C2 domain of the Regulator Of G-Protein Signaling (RGS) family Back     alignment and domain information
>cd08521 C2A_SLP C2 domain first repeat present in Synaptotagmin-like proteins Back     alignment and domain information
>cd04048 C2A_Copine C2 domain first repeat in Copine Back     alignment and domain information
>cd08400 C2_Ras_p21A1 C2 domain present in RAS p21 protein activator 1 (RasA1) Back     alignment and domain information
>cd04049 C2_putative_Elicitor-responsive_gene C2 domain present in the putative elicitor-responsive gene Back     alignment and domain information
>cd04031 C2A_RIM1alpha C2 domain first repeat contained in Rab3-interacting molecule (RIM) proteins Back     alignment and domain information
>cd04019 C2C_MCTP_PRT_plant C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP); plant subset Back     alignment and domain information
>cd08375 C2_Intersectin C2 domain present in Intersectin Back     alignment and domain information
>cd04041 C2A_fungal C2 domain first repeat; fungal group Back     alignment and domain information
>cd04010 C2B_RasA3 C2 domain second repeat present in RAS p21 protein activator 3 (RasA3) Back     alignment and domain information
>cd08377 C2C_MCTP_PRT C2 domain third repeat found in Multiple C2 domain and Transmembrane region Proteins (MCTP) Back     alignment and domain information
>cd08676 C2A_Munc13-like C2 domain first repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>cd04046 C2_Calpain C2 domain present in Calpain proteins Back     alignment and domain information
>smart00239 C2 Protein kinase C conserved region 2 (CalB) Back     alignment and domain information
>cd08392 C2A_SLP-3 C2 domain first repeat present in Synaptotagmin-like protein 3 Back     alignment and domain information
>cd08401 C2A_RasA2_RasA3 C2 domain first repeat present in RasA2 and RasA3 Back     alignment and domain information
>cd08390 C2A_Synaptotagmin-15-17 C2A domain first repeat present in Synaptotagmins 15 and 17 Back     alignment and domain information
>cd04018 C2C_Ferlin C2 domain third repeat in Ferlin Back     alignment and domain information
>cd08688 C2_KIAA0528-like C2 domain found in the Human KIAA0528 cDNA clone Back     alignment and domain information
>cd04032 C2_Perforin C2 domain of Perforin Back     alignment and domain information
>cd04051 C2_SRC2_like C2 domain present in Soybean genes Regulated by Cold 2 (SRC2)-like proteins Back     alignment and domain information
>cd08387 C2A_Synaptotagmin-8 C2A domain first repeat present in Synaptotagmin 8 Back     alignment and domain information
>cd04025 C2B_RasA1_RasA4 C2 domain second repeat present in RasA1 and RasA4 Back     alignment and domain information
>cd04027 C2B_Munc13 C2 domain second repeat in Munc13 (mammalian uncoordinated) proteins Back     alignment and domain information
>cd04044 C2A_Tricalbin-like C2 domain first repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd04029 C2A_SLP-4_5 C2 domain first repeat present in Synaptotagmin-like proteins 4 and 5 Back     alignment and domain information
>cd08382 C2_Smurf-like C2 domain present in Smad ubiquitination-related factor (Smurf)-like proteins Back     alignment and domain information
>cd08675 C2B_RasGAP C2 domain second repeat of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>cd08393 C2A_SLP-1_2 C2 domain first repeat present in Synaptotagmin-like proteins 1 and 2 Back     alignment and domain information
>cd04030 C2C_KIAA1228 C2 domain third repeat present in uncharacterized human KIAA1228-like proteins Back     alignment and domain information
>cd08389 C2A_Synaptotagmin-14_16 C2A domain first repeat present in Synaptotagmins 14 and 16 Back     alignment and domain information
>cd04014 C2_PKC_epsilon C2 domain in Protein Kinase C (PKC) epsilon Back     alignment and domain information
>cd04045 C2C_Tricalbin-like C2 domain third repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd00030 C2 C2 domain Back     alignment and domain information
>cd08373 C2A_Ferlin C2 domain first repeat in Ferlin Back     alignment and domain information
>cd04020 C2B_SLP_1-2-3-4 C2 domain second repeat present in Synaptotagmin-like proteins 1-4 Back     alignment and domain information
>cd04037 C2E_Ferlin C2 domain fifth repeat in Ferlin Back     alignment and domain information
>cd04047 C2B_Copine C2 domain second repeat in Copine Back     alignment and domain information
>cd04039 C2_PSD C2 domain present in Phosphatidylserine decarboxylase (PSD) Back     alignment and domain information
>cd08386 C2A_Synaptotagmin-7 C2A domain first repeat present in Synaptotagmin 7 Back     alignment and domain information
>cd04040 C2D_Tricalbin-like C2 domain fourth repeat present in Tricalbin-like proteins Back     alignment and domain information
>cd00276 C2B_Synaptotagmin C2 domain second repeat present in Synaptotagmin Back     alignment and domain information
>cd04017 C2D_Ferlin C2 domain fourth repeat in Ferlin Back     alignment and domain information
>cd08388 C2A_Synaptotagmin-4-11 C2A domain first repeat present in Synaptotagmins 4 and 11 Back     alignment and domain information
>cd04009 C2B_Munc13-like C2 domain second repeat in Munc13 (mammalian uncoordinated)-like proteins Back     alignment and domain information
>cd08403 C2B_Synaptotagmin-3-5-6-9-10 C2 domain second repeat present in Synaptotagmins 3, 5, 6, 9, and 10 Back     alignment and domain information
>cd04038 C2_ArfGAP C2 domain present in Arf GTPase Activating Proteins (GAP) Back     alignment and domain information
>cd08691 C2_NEDL1-like C2 domain present in NEDL1 (NEDD4-like ubiquitin protein ligase-1) Back     alignment and domain information
>cd08405 C2B_Synaptotagmin-7 C2 domain second repeat present in Synaptotagmin 7 Back     alignment and domain information
>cd08383 C2A_RasGAP C2 domain (first repeat) of Ras GTPase activating proteins (GAPs) Back     alignment and domain information
>cd04021 C2_E3_ubiquitin_ligase C2 domain present in E3 ubiquitin ligase Back     alignment and domain information
>cd04026 C2_PKC_alpha_gamma C2 domain in Protein Kinase C (PKC) alpha and gamma Back     alignment and domain information
>cd08384 C2B_Rabphilin_Doc2 C2 domain second repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>cd04028 C2B_RIM1alpha C2 domain second repeat contained in Rab3-interacting molecule (RIM) proteins Back     alignment and domain information
>cd04035 C2A_Rabphilin_Doc2 C2 domain first repeat present in Rabphilin and Double C2 domain Back     alignment and domain information
>cd08402 C2B_Synaptotagmin-1 C2 domain second repeat present in Synaptotagmin 1 Back     alignment and domain information
>cd00275 C2_PLC_like C2 domain present in Phosphoinositide-specific phospholipases C (PLC) Back     alignment and domain information
>cd08404 C2B_Synaptotagmin-4 C2 domain second repeat present in Synaptotagmin 4 Back     alignment and domain information
>cd08680 C2_Kibra C2 domain found in Human protein Kibra Back     alignment and domain information
>PLN03008 Phospholipase D delta Back     alignment and domain information
>cd08677 C2A_Synaptotagmin-13 C2 domain Back     alignment and domain information
>cd08692 C2B_Tac2-N C2 domain second repeat found in Tac2-N (Tandem C2 protein in Nucleus) Back     alignment and domain information
>cd04013 C2_SynGAP_like C2 domain present in Ras GTPase activating protein (GAP) family Back     alignment and domain information
>cd08409 C2B_Synaptotagmin-15 C2 domain second repeat present in Synaptotagmin 15 Back     alignment and domain information
>PF00168 C2: C2 domain; InterPro: IPR000008 The C2 domain is a Ca2+-dependent membrane-targeting module found in many cellular proteins involved in signal transduction or membrane trafficking Back     alignment and domain information
>cd08686 C2_ABR C2 domain in the Active BCR (Breakpoint cluster region) Related protein Back     alignment and domain information
>cd08410 C2B_Synaptotagmin-17 C2 domain second repeat present in Synaptotagmin 17 Back     alignment and domain information
>cd08406 C2B_Synaptotagmin-12 C2 domain second repeat present in Synaptotagmin 12 Back     alignment and domain information
>cd08407 C2B_Synaptotagmin-13 C2 domain second repeat present in Synaptotagmin 13 Back     alignment and domain information
>KOG1030|consensus Back     alignment and domain information
>cd08408 C2B_Synaptotagmin-14_16 C2 domain second repeat present in Synaptotagmins 14 and 16 Back     alignment and domain information
>PLN03200 cellulose synthase-interactive protein; Provisional Back     alignment and domain information
>cd08374 C2F_Ferlin C2 domain sixth repeat in Ferlin Back     alignment and domain information
>PLN02223 phosphoinositide phospholipase C Back     alignment and domain information
>PLN02952 phosphoinositide phospholipase C Back     alignment and domain information
>PLN02222 phosphoinositide phospholipase C 2 Back     alignment and domain information
>PLN02230 phosphoinositide phospholipase C 4 Back     alignment and domain information
>KOG0169|consensus Back     alignment and domain information
>cd08689 C2_fungal_Pkc1p C2 domain found in protein kinase C (Pkc1p) in Saccharomyces cerevisiae Back     alignment and domain information
>PLN02228 Phosphoinositide phospholipase C Back     alignment and domain information
>KOG1028|consensus Back     alignment and domain information
>KOG2059|consensus Back     alignment and domain information
>COG5038 Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] Back     alignment and domain information
>KOG1328|consensus Back     alignment and domain information
>KOG0696|consensus Back     alignment and domain information
>KOG1028|consensus Back     alignment and domain information
>PLN02270 phospholipase D alpha Back     alignment and domain information
>KOG1264|consensus Back     alignment and domain information
>KOG2059|consensus Back     alignment and domain information
>COG5038 Ca2+-dependent lipid-binding protein, contains C2 domain [General function prediction only] Back     alignment and domain information
>PF15625 CC2D2AN-C2: CC2D2A N-terminal C2 domain Back     alignment and domain information
>KOG1011|consensus Back     alignment and domain information
>cd08679 C2_DOCK180_related C2 domains found in Dedicator Of CytoKinesis 1 (DOCK 180) and related proteins Back     alignment and domain information
>PF14429 DOCK-C2: C2 domain in Dock180 and Zizimin proteins; PDB: 3L4C_A Back     alignment and domain information
>KOG1031|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query85
2cjt_A131 Structural Basis For A Munc13-1 Dimeric - Munc13-1 2e-05
2cjs_A167 Structural Basis For A Munc13-1 Dimeric - Munc13-1 2e-05
>pdb|2CJT|A Chain A, Structural Basis For A Munc13-1 Dimeric - Munc13-1 - Rim Heterodimer Switch: C2-Domains As Versatile Protein- Protein Interaction Modules Length = 131 Back     alignment and structure

Iteration: 1

Score = 44.3 bits (103), Expect = 2e-05, Method: Compositional matrix adjust. Identities = 19/41 (46%), Positives = 28/41 (68%) Query: 28 ETNDVNQGLLIEVWDKGIIWDRAIGYHYLPLPQVAFSNEVG 68 E N ++ GL +EVW+KG+IWD +G ++PL + SNE G Sbjct: 55 EINRLDLGLTVEVWNKGLIWDTMVGTVWIPLRTIRQSNEEG 95
>pdb|2CJS|A Chain A, Structural Basis For A Munc13-1 Dimeric - Munc13-1 - Rim Heterodimer Switch: C2-domains As Versatile Protein- Protein Interaction Modules Length = 167 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query85
2cjs_A167 UNC-13 homolog A, MUNC13-1; neurotransmitter trans 2e-12
2cjt_A131 UNC-13 homolog A, MUNC13-1; phorbol-ester binding, 2e-10
>2cjs_A UNC-13 homolog A, MUNC13-1; neurotransmitter transport, zinc finger, synapto phorbol-ester binding; 1.78A {Rattus norvegicus} SCOP: b.7.1.1 Length = 167 Back     alignment and structure
 Score = 58.1 bits (140), Expect = 2e-12
 Identities = 19/44 (43%), Positives = 29/44 (65%)

Query: 28  ETNDVNQGLLIEVWDKGIIWDRAIGYHYLPLPQVAFSNEVGSRK 71
           E N ++ GL +EVW+KG+IWD  +G  ++PL  +  SNE G  +
Sbjct: 64  EINRLDLGLTVEVWNKGLIWDTMVGTVWIPLRTIRQSNEEGPGE 107


>2cjt_A UNC-13 homolog A, MUNC13-1; phorbol-ester binding, neurotransmitter release, RIM, MUNC13 domains, exocytosis, metal-binding; 1.44A {Rattus norvegicus} SCOP: b.7.1.1 Length = 131 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query85
2cjt_A131 UNC-13 homolog A, MUNC13-1; phorbol-ester binding, 99.42
2cjs_A167 UNC-13 homolog A, MUNC13-1; neurotransmitter trans 99.38
1rlw_A126 Phospholipase A2, CALB domain; hydrolase, C2 domai 99.11
2bwq_A129 Regulating synaptic membrane exocytosis protein 2; 99.06
2dmh_A140 Myoferlin; beta-sandwich, FER-1-like protein 3, mu 99.03
1wfj_A136 Putative elicitor-responsive gene; C2 domain, rike 99.02
3b7y_A153 E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL- 99.01
3kwu_A148 MUNC13-1; calcium binding protein, phospholipid bi 99.01
1gmi_A136 Protein kinase C, epsilon type; PKC, C2 domain, X- 98.99
3m7f_B176 E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB1 98.97
2ep6_A133 MCTP2 protein; beta sandwich, Ca2+ binding, membra 98.96
3pyc_A132 E3 ubiquitin-protein ligase smurf1; phospholipid b 98.94
2q3x_A171 Regulating synaptic membrane exocytosis protein 1; 98.94
1v27_A141 Regulating synaptic membrane exocytosis protein 2; 98.94
1rh8_A142 Piccolo protein; beta-sandwich, metal binding prot 98.93
3f04_A143 Synaptotagmin-1; C2A, calcium, cell junction, cyto 98.92
2b3r_A134 Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA 98.92
1rsy_A152 Synaptotagmin I; calcium/phospholipid binding prot 98.9
1wfm_A138 Synaptotagmin XIII; C2 domain, exocytosis, neurotr 98.89
2d8k_A141 Synaptotagmin VII; exocytosis, calcium binding, ly 98.89
3fdw_A148 Synaptotagmin-like protein 4; structural genomics, 98.88
1a25_A149 CALB, protein kinase C (beta); calcium++/phospholi 98.87
2dmg_A142 KIAA1228 protein; beta-sandwich, structural genomi 98.84
3fbk_A153 RGS3, RGP3, regulator of G-protein signaling 3; al 98.84
2fk9_A157 Protein kinase C, ETA type; ATP-binding, metal-bin 98.81
3rdl_A137 Protein kinase C alpha type; protein kinase PKC, t 98.81
2enp_A147 B/K protein; C2 type 1,beta sandwich, structural g 98.78
1ugk_A138 Synaptotagmin IV, KIAA1342; beta sandwich, structu 98.77
2chd_A142 Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium 98.75
2nq3_A173 Itchy homolog E3 ubiquitin protein ligase; C2 doma 98.71
1tjx_A159 Similar to synaptotagmini/P65; C2B domain, calcium 98.71
1w15_A153 Synaptotagmin IV; metal binding protein, endocytos 98.71
3n5a_A138 Synaptotagmin-7; calcium/phospholipid binding prot 98.69
2r83_A 284 Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel 98.66
2z0u_A155 WW domain-containing protein 1; C2 domain, alterna 98.59
2cm5_A166 Rabphilin-3A; protein transport, zinc-finger, Ca2+ 98.55
1cjy_A 749 CPLA2, protein (cytosolic phospholipase A2); lipid 98.39
2r83_A284 Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cel 98.35
3jzy_A510 Intersectin 2; C2 domain, structural genomics cons 98.33
3bxj_A 483 RAS GTPase-activating protein syngap; GTPase activ 98.21
3nsj_A540 Perforin-1; pore forming protein, immune system; H 98.19
1djx_A624 PLC-D1, phosphoinositide-specific phospholipase C, 98.06
1dqv_A296 Synaptotagmin III; beta sandwich, calcium ION, C2 97.96
3ohm_B885 1-phosphatidylinositol-4,5-bisphosphate phosphodi 97.93
1dqv_A 296 Synaptotagmin III; beta sandwich, calcium ION, C2 97.92
3qr0_A816 Phospholipase C-beta (PLC-beta); PH domain, EF han 97.8
2zkm_X799 1-phosphatidylinositol-4,5-bisphosphate phosphodie 97.63
3pfq_A 674 PKC-B, PKC-beta, protein kinase C beta type; phosp 97.54
3l9b_A144 Otoferlin; C2-domain, beta-sheets, cell membrane, 96.66
2enj_A138 NPKC-theta, protein kinase C theta type; beta-sand 89.75
1yrk_A126 NPKC-delta, protein kinase C, delta type; C2 domai 89.45
>2cjt_A UNC-13 homolog A, MUNC13-1; phorbol-ester binding, neurotransmitter release, RIM, MUNC13 domains, exocytosis, metal-binding; 1.44A {Rattus norvegicus} SCOP: b.7.1.1 Back     alignment and structure
Probab=99.42  E-value=4.3e-13  Score=88.34  Aligned_cols=62  Identities=35%  Similarity=0.686  Sum_probs=54.1

Q ss_pred             ecCceeeeeccccceeeEeeeccCCCCceEEEEeeCCeeeeceeeEEEeecCCeeeecCcCCCceeEee
Q psy8569           8 IGSNFRWSVFSVKTRFEVPSETNDVNQGLLIEVWDKGIIWDRAIGYHYLPLPQVAFSNEVGSRKTAGVK   76 (85)
Q Consensus         8 ~g~~P~W~~~~~~~~~~f~fet~d~~~gL~vEVWnKgviwDdLLG~~~lPL~~v~~s~e~g~g~W~~l~   76 (85)
                      ++.||.||+       +|.|+..+.+..|.|+|||+|+..||+||.+.|||++|..+...+..+|..+.
T Consensus        42 ~t~nP~WnE-------~f~f~v~~~~~~L~~~V~D~d~~~dd~iG~~~i~l~~l~~~~~~~~~~~~~~~  103 (131)
T 2cjt_A           42 RGSQPSWEQ-------DFMFEINRLDLGLTVEVWNKGLIWDTMVGTVWIPLRTIRQSNEEGPGEWLTLD  103 (131)
T ss_dssp             ESSSCEEEE-------EEEEEECCCSSEEEEEEEECCSSCEEEEEEEEEEGGGSCBCSSCCCCEEEECB
T ss_pred             CCCCceECC-------EEEEEEeCCCCeEEEEEEECCCCCCCeEEEEEEEHHHhhhcCCCCccccEEcc
Confidence            589999999       99999988878899999999988999999999999999887666666776543



>2cjs_A UNC-13 homolog A, MUNC13-1; neurotransmitter transport, zinc finger, synapto phorbol-ester binding; 1.78A {Rattus norvegicus} SCOP: b.7.1.1 Back     alignment and structure
>1rlw_A Phospholipase A2, CALB domain; hydrolase, C2 domain; 2.40A {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>2bwq_A Regulating synaptic membrane exocytosis protein 2; C2 domain, neurotransmitter release, transport protein; 1.41A {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>2dmh_A Myoferlin; beta-sandwich, FER-1-like protein 3, muscular dystrophy, cardiomyopathy, membrane fusion, dystrophin, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wfj_A Putative elicitor-responsive gene; C2 domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, plant protein; NMR {Arabidopsis thaliana} SCOP: b.7.1.2 Back     alignment and structure
>3b7y_A E3 ubiquitin-protein ligase NEDD4; C2 domain, UBL-conjugation pathway, structural genomics consortium, SGC, cytoplasm; 1.80A {Homo sapiens} PDB: 2nsq_A Back     alignment and structure
>3kwu_A MUNC13-1; calcium binding protein, phospholipid binding protein, metal binding protein; HET: GOL; 1.37A {Rattus norvegicus} SCOP: b.7.1.0 PDB: 3kwt_A* Back     alignment and structure
>1gmi_A Protein kinase C, epsilon type; PKC, C2 domain, X-RAY, phospholipids, PKC epsilon.; 1.7A {Rattus rattus} SCOP: b.7.1.1 Back     alignment and structure
>3m7f_B E3 ubiquitin-protein ligase NEDD4; C2 domain, GRB10, SH2 domain, phosphoprotein, conjugation pathway, signaling protein-ligase complex; 2.00A {Mus musculus} Back     alignment and structure
>2ep6_A MCTP2 protein; beta sandwich, Ca2+ binding, membrane binding, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>3pyc_A E3 ubiquitin-protein ligase smurf1; phospholipid binding, membrane associate, lipid binding PROT; 1.96A {Homo sapiens} PDB: 2jqz_A Back     alignment and structure
>2q3x_A Regulating synaptic membrane exocytosis protein 1; C2 domain dimer, neurotransmitter release, transport protein; HET: MSE; 1.73A {Rattus norvegicus} Back     alignment and structure
>1v27_A Regulating synaptic membrane exocytosis protein 2; RAB3-interacting molecule, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>1rh8_A Piccolo protein; beta-sandwich, metal binding protein; NMR {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>3f04_A Synaptotagmin-1; C2A, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal- binding, palmitate, phosphoprotein; 1.35A {Homo sapiens} SCOP: b.7.1.2 PDB: 3f01_A 3f05_A 3f00_A 1byn_A 2k45_A 2k4a_A 2k8m_A 2ki6_A* Back     alignment and structure
>2b3r_A Phosphatidylinositol-4-phosphate 3-kinase C2 DOMA containing alpha polypeptide; C2 domain, lipid binding, PI3-kinase, transferase; 2.30A {Mus musculus} Back     alignment and structure
>1rsy_A Synaptotagmin I; calcium/phospholipid binding protein; 1.90A {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>1wfm_A Synaptotagmin XIII; C2 domain, exocytosis, neurotransmitter release, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>2d8k_A Synaptotagmin VII; exocytosis, calcium binding, lysosome, C2 domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3fdw_A Synaptotagmin-like protein 4; structural genomics, phospholipid binding, alternative splicing, cell membrane, cytoplasmic vesicle, membrane; 2.20A {Homo sapiens} Back     alignment and structure
>1a25_A CALB, protein kinase C (beta); calcium++/phospholipid binding protein, calcium-binding protein; HET: PSE; 2.70A {Rattus norvegicus} SCOP: b.7.1.2 Back     alignment and structure
>2dmg_A KIAA1228 protein; beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3fbk_A RGS3, RGP3, regulator of G-protein signaling 3; all beta-sheet fold, structural genomics, PSI-2, protein structure initiative; 2.00A {Homo sapiens} SCOP: b.7.1.0 Back     alignment and structure
>2fk9_A Protein kinase C, ETA type; ATP-binding, metal-binding, nucleotide-binding, diacylglycerol binding, serine/threonine-protein kinase, transferase; 1.75A {Homo sapiens} Back     alignment and structure
>2enp_A B/K protein; C2 type 1,beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ugk_A Synaptotagmin IV, KIAA1342; beta sandwich, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>2chd_A Rabphilin-3A, exophilin-1; C2 domain, C2A, calcium binding, synaptic EXOC metal-binding, protein transport, synapse, transport, zinc-; 1.92A {Rattus norvegicus} PDB: 2k3h_A Back     alignment and structure
>2nq3_A Itchy homolog E3 ubiquitin protein ligase; C2 domain, UBL conjugation pathway, structural genomics consortium, SGC; 1.80A {Homo sapiens} SCOP: b.7.1.1 Back     alignment and structure
>1tjx_A Similar to synaptotagmini/P65; C2B domain, calcium binding, endocytosis-EX complex; HET: GOL; 1.04A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1tjm_A* 1uov_A 1uow_A 1k5w_A 2lha_A* Back     alignment and structure
>1w15_A Synaptotagmin IV; metal binding protein, endocytosis/exocytosis neurotransmitter release, transmembrane; 1.93A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 1w16_A Back     alignment and structure
>3n5a_A Synaptotagmin-7; calcium/phospholipid binding protein, protein transport; 1.44A {Mus musculus} Back     alignment and structure
>2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>2z0u_A WW domain-containing protein 1; C2 domain, alternative splicing, coiled coil, cytoplasm, phosphorylation, polymorphism, lipid binding protein; 2.20A {Homo sapiens} Back     alignment and structure
>2cm5_A Rabphilin-3A; protein transport, zinc-finger, Ca2+ binding, metal-binding, synaptic exocytosis, C2A-C2B linker fragment, C2B, zinc, synapse; 1.28A {Rattus norvegicus} SCOP: b.7.1.2 PDB: 2cm6_A 3rpb_A Back     alignment and structure
>1cjy_A CPLA2, protein (cytosolic phospholipase A2); lipid-binding, hydrolase; HET: MES; 2.50A {Homo sapiens} SCOP: b.7.1.1 c.19.1.2 PDB: 1bci_A Back     alignment and structure
>2r83_A Synaptotagmin-1; C2A-C2B, exocytosis, calcium, cell junction, cytoplasmic vesicle, glycoprotein, lipoprotein, membrane, metal-binding palmitate; 2.70A {Homo sapiens} SCOP: b.7.1.2 Back     alignment and structure
>3jzy_A Intersectin 2; C2 domain, structural genomics consortium (SGC), endocytosis; 1.56A {Homo sapiens} PDB: 3qbv_B* 1ki1_B Back     alignment and structure
>3bxj_A RAS GTPase-activating protein syngap; GTPase activation, membrane, phosphoprotein, SH3-binding, signaling protein; 3.00A {Rattus norvegicus} Back     alignment and structure
>3nsj_A Perforin-1; pore forming protein, immune system; HET: NAG; 2.75A {Mus musculus} Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Back     alignment and structure
>3ohm_B 1-phosphatidylinositol-4,5-bisphosphate phosphodi beta-3; PH domain, EF hand, TIM barrel, C2 domain, GTPase, lipase, C binding, GTP binding; HET: GDP; 2.70A {Homo sapiens} Back     alignment and structure
>1dqv_A Synaptotagmin III; beta sandwich, calcium ION, C2 domain, endocytosis/exocytosis complex; 3.20A {Rattus rattus} SCOP: b.7.1.2 b.7.1.2 PDB: 3hn8_A Back     alignment and structure
>3qr0_A Phospholipase C-beta (PLC-beta); PH domain, EF hand, C2 domain, TIM barrel domain, hydrolase, calcium binding, phospholipid binding; 2.00A {Sepia officinalis} PDB: 3qr1_A Back     alignment and structure
>2zkm_X 1-phosphatidylinositol-4,5-bisphosphate phosphodiesterase beta-2; phospholipase C, phosphoinositide phospholipase, PLC-beta-2, calcium, coiled coil; 1.62A {Homo sapiens} SCOP: a.39.1.7 b.7.1.1 b.55.1.1 c.1.18.1 PDB: 2fju_B Back     alignment and structure
>3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A Back     alignment and structure
>3l9b_A Otoferlin; C2-domain, beta-sheets, cell membrane, synaptic V hearing, membrane, synapse, transmembrane, membrane protein; 1.95A {Rattus norvegicus} Back     alignment and structure
>2enj_A NPKC-theta, protein kinase C theta type; beta-sandwich, phosphotyrosine binding, TCR, T-cell, diacylglycerol, phorbol ester, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1yrk_A NPKC-delta, protein kinase C, delta type; C2 domain, protein binding; HET: PTR; 1.70A {Homo sapiens} PDB: 1bdy_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query85
d2cjta1128 Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 99.67
d1rlwa_126 Domain from cytosolic phospholipase A2 {Human (Hom 99.03
d2ep6a1126 Multiple C2 and transmembrane domain-containing pr 98.96
d1gmia_136 Domain from protein kinase C epsilon {Rat (Rattus 98.93
d1wfja_136 C2 domain protein At1g63220 {Thale cress (Arabidop 98.92
d1a25a_132 C2 domain from protein kinase c (beta) {Rat (Rattu 98.85
d1rh8a_142 Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} 98.82
d1qasa2131 PI-specific phospholipase C isozyme D1 (PLC-D1), C 98.82
d1dqva1130 Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 98.7
d1rsya_143 Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 98.66
d2nq3a1133 E3 ubiquitin-protein ligase Itchy {Human (Homo sap 98.64
d1wfma_138 Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9 98.61
d2bwqa1125 Regulating synaptic membrane exocytosis protein, r 98.59
d1ugka_138 Synaptotagmin IV {Human (Homo sapiens) [TaxId: 960 98.48
d1bdya_123 Domain from protein kinase C delta {Rat (Rattus no 98.43
d1w15a_138 Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 98.42
d1uowa_157 Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10 98.4
d2zkmx2122 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 98.38
d2cm5a1137 C2b-domain of rabphilin {Rat (Rattus norvegicus) [ 98.23
d1dqva2145 Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 97.96
>d2cjta1 b.7.1.1 (A:1-128) Unc-13 homolog A {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: All beta proteins
fold: C2 domain-like
superfamily: C2 domain (Calcium/lipid-binding domain, CaLB)
family: PLC-like (P variant)
domain: Unc-13 homolog A
species: Rat (Rattus norvegicus) [TaxId: 10116]
Probab=99.67  E-value=4.4e-17  Score=107.91  Aligned_cols=69  Identities=33%  Similarity=0.624  Sum_probs=65.0

Q ss_pred             ceeeeeecCceeeeeccccceeeEeeeccCCCCceEEEEeeCCeeeeceeeEEEeecCCeeeecCcCCCceeEeec
Q psy8569           2 RKESNVIGSNFRWSVFSVKTRFEVPSETNDVNQGLLIEVWDKGIIWDRAIGYHYLPLPQVAFSNEVGSRKTAGVKG   77 (85)
Q Consensus         2 ~~~~~v~g~~P~W~~~~~~~~~~f~fet~d~~~gL~vEVWnKgviwDdLLG~~~lPL~~v~~s~e~g~g~W~~l~~   77 (85)
                      .+|..++|+||.|++       +|.|.+.+.+..|.|+|||++.+.|++||.+.|||++|..+++.++++|+.|..
T Consensus        33 ~~T~~~k~~nP~Wne-------~f~f~v~~~~~~L~v~V~d~~~~~d~~lG~~~I~L~~l~~~~~~~~~~W~~L~~  101 (128)
T d2cjta1          33 STTIAVRGSQPSWEQ-------DFMFEINRLDLGLTVEVWNKGLIWDTMVGTVWIPLRTIRQSNEEGPGEWLTLDS  101 (128)
T ss_dssp             EECCCEESSSCEEEE-------EEEEEECCCSSEEEEEEEECCSSCEEEEEEEEEEGGGSCBCSSCCCCEEEECBC
T ss_pred             EEEEEecCCCCeEEE-------EEEEeeccccceEEEEEEeCCCcCCcceEEEEEEehhhccCCCCCCCeeEECCc
Confidence            467888999999999       999999999889999999999999999999999999999999999999999953



>d1rlwa_ b.7.1.1 (A:) Domain from cytosolic phospholipase A2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ep6a1 b.7.1.1 (A:92-217) Multiple C2 and transmembrane domain-containing protein 2, MCTP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gmia_ b.7.1.1 (A:) Domain from protein kinase C epsilon {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1wfja_ b.7.1.2 (A:) C2 domain protein At1g63220 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1a25a_ b.7.1.2 (A:) C2 domain from protein kinase c (beta) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rh8a_ b.7.1.2 (A:) Piccolo {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1qasa2 b.7.1.1 (A:626-756) PI-specific phospholipase C isozyme D1 (PLC-D1), C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dqva1 b.7.1.2 (A:295-424) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1rsya_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2nq3a1 b.7.1.1 (A:13-145) E3 ubiquitin-protein ligase Itchy {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfma_ b.7.1.2 (A:) Synaptotagmin XIII {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bwqa1 b.7.1.2 (A:729-853) Regulating synaptic membrane exocytosis protein, rim2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ugka_ b.7.1.2 (A:) Synaptotagmin IV {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bdya_ b.7.1.1 (A:) Domain from protein kinase C delta {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1w15a_ b.7.1.2 (A:) Synaptotagmin IV {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1uowa_ b.7.1.2 (A:) Synaptogamin I {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2zkmx2 b.7.1.1 (X:678-799) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cm5a1 b.7.1.2 (A:541-677) C2b-domain of rabphilin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dqva2 b.7.1.2 (A:425-569) Synaptotagmin III {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure