Psyllid ID: psy8596

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------
MQAHHCSSEGALSSLEEAIGDKEKQMNQLREQRDRADQERQEERDLHERDIAEYKLKLHAYESEVEELELGKSKAELDKAANEVGRSGADWEAARQRLSRLELENERLKHELERSQTTFGRTTLSTSAELDRLQEKYDKTCADLRRAQAELRVVQADNERVRSEEKTMQEKVEKSQGEVYRLKAKLENTQGEMESMKEEYERTQGTLSRLLSERDKAVLEMDKSKEELERSQATLGE
ccccHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
cccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
mqahhcssegaLSSLEEAIGDKEKQMNQLREQRDRADQERQEERDLHERDIAEYKLKLHAYESEVEELELGKSKAELDKAANEVGRSGADWEAARQRLSRLELENERLKHELERsqttfgrttlsTSAELDRLQEKYDKTCADLRRAQAELRVVQADNERVRSEEKTMQEKVEKSQGEVYRLKAKLENTQGEMESMKEEYERTQGTLSRLLSERDKAVLEMDKSKEELERSQATLGE
mqahhcssegalsSLEEAIGDKEKQMNQlreqrdradqerqeerdlherdIAEYKLKLHAYESEVEELELGKSKAELDKAAnevgrsgadweAARQRLSRLELENERLKhelersqttfgrttlstsaeldrlQEKYDKTCADLRRAQAelrvvqadnervrseektmqekveksqgevyrLKAKLentqgemesmKEEYERTQGTLSRLLSERDKAVlemdkskeelersqatlge
MQAHHCssegalssleeaIGDKEKQMNQLreqrdradqerqeerdLHERDIAEYKLKLHAYESEVEELELGKSKAELDKAANEVGRSGADWEAArqrlsrlelenerlKHELERSQTTFGRTTLSTSAELDRLQEKYDKTCADLRRAQAELRVVQADNERVRSEEKTMQEKVEKSQGEVYRLKAKLENTQGEMESMKEEYERTQGTLSRLLSERDKAVLEMDKSKEELERSQATLGE
*******************************************************L*L***********************************************************************************************************************************************************************************
*********************************************************************************************************************************************************************************************************************************************
***********LSSLEEAIGDK***********************LHERDIAEYKLKLHAYESEVEELELGKSKAELDKAANEVGRSGADWEAARQRLSRLELENERLKHELERSQTTFGRTTLSTSAELDRLQEKYDKTCADLRRAQAELRVVQAD******************QGEVYRLKAKLENT*****************LSRLLSERDKAVLE*****************
*********G*LSSLEEAIGDKEKQMNQLREQRDRADQERQEERDLHERDIAEYKLKLHAYESEVEELELGKSKAELDKAANEVGRSGADWEAARQRLSRLELENERLKHELERSQTTFGRTTLSTSAELDRLQEKYDKTCADLRRAQAELRVVQADNERVRSEEKTMQEKVEKSQGEVYRLKAKLENTQGEMESMKEEYERTQGTLSRLLSERDKAVLEMDKSKEELERSQ*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MQAHHCSSEGAxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxKAANEVGRSGADxxxxxxxxxxxxxxxxxxxxxxxxxxxxFGRTTLSTSAExxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxLGE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query237
242015610 1490 trichohyalin, putative [Pediculus humanu 0.991 0.157 0.717 9e-96
357602530 2057 hypothetical protein KGM_11786 [Danaus p 0.995 0.114 0.710 6e-95
332017518 1613 ERC protein 2 [Acromyrmex echinatior] 0.991 0.145 0.698 2e-93
365733625 1908 bruchpilot [Apis mellifera] 0.995 0.123 0.698 5e-93
307208455 1550 ELKS/RAB6-interacting/CAST family member 0.991 0.151 0.694 6e-93
345479003 1869 PREDICTED: hypothetical protein LOC10012 0.991 0.125 0.687 8e-91
307172617 2103 ELKS/RAB6-interacting/CAST family member 0.991 0.111 0.687 5e-86
170065374 1391 bruchpilot [Culex quinquefasciatus] gi|1 0.995 0.169 0.687 3e-82
189239658 1703 PREDICTED: similar to bruchpilot CG34146 0.995 0.138 0.654 1e-81
328719506 1783 PREDICTED: hypothetical protein LOC10016 0.995 0.132 0.613 6e-79
>gi|242015610|ref|XP_002428446.1| trichohyalin, putative [Pediculus humanus corporis] gi|212513058|gb|EEB15708.1| trichohyalin, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  355 bits (911), Expect = 9e-96,   Method: Compositional matrix adjust.
 Identities = 185/258 (71%), Positives = 216/258 (83%), Gaps = 23/258 (8%)

Query: 1   MQAHHCSSEGALSSLEEAIGDKEKQMNQLREQRDRADQERQEERDLHERDIAEYKLKLHA 60
           MQA HCSSEGAL+SLEEAIGDKEKQMNQLREQRDRA+QE+QEER+LHER+IAEYK+KLHA
Sbjct: 144 MQASHCSSEGALTSLEEAIGDKEKQMNQLREQRDRAEQEKQEERELHEREIAEYKMKLHA 203

Query: 61  YESEVEEL-----------------------ELGKSKAELDKAANEVGRSGADWEAARQR 97
            E+EVE+L                       ELGKSKAELDKA +EVG+SGADWEAA+Q+
Sbjct: 204 LENEVEKLGARLERAQAEKDRLEAKLESSQSELGKSKAELDKATSEVGKSGADWEAAKQK 263

Query: 98  LSRLELENERLKHELERSQTTFGRTTLSTSAELDRLQEKYDKTCADLRRAQAELRVVQAD 157
           L+RLELENERLKH+LERSQTTFGR+TLSTS ELDR+QEK +K  A+LRRAQAELRVVQAD
Sbjct: 264 LARLELENERLKHDLERSQTTFGRSTLSTSQELDRVQEKAEKMAAELRRAQAELRVVQAD 323

Query: 158 NERVRSEEKTMQEKVEKSQGEVYRLKAKLENTQGEMESMKEEYERTQGTLSRLLSERDKA 217
           NER  SE  T+QEK+EKSQGEVYRLKA+LEN Q E ES++EEY+R+QGT++RL SERDKA
Sbjct: 324 NERAYSETATLQEKLEKSQGEVYRLKARLENAQAERESLREEYDRSQGTITRLHSERDKA 383

Query: 218 VLEMDKSKEELERSQATL 235
             +++K KEELER+Q TL
Sbjct: 384 CADLEKLKEELERTQGTL 401

Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|357602530|gb|EHJ63437.1| hypothetical protein KGM_11786 [Danaus plexippus] Back     alignment and taxonomy information
>gi|332017518|gb|EGI58229.1| ERC protein 2 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|365733625|ref|NP_001242968.1| bruchpilot [Apis mellifera] Back     alignment and taxonomy information
>gi|307208455|gb|EFN85822.1| ELKS/RAB6-interacting/CAST family member 1 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|345479003|ref|XP_001606987.2| PREDICTED: hypothetical protein LOC100123358 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|307172617|gb|EFN63976.1| ELKS/RAB6-interacting/CAST family member 1 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|170065374|ref|XP_001867912.1| bruchpilot [Culex quinquefasciatus] gi|167882490|gb|EDS45873.1| bruchpilot [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|189239658|ref|XP_973199.2| PREDICTED: similar to bruchpilot CG34146-PB [Tribolium castaneum] Back     alignment and taxonomy information
>gi|328719506|ref|XP_003246780.1| PREDICTED: hypothetical protein LOC100162634 isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query237
FB|FBgn0259246 1786 brp "bruchpilot" [Drosophila m 0.793 0.105 0.532 3e-45
UNIPROTKB|J9PA32 506 MYH13 "Myosin-13" [Canis lupus 0.514 0.241 0.311 5.6e-06
UNIPROTKB|F1NPC4 405 LOC429272 "Uncharacterized pro 0.801 0.469 0.204 1.8e-05
ZFIN|ZDB-GENE-041111-270 1398 eea1 "early endosome antigen 1 0.767 0.130 0.242 2.1e-05
RGD|1311992 838 Cgn "cingulin" [Rattus norvegi 0.447 0.126 0.3 2.8e-05
UNIPROTKB|F1PQU7 1938 MYH13 "Myosin-13" [Canis lupus 0.514 0.062 0.311 3e-05
MGI|MGI:1922152 1324 Ccdc171 "coiled-coil domain co 0.759 0.135 0.231 3.6e-05
UNIPROTKB|I3LSQ0 678 CALCOCO1 "Uncharacterized prot 0.763 0.266 0.230 3.9e-05
UNIPROTKB|D4A4X4 1193 Cgn "Protein Cgn" [Rattus norv 0.447 0.088 0.3 4.3e-05
UNIPROTKB|Q2HJ46487 RNF8 "E3 ubiquitin-protein lig 0.468 0.227 0.316 4.4e-05
FB|FBgn0259246 brp "bruchpilot" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 490 (177.5 bits), Expect = 3.0e-45, P = 3.0e-45
 Identities = 108/203 (53%), Positives = 138/203 (67%)

Query:    48 ERDIAEYKLKLHAYESEVEELELGKSKAELDKAANEVGRSGADWEAAXXXXXXXXXXXXX 107
             ER + E + +L   + E  + ELGKSKAEL+KA  E+GRS ADWE+              
Sbjct:   539 ERAVTERE-RLEI-KLEASQSELGKSKAELEKATCEMGRSSADWESTKQRIARLELENER 596

Query:   108 XKHELERSQ-------------TTFGRTTLSTSAELDRLQEKYDKTCADLRRAQAELRVV 154
              KH+LERSQ             TTFGRTT++TS ELDR QE+ DK  A+LRR QAELRV 
Sbjct:   597 LKHDLERSQNVQKLMFETGKISTTFGRTTMTTSQELDRAQERADKASAELRRTQAELRVT 656

Query:   155 QADNERVRSEEKTMQEKVEKSQGEVYRLKAKLENTQGEMESMKEEYERTQGTLSRLLSER 214
             Q+D ER R E   +QEK+EKSQGEVYRLKAKLEN QGE ES+++E E+ Q  +SR+ ++R
Sbjct:   657 QSDAERAREEAAALQEKLEKSQGEVYRLKAKLENAQGEQESLRQELEKAQSGVSRIHADR 716

Query:   215 DKAVLEMDKSKEELERSQATLGE 237
             D+A  E++K KEE+ER+QATLG+
Sbjct:   717 DRAFSEVEKIKEEMERTQATLGK 739
GO:0005262 "calcium channel activity" evidence=IMP
GO:0007269 "neurotransmitter secretion" evidence=IMP
GO:0048790 "maintenance of presynaptic active zone structure" evidence=IMP
GO:0048167 "regulation of synaptic plasticity" evidence=IMP
GO:0008344 "adult locomotory behavior" evidence=IMP
GO:0048786 "presynaptic active zone" evidence=IDA
GO:0031594 "neuromuscular junction" evidence=IDA
GO:0042734 "presynaptic membrane" evidence=IDA
GO:0007268 "synaptic transmission" evidence=IDA;IMP
GO:0007274 "neuromuscular synaptic transmission" evidence=IMP
GO:0048789 "cytoskeletal matrix organization at active zone" evidence=IMP
GO:0048788 "presynaptic cytoskeletal matrix assembled at active zones" evidence=IDA
GO:0007615 "anesthesia-resistant memory" evidence=IDA
GO:0007614 "short-term memory" evidence=IDA
UNIPROTKB|J9PA32 MYH13 "Myosin-13" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1NPC4 LOC429272 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-041111-270 eea1 "early endosome antigen 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
RGD|1311992 Cgn "cingulin" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1PQU7 MYH13 "Myosin-13" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1922152 Ccdc171 "coiled-coil domain containing 171" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|I3LSQ0 CALCOCO1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|D4A4X4 Cgn "Protein Cgn" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q2HJ46 RNF8 "E3 ubiquitin-protein ligase RNF8" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query237
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 3e-10
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 2e-08
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 9e-07
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 3e-06
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 5e-06
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 9e-06
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 1e-05
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 2e-05
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 2e-05
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 4e-05
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 4e-05
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 1e-04
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 1e-04
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 2e-04
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 3e-04
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 3e-04
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 4e-04
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 5e-04
pfam10174 774 pfam10174, Cast, RIM-binding protein of the cytoma 6e-04
COG4477 570 COG4477, EzrA, Negative regulator of septation rin 8e-04
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 9e-04
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 0.002
PLN02939 977 PLN02939, PLN02939, transferase, transferring glyc 0.002
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 0.003
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information 
 Score = 59.3 bits (144), Expect = 3e-10
 Identities = 56/231 (24%), Positives = 105/231 (45%), Gaps = 19/231 (8%)

Query: 7   SSEGALSSLEEAIGDKEKQMNQLREQRDRADQER---QEERDLHERDIAEYKLKLHAYES 63
             E  ++SLE +I +KE+++    E+  + + E      E +  ER+I E + +      
Sbjct: 298 ELEAEIASLERSIAEKERELEDAEERLAKLEAEIDKLLAEIEELEREIEEERKRRDKLTE 357

Query: 64  EVEELELGKSKAELDKAANEVGRSGADWEAARQRLSRLELENERLKHELERSQTTFGRTT 123
           E  EL     K EL+    E+     ++   R  L     + E+LK E+   +       
Sbjct: 358 EYAEL-----KEELEDLRAELEEVDKEFAETRDELKDYREKLEKLKREINELKR------ 406

Query: 124 LSTSAELDRLQEKYDKTCADLRRAQAELRVVQADNERVRSEEKTMQEKVEKSQGEVYRLK 183
                ELDRLQE+  +   +L    A +  ++A    +  E++    +++K + ++ +L 
Sbjct: 407 -----ELDRLQEELQRLSEELADLNAAIAGIEAKINELEEEKEDKALEIKKQEWKLEQLA 461

Query: 184 AKLENTQGEMESMKEEYERTQGTLSRLLSERDKAVLEMDKSKEELERSQAT 234
           A L   + E+  +KEEY+R +  LS+L  E  +A  +   S+E +   +A 
Sbjct: 462 ADLSKYEQELYDLKEEYDRVEKELSKLQRELAEAEAQARASEERVRGGRAV 512

SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. It is found in a single copy and is homodimeric in prokaryotes, but six paralogs (excluded from this family) are found in eukarotes, where SMC proteins are heterodimeric. This family represents the SMC protein of archaea and a few bacteria (Aquifex, Synechocystis, etc); the SMC of other bacteria is described by TIGR02168. The N- and C-terminal domains of this protein are well conserved, but the central hinge region is skewed in composition and highly divergent [Cellular processes, Cell division, DNA metabolism, Chromosome-associated proteins]. Length = 1164
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|220614 pfam10174, Cast, RIM-binding protein of the cytomatrix active zone Back     alignment and domain information
>gnl|CDD|226883 COG4477, EzrA, Negative regulator of septation ring formation [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|215507 PLN02939, PLN02939, transferase, transferring glycosyl groups Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 237
TIGR02168 1179 SMC_prok_B chromosome segregation protein SMC, com 99.54
COG1196 1163 Smc Chromosome segregation ATPases [Cell division 99.39
TIGR02169 1164 SMC_prok_A chromosome segregation protein SMC, pri 99.37
PF10174775 Cast: RIM-binding protein of the cytomatrix active 99.28
TIGR02169 1164 SMC_prok_A chromosome segregation protein SMC, pri 99.25
PF10174 775 Cast: RIM-binding protein of the cytomatrix active 99.24
TIGR02168 1179 SMC_prok_B chromosome segregation protein SMC, com 99.01
PRK04863 1486 mukB cell division protein MukB; Provisional 98.76
PF05701 522 WEMBL: Weak chloroplast movement under blue light; 98.25
PRK03918 880 chromosome segregation protein; Provisional 98.23
KOG4809|consensus654 98.2
COG1196 1163 Smc Chromosome segregation ATPases [Cell division 98.19
PRK02224 880 chromosome segregation protein; Provisional 98.14
PF05701522 WEMBL: Weak chloroplast movement under blue light; 98.12
PRK02224 880 chromosome segregation protein; Provisional 98.09
KOG0250|consensus 1074 98.07
KOG0996|consensus 1293 98.03
KOG0161|consensus 1930 97.92
KOG0996|consensus 1293 97.9
PF12128 1201 DUF3584: Protein of unknown function (DUF3584); In 97.83
PHA02562 562 46 endonuclease subunit; Provisional 97.8
PRK03918 880 chromosome segregation protein; Provisional 97.72
KOG0250|consensus 1074 97.71
KOG0161|consensus 1930 97.67
TIGR00606 1311 rad50 rad50. This family is based on the phylogeno 97.65
TIGR00606 1311 rad50 rad50. This family is based on the phylogeno 97.56
PF07888 546 CALCOCO1: Calcium binding and coiled-coil domain ( 97.5
PRK11637 428 AmiB activator; Provisional 97.45
KOG0964|consensus 1200 97.43
PF07888 546 CALCOCO1: Calcium binding and coiled-coil domain ( 97.41
PF00261237 Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop 97.4
PHA02562 562 46 endonuclease subunit; Provisional 97.3
PRK04778 569 septation ring formation regulator EzrA; Provision 97.23
PF00261237 Tropomyosin: Tropomyosin; InterPro: IPR000533 Trop 97.22
PRK04863 1486 mukB cell division protein MukB; Provisional 97.1
PRK11637 428 AmiB activator; Provisional 97.07
PF12128 1201 DUF3584: Protein of unknown function (DUF3584); In 96.97
PRK04778569 septation ring formation regulator EzrA; Provision 96.96
TIGR01843 423 type_I_hlyD type I secretion membrane fusion prote 96.95
KOG0933|consensus 1174 96.83
PF06160560 EzrA: Septation ring formation regulator, EzrA ; I 96.62
PRK01156 895 chromosome segregation protein; Provisional 96.51
KOG0971|consensus 1243 96.46
PRK09039 343 hypothetical protein; Validated 96.37
PF10473140 CENP-F_leu_zip: Leucine-rich repeats of kinetochor 96.32
PRK09039 343 hypothetical protein; Validated 96.28
PF14915305 CCDC144C: CCDC144C protein coiled-coil region 96.23
KOG1029|consensus 1118 96.22
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 96.18
KOG0995|consensus 581 95.97
PF10481307 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 95.87
COG1579239 Zn-ribbon protein, possibly nucleic acid-binding [ 95.87
PF12718143 Tropomyosin_1: Tropomyosin like; InterPro: IPR0005 95.81
TIGR01843 423 type_I_hlyD type I secretion membrane fusion prote 95.78
PF00769 246 ERM: Ezrin/radixin/moesin family; InterPro: IPR011 95.75
PF00769246 ERM: Ezrin/radixin/moesin family; InterPro: IPR011 95.61
PF05667594 DUF812: Protein of unknown function (DUF812); Inte 95.57
PF15619194 Lebercilin: Ciliary protein causing Leber congenit 95.35
KOG4674|consensus 1822 95.24
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 95.22
PF04156191 IncA: IncA protein; InterPro: IPR007285 Chlamydia 95.04
TIGR02680 1353 conserved hypothetical protein TIGR02680. Members 95.04
PF01576 859 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu 94.97
PF14915305 CCDC144C: CCDC144C protein coiled-coil region 94.91
KOG4674|consensus 1822 94.87
smart00787312 Spc7 Spc7 kinetochore protein. This domain is foun 94.82
PF09730 717 BicD: Microtubule-associated protein Bicaudal-D; I 94.81
KOG0018|consensus 1141 94.75
PF01576859 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Mu 94.53
KOG0994|consensus1758 94.34
KOG0933|consensus 1174 94.34
PF04849306 HAP1_N: HAP1 N-terminal conserved region; InterPro 94.25
PF04156191 IncA: IncA protein; InterPro: IPR007285 Chlamydia 94.15
PF00038312 Filament: Intermediate filament protein; InterPro: 94.12
PF10481 307 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR0 94.08
TIGR03007 498 pepcterm_ChnLen polysaccharide chain length determ 94.02
PRK10884206 SH3 domain-containing protein; Provisional 93.93
PF15070 617 GOLGA2L5: Putative golgin subfamily A member 2-lik 93.83
COG4942 420 Membrane-bound metallopeptidase [Cell division and 93.75
PF04111 314 APG6: Autophagy protein Apg6; InterPro: IPR007243 93.67
PF06818202 Fez1: Fez1; InterPro: IPR009638 This family repres 93.67
KOG0963|consensus 629 93.55
PF07926132 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: 93.23
KOG0977|consensus 546 92.93
KOG0978|consensus698 92.9
KOG1962|consensus216 92.39
PF15070 617 GOLGA2L5: Putative golgin subfamily A member 2-lik 92.31
KOG0243|consensus 1041 92.1
PF15619194 Lebercilin: Ciliary protein causing Leber congenit 91.8
PF12325120 TMF_TATA_bd: TATA element modulatory factor 1 TATA 91.73
PF08317325 Spc7: Spc7 kinetochore protein; InterPro: IPR01325 91.61
KOG0963|consensus 629 91.36
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 91.33
TIGR01000 457 bacteriocin_acc bacteriocin secretion accessory pr 91.24
PF12325120 TMF_TATA_bd: TATA element modulatory factor 1 TATA 91.15
PF04111 314 APG6: Autophagy protein Apg6; InterPro: IPR007243 90.93
PF06818202 Fez1: Fez1; InterPro: IPR009638 This family repres 90.83
PF10498359 IFT57: Intra-flagellar transport protein 57 ; Inte 90.75
PF13870177 DUF4201: Domain of unknown function (DUF4201) 90.7
COG4026290 Uncharacterized protein containing TOPRIM domain, 90.62
KOG0978|consensus698 90.55
PF10473140 CENP-F_leu_zip: Leucine-rich repeats of kinetochor 90.32
PF13514 1111 AAA_27: AAA domain 90.31
PRK10884206 SH3 domain-containing protein; Provisional 90.17
COG4372 499 Uncharacterized protein conserved in bacteria with 90.14
PF08614194 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR 90.08
PF09789319 DUF2353: Uncharacterized coiled-coil protein (DUF2 90.03
COG3883265 Uncharacterized protein conserved in bacteria [Fun 89.61
TIGR02680 1353 conserved hypothetical protein TIGR02680. Members 89.48
KOG0243|consensus 1041 89.33
KOG4673|consensus 961 89.26
PF04849306 HAP1_N: HAP1 N-terminal conserved region; InterPro 89.08
PF07926132 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: 89.03
PF05622 713 HOOK: HOOK protein; InterPro: IPR008636 This famil 89.02
KOG0979|consensus 1072 88.92
KOG4643|consensus 1195 88.85
COG4026290 Uncharacterized protein containing TOPRIM domain, 88.61
KOG0971|consensus 1243 88.52
PF06160560 EzrA: Septation ring formation regulator, EzrA ; I 88.44
PF13514 1111 AAA_27: AAA domain 88.33
PF09730 717 BicD: Microtubule-associated protein Bicaudal-D; I 87.82
PF15294278 Leu_zip: Leucine zipper 87.41
PF09728309 Taxilin: Myosin-like coiled-coil protein; InterPro 87.28
TIGR00998 334 8a0101 efflux pump membrane protein (multidrug res 87.2
KOG0964|consensus 1200 87.19
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 87.08
KOG0979|consensus 1072 86.59
PF15066527 CAGE1: Cancer-associated gene protein 1 family 86.45
PF10498359 IFT57: Intra-flagellar transport protein 57 ; Inte 86.41
KOG1853|consensus 333 86.18
COG0419 908 SbcC ATPase involved in DNA repair [DNA replicatio 86.14
PF05335188 DUF745: Protein of unknown function (DUF745); Inte 85.98
PF09726697 Macoilin: Transmembrane protein; InterPro: IPR0191 85.84
PF15294278 Leu_zip: Leucine zipper 85.76
KOG0977|consensus 546 85.73
KOG0995|consensus 581 85.69
PF14662193 CCDC155: Coiled-coil region of CCDC155 85.48
KOG1962|consensus216 85.34
PF06008264 Laminin_I: Laminin Domain I; InterPro: IPR009254 L 85.32
PF13870177 DUF4201: Domain of unknown function (DUF4201) 84.24
KOG0999|consensus 772 84.12
PF05622 713 HOOK: HOOK protein; InterPro: IPR008636 This famil 83.29
PRK11281 1113 hypothetical protein; Provisional 83.02
PF10146230 zf-C4H2: Zinc finger-containing protein ; InterPro 83.0
PF09755310 DUF2046: Uncharacterized conserved protein H4 (DUF 82.88
PF12777344 MT: Microtubule-binding stalk of dynein motor; Int 82.77
KOG0982|consensus 502 82.45
PF10168717 Nup88: Nuclear pore component; InterPro: IPR019321 82.13
KOG0980|consensus 980 82.02
TIGR03007498 pepcterm_ChnLen polysaccharide chain length determ 81.64
PF11559151 ADIP: Afadin- and alpha -actinin-Binding; InterPro 81.56
PF14662193 CCDC155: Coiled-coil region of CCDC155 81.28
KOG3647|consensus338 81.07
PF11932251 DUF3450: Protein of unknown function (DUF3450); In 80.84
COG4477 570 EzrA Negative regulator of septation ring formatio 80.52
>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type Back     alignment and domain information 
Probab=99.54  E-value=2.2e-11  Score=125.42  Aligned_cols=119  Identities=24%  Similarity=0.290  Sum_probs=96.0

Q ss_pred             cChHhHHhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhHhhHHHHHHHHhhhhHHHHHH--HhhhhHHHHHHHHHH
Q psy8596           6 CSSEGALSSLEEAIGDKEKQMNQLREQRDRADQERQEERDLHERDIAEYKLKLHAYESEVEEL--ELGKSKAELDKAANE   83 (237)
Q Consensus         6 ~~Te~nL~RveDil~Evekql~~L~~Qa~kaery~elk~e~~~lei~~~~~~~~~l~~el~~l--e~~~lq~elek~q~E   83 (237)
                      ..|..||.||.|++.|++.++..|+.|+++|++|+.+..+|+.++..++...+..+...+..+  .+..+...+..+..+
T Consensus       175 ~~t~~nL~r~~d~l~el~~ql~~L~~q~~~a~~~~~~~~~~~~l~~~l~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~  254 (1179)
T TIGR02168       175 KETERKLERTRENLDRLEDILNELERQLKSLERQAEKAERYKELKAELRELELALLVLRLEELREELEELQEELKEAEEE  254 (1179)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            357899999999999999999999999999999999999999999999999998888888887  666666677777777


Q ss_pred             HhhhhhhHHHHHHHHHHHHHHHHHHHHHHHHHHHHhhhhhh
Q psy8596          84 VGRSGADWEAARQRLSRLELENERLKHELERSQTTFGRTTL  124 (237)
Q Consensus        84 ~~rleaele~~K~ei~qlEkEle~~qeel~e~q~~i~~~e~  124 (237)
                      +..+...+..++..+..+...+...+..+..+...+.....
T Consensus       255 ~~~~~~~~~~~~~~l~~l~~~~~~~~~~~~~l~~~i~~~~~  295 (1179)
T TIGR02168       255 LEELTAELQELEEKLEELRLEVSELEEEIEELQKELYALAN  295 (1179)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            77777766666666666666666666666666655555544

SMC (structural maintenance of chromosomes) proteins bind DNA and act in organizing and segregating chromosomes for partition. SMC proteins are found in bacteria, archaea, and eukaryotes. This family represents the SMC protein of most bacteria. The smc gene is often associated with scpB (TIGR00281) and scpA genes, where scp stands for segregation and condensation protein. SMC was shown (in Caulobacter crescentus) to be induced early in S phase but present and bound to DNA throughout the cell cycle.
>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] Back     alignment and domain information
>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>PF10174 Cast: RIM-binding protein of the cytomatrix active zone; InterPro: IPR019323 This entry represents a family of proteins that form part of the CAZ (cytomatrix at the active zone) complex which is involved in determining the site of synaptic vesicle fusion [] Back     alignment and domain information
>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>PRK04863 mukB cell division protein MukB; Provisional Back     alignment and domain information
>PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function Back     alignment and domain information
>PRK03918 chromosome segregation protein; Provisional Back     alignment and domain information
>KOG4809|consensus Back     alignment and domain information
>COG1196 Smc Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>PF05701 WEMBL: Weak chloroplast movement under blue light; InterPro: IPR008545 This family consists of several plant proteins of unknown function Back     alignment and domain information
>PRK02224 chromosome segregation protein; Provisional Back     alignment and domain information
>KOG0250|consensus Back     alignment and domain information
>KOG0996|consensus Back     alignment and domain information
>KOG0161|consensus Back     alignment and domain information
>KOG0996|consensus Back     alignment and domain information
>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>PRK03918 chromosome segregation protein; Provisional Back     alignment and domain information
>KOG0250|consensus Back     alignment and domain information
>KOG0161|consensus Back     alignment and domain information
>TIGR00606 rad50 rad50 Back     alignment and domain information
>TIGR00606 rad50 rad50 Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>KOG0964|consensus Back     alignment and domain information
>PF07888 CALCOCO1: Calcium binding and coiled-coil domain (CALCOCO1) like; InterPro: IPR012852 Proteins found in this family are similar to the coiled-coil transcriptional coactivator protein expressed by Mus musculus (CoCoA, Q8CGU1 from SWISSPROT) Back     alignment and domain information
>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>PHA02562 46 endonuclease subunit; Provisional Back     alignment and domain information
>PRK04778 septation ring formation regulator EzrA; Provisional Back     alignment and domain information
>PF00261 Tropomyosin: Tropomyosin; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>PRK04863 mukB cell division protein MukB; Provisional Back     alignment and domain information
>PRK11637 AmiB activator; Provisional Back     alignment and domain information
>PF12128 DUF3584: Protein of unknown function (DUF3584); InterPro: IPR021979 This family consist of uncharacterised bacterial proteins Back     alignment and domain information
>PRK04778 septation ring formation regulator EzrA; Provisional Back     alignment and domain information
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family Back     alignment and domain information
>KOG0933|consensus Back     alignment and domain information
>PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site Back     alignment and domain information
>PRK01156 chromosome segregation protein; Provisional Back     alignment and domain information
>KOG0971|consensus Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] Back     alignment and domain information
>PRK09039 hypothetical protein; Validated Back     alignment and domain information
>PF14915 CCDC144C: CCDC144C protein coiled-coil region Back     alignment and domain information
>KOG1029|consensus Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>KOG0995|consensus Back     alignment and domain information
>PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] Back     alignment and domain information
>COG1579 Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>PF12718 Tropomyosin_1: Tropomyosin like; InterPro: IPR000533 Tropomyosins [], are a family of closely related proteins present in muscle and non-muscle cells Back     alignment and domain information
>TIGR01843 type_I_hlyD type I secretion membrane fusion protein, HlyD family Back     alignment and domain information
>PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] Back     alignment and domain information
>PF00769 ERM: Ezrin/radixin/moesin family; InterPro: IPR011259 The ERM family consists of three closely-related proteins, ezrin, radixin and moesin [] Back     alignment and domain information
>PF05667 DUF812: Protein of unknown function (DUF812); InterPro: IPR008530 This family consists of several eukaryotic proteins of unknown function Back     alignment and domain information
>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease Back     alignment and domain information
>KOG4674|consensus Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion Back     alignment and domain information
>TIGR02680 conserved hypothetical protein TIGR02680 Back     alignment and domain information
>PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril Back     alignment and domain information
>PF14915 CCDC144C: CCDC144C protein coiled-coil region Back     alignment and domain information
>KOG4674|consensus Back     alignment and domain information
>smart00787 Spc7 Spc7 kinetochore protein Back     alignment and domain information
>PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] Back     alignment and domain information
>KOG0018|consensus Back     alignment and domain information
>PF01576 Myosin_tail_1: Myosin tail; InterPro: IPR002928 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril Back     alignment and domain information
>KOG0994|consensus Back     alignment and domain information
>KOG0933|consensus Back     alignment and domain information
>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues Back     alignment and domain information
>PF04156 IncA: IncA protein; InterPro: IPR007285 Chlamydia trachomatis is an obligate intracellular bacterium that develops within a parasitophorous vacuole termed an inclusion Back     alignment and domain information
>PF00038 Filament: Intermediate filament protein; InterPro: IPR016044 Intermediate filaments (IF) [, , ] are proteins which are primordial components of the cytoskeleton and the nuclear envelope Back     alignment and domain information
>PF10481 CENP-F_N: Cenp-F N-terminal domain; InterPro: IPR018463 Mitosin or centromere-associated protein-F (Cenp-F) is found bound across the centromere as one of the proteins of the outer layer of the kinetochore [] Back     alignment and domain information
>TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 Back     alignment and domain information
>COG4942 Membrane-bound metallopeptidase [Cell division and chromosome partitioning] Back     alignment and domain information
>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein Back     alignment and domain information
>KOG0963|consensus Back     alignment and domain information
>PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) Back     alignment and domain information
>KOG0977|consensus Back     alignment and domain information
>KOG0978|consensus Back     alignment and domain information
>KOG1962|consensus Back     alignment and domain information
>PF15070 GOLGA2L5: Putative golgin subfamily A member 2-like protein 5 Back     alignment and domain information
>KOG0243|consensus Back     alignment and domain information
>PF15619 Lebercilin: Ciliary protein causing Leber congenital amaurosis disease Back     alignment and domain information
>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] Back     alignment and domain information
>PF08317 Spc7: Spc7 kinetochore protein; InterPro: IPR013253 This entry consists of cell division proteins which are required for kinetochore-spindle association [] Back     alignment and domain information
>KOG0963|consensus Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>TIGR01000 bacteriocin_acc bacteriocin secretion accessory protein Back     alignment and domain information
>PF12325 TMF_TATA_bd: TATA element modulatory factor 1 TATA binding; InterPro: IPR022091 This is the C-terminal conserved coiled coil region of a family of TATA element modulatory factor 1 proteins conserved in eukaryotes [] Back     alignment and domain information
>PF04111 APG6: Autophagy protein Apg6; InterPro: IPR007243 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PF06818 Fez1: Fez1; InterPro: IPR009638 This family represents the eukaryotic Fez1 protein Back     alignment and domain information
>PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms Back     alignment and domain information
>PF13870 DUF4201: Domain of unknown function (DUF4201) Back     alignment and domain information
>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] Back     alignment and domain information
>KOG0978|consensus Back     alignment and domain information
>PF10473 CENP-F_leu_zip: Leucine-rich repeats of kinetochore protein Cenp-F/LEK1; InterPro: IPR019513 Cenp-F, a centromeric kinetochore, microtubule-binding protein consisting of two 1,600-amino acid-long coils, is essential for the full functioning of the mitotic checkpoint pathway [, ] Back     alignment and domain information
>PF13514 AAA_27: AAA domain Back     alignment and domain information
>PRK10884 SH3 domain-containing protein; Provisional Back     alignment and domain information
>COG4372 Uncharacterized protein conserved in bacteria with the myosin-like domain [Function unknown] Back     alignment and domain information
>PF08614 ATG16: Autophagy protein 16 (ATG16); InterPro: IPR013923 Macroautophagy is a bulk degradation process induced by starvation in eukaryotic cells Back     alignment and domain information
>PF09789 DUF2353: Uncharacterized coiled-coil protein (DUF2353); InterPro: IPR019179 Members of this family have been annotated as being coiled-coil domain-containing protein 149, however they currently have no known function Back     alignment and domain information
>COG3883 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR02680 conserved hypothetical protein TIGR02680 Back     alignment and domain information
>KOG0243|consensus Back     alignment and domain information
>KOG4673|consensus Back     alignment and domain information
>PF04849 HAP1_N: HAP1 N-terminal conserved region; InterPro: IPR006933 This family is defined by an N-terminal conserved region found in several huntingtin-associated protein 1 (HAP1) homologues Back     alignment and domain information
>PF07926 TPR_MLP1_2: TPR/MLP1/MLP2-like protein; InterPro: IPR012929 This domain is found in a number of proteins, including TPR protein (P12270 from SWISSPROT) and yeast myosin-like proteins 1 (MLP1, Q02455 from SWISSPROT) and 2 (MLP2, P40457 from SWISSPROT) Back     alignment and domain information
>PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms Back     alignment and domain information
>KOG0979|consensus Back     alignment and domain information
>KOG4643|consensus Back     alignment and domain information
>COG4026 Uncharacterized protein containing TOPRIM domain, potential nuclease [General function prediction only] Back     alignment and domain information
>KOG0971|consensus Back     alignment and domain information
>PF06160 EzrA: Septation ring formation regulator, EzrA ; InterPro: IPR010379 During the bacterial cell cycle, the tubulin-like cell-division protein FtsZ polymerises into a ring structure that establishes the location of the nascent division site Back     alignment and domain information
>PF13514 AAA_27: AAA domain Back     alignment and domain information
>PF09730 BicD: Microtubule-associated protein Bicaudal-D; InterPro: IPR018477 BicD proteins consist of three coiled-coiled domains and are involved in dynein-mediated minus end-directed transport from the Golgi apparatus to the endoplasmic reticulum (ER) [] Back     alignment and domain information
>PF15294 Leu_zip: Leucine zipper Back     alignment and domain information
>PF09728 Taxilin: Myosin-like coiled-coil protein; InterPro: IPR019132 Taxilin contains an extraordinarily long coiled-coil domain in its C-terminal half and is ubiquitously expressed Back     alignment and domain information
>TIGR00998 8a0101 efflux pump membrane protein (multidrug resistance protein A) Back     alignment and domain information
>KOG0964|consensus Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>KOG0979|consensus Back     alignment and domain information
>PF15066 CAGE1: Cancer-associated gene protein 1 family Back     alignment and domain information
>PF10498 IFT57: Intra-flagellar transport protein 57 ; InterPro: IPR019530 Eukaryotic cilia and flagella are specialised organelles found at the periphery of cells of diverse organisms Back     alignment and domain information
>KOG1853|consensus Back     alignment and domain information
>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>PF05335 DUF745: Protein of unknown function (DUF745); InterPro: IPR007999 This family consists of several uncharacterised Drosophila melanogaster proteins of unknown function Back     alignment and domain information
>PF09726 Macoilin: Transmembrane protein; InterPro: IPR019130 This entry represents the multi-pass transmembrane protein Macoilin, which is highly conserved in eukaryotes Back     alignment and domain information
>PF15294 Leu_zip: Leucine zipper Back     alignment and domain information
>KOG0977|consensus Back     alignment and domain information
>KOG0995|consensus Back     alignment and domain information
>PF14662 CCDC155: Coiled-coil region of CCDC155 Back     alignment and domain information
>KOG1962|consensus Back     alignment and domain information
>PF06008 Laminin_I: Laminin Domain I; InterPro: IPR009254 Laminins are glycoproteins that are major constituents of the basement membrane of cells Back     alignment and domain information
>PF13870 DUF4201: Domain of unknown function (DUF4201) Back     alignment and domain information
>KOG0999|consensus Back     alignment and domain information
>PF05622 HOOK: HOOK protein; InterPro: IPR008636 This family consists of several HOOK1, 2 and 3 proteins from different eukaryotic organisms Back     alignment and domain information
>PRK11281 hypothetical protein; Provisional Back     alignment and domain information
>PF10146 zf-C4H2: Zinc finger-containing protein ; InterPro: IPR018482 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF09755 DUF2046: Uncharacterized conserved protein H4 (DUF2046); InterPro: IPR019152 This is the conserved N-terminal 350 residues of a family of proteins of unknown function possibly containing a coiled-coil domain Back     alignment and domain information
>PF12777 MT: Microtubule-binding stalk of dynein motor; InterPro: IPR024743 The 380 kDa motor unit of dynein belongs to the AAA class of chaperone-like ATPases Back     alignment and domain information
>KOG0982|consensus Back     alignment and domain information
>PF10168 Nup88: Nuclear pore component; InterPro: IPR019321 Nup88 can be divided into two structural domains; the N-terminal two-thirds of the protein have no obvious structural motifs Back     alignment and domain information
>KOG0980|consensus Back     alignment and domain information
>TIGR03007 pepcterm_ChnLen polysaccharide chain length determinant protein, PEP-CTERM locus subfamily Back     alignment and domain information
>PF11559 ADIP: Afadin- and alpha -actinin-Binding; InterPro: IPR021622 This family is found in mammals where it is localised at cell-cell adherens junctions [], and in Sch Back     alignment and domain information
>PF14662 CCDC155: Coiled-coil region of CCDC155 Back     alignment and domain information
>KOG3647|consensus Back     alignment and domain information
>PF11932 DUF3450: Protein of unknown function (DUF3450); InterPro: IPR016866 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>COG4477 EzrA Negative regulator of septation ring formation [Cell division and chromosome partitioning] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query237
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 5e-15
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 5e-12
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 4e-11
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 5e-09
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 3e-06
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 1e-10
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 4e-10
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 4e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-05
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
 Score = 72.9 bits (179), Expect = 5e-15
 Identities = 38/228 (16%), Positives = 94/228 (41%), Gaps = 1/228 (0%)

Query: 9    EGALSSLEEAIGDKEKQMNQLREQRDRADQERQE-ERDLHERDIAEYKLKLHAYESEVEE 67
            E     L+      ++QM  L EQ +  +  RQ+ + +    D    K++      E + 
Sbjct: 940  EERSQQLQAEKKKMQQQMLDLEEQLEEEEAARQKLQLEKVTADGKIKKMEDDILIMEDQN 999

Query: 68   LELGKSKAELDKAANEVGRSGADWEAARQRLSRLELENERLKHELERSQTTFGRTTLSTS 127
             +L K +  L++  +++  + A+ E   + L++L+ ++E +  ELE       ++     
Sbjct: 1000 NKLTKERKLLEERVSDLTTNLAEEEEKAKNLTKLKNKHESMISELEVRLKKEEKSRQELE 1059

Query: 128  AELDRLQEKYDKTCADLRRAQAELRVVQADNERVRSEEKTMQEKVEKSQGEVYRLKAKLE 187
                +L+ +       +   QA++  ++A   +   E +    ++E    +      K+ 
Sbjct: 1060 KIKRKLEGESSDLHEQIAELQAQIAELKAQLAKKEEELQAALARLEDETSQKNNALKKIR 1119

Query: 188  NTQGEMESMKEEYERTQGTLSRLLSERDKAVLEMDKSKEELERSQATL 235
              +  +  ++E+ E  +   ++   ++     E++  K ELE +  T 
Sbjct: 1120 ELESHISDLQEDLESEKAARNKAEKQKRDLSEELEALKTELEDTLDTT 1167
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query237
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 98.57
1c1g_A284 Tropomyosin; contractIle protein; 7.00A {Sus scrof 98.5
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 98.41
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 97.74
3na7_A256 HP0958; flagellar biogenesis, flagellum export, C4 97.67
3na7_A256 HP0958; flagellar biogenesis, flagellum export, C4 97.61
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 97.27
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 96.88
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 96.48
2v71_A189 Nuclear distribution protein NUDE-like 1; developm 96.19
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 94.95
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 94.78
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 93.84
2efr_A155 General control protein GCN4 and tropomyosin 1 Al; 93.72
1x79_B112 RAB GTPase binding effector protein 1; rabaptin5, 92.59
1ic2_A81 Tropomyosin alpha chain, skeletal muscle; alpha-he 92.58
2efr_A155 General control protein GCN4 and tropomyosin 1 Al; 91.85
3q8t_A96 Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90 91.26
2fxo_A129 Myosin heavy chain, cardiac muscle beta isoform; c 91.06
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 90.42
3ghg_A 562 Fibrinogen alpha chain; triple-stranded coiled coi 89.79
3ol1_A119 Vimentin; structural genomics, PSI-2, protein stru 89.2
3s4r_A93 Vimentin; alpha-helix, cytoskeleton, intermediate 86.66
3swk_A86 Vimentin; cytoskeleton, intermediate filament, alp 86.42
3tnu_B129 Keratin, type II cytoskeletal 5; coiled-coil, stru 85.8
3tnu_B129 Keratin, type II cytoskeletal 5; coiled-coil, stru 85.67
3u1c_A101 Tropomyosin alpha-1 chain; anti-parallel coiled co 85.66
2i1j_A 575 Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, 85.25
4dk0_A 369 Putative MACA; alpha-hairpin, lipoyl, beta-barrel, 84.53
3q8t_A96 Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90 84.48
2v4h_A110 NF-kappa-B essential modulator; transcription, met 84.46
3hnw_A138 Uncharacterized protein; coiled-coil, structural g 84.24
3tnu_A131 Keratin, type I cytoskeletal 14; coiled-coil, stru 84.13
3u1c_A101 Tropomyosin alpha-1 chain; anti-parallel coiled co 83.68
3swk_A86 Vimentin; cytoskeleton, intermediate filament, alp 83.59
2fxo_A129 Myosin heavy chain, cardiac muscle beta isoform; c 83.51
3tnu_A131 Keratin, type I cytoskeletal 14; coiled-coil, stru 82.7
3u59_A101 Tropomyosin beta chain; muscle contraction, actin, 82.14
3o0z_A168 RHO-associated protein kinase 1; coiled-coil, tran 81.88
3ol1_A119 Vimentin; structural genomics, PSI-2, protein stru 80.97
1x79_B112 RAB GTPase binding effector protein 1; rabaptin5, 80.19
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Back     alignment and structure
Probab=98.57  E-value=0.00021  Score=59.51  Aligned_cols=34  Identities=18%  Similarity=0.227  Sum_probs=12.7

Q ss_pred             HHHHHHhHHHHHHHHHHHhHhHHHHHHHHHHHHH
Q psy8596         197 KEEYERTQGTLSRLLSERDKAVLEMDKSKEELER  230 (237)
Q Consensus       197 ~~~~~~~q~~~~~~~~e~d~~~~e~~~~~e~le~  230 (237)
                      ...+......+..+...+..+...+..+..+++.
T Consensus       243 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  276 (284)
T 1c1g_A          243 ERSVTKLEKSIDDLEDELYAQKLKYKAISEELDH  276 (284)
T ss_dssp             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            3333333333333333333333333334434333
>1c1g_A Tropomyosin; contractIle protein; 7.00A {Sus scrofa} SCOP: h.1.5.1 PDB: 2tma_A 2w49_A 2w4u_A Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure
>3na7_A HP0958; flagellar biogenesis, flagellum export, C4 Zn-ribbon, coiled post-transcriptional, gene regulation, chaperone; HET: EPE; 2.20A {Helicobacter pylori} Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>2v71_A Nuclear distribution protein NUDE-like 1; developmental protein, nuclear protein, neurogenesis, cytosk LIS1 binding, differentiation; 2.24A {Rattus norvegicus} Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A Back     alignment and structure
>1x79_B RAB GTPase binding effector protein 1; rabaptin5, GGA protein, GAT domain, intracellular trafficking, protein transport; 2.41A {Homo sapiens} SCOP: h.1.27.2 Back     alignment and structure
>1ic2_A Tropomyosin alpha chain, skeletal muscle; alpha-helical coiled coil, alanine, symmetry, axial stagger, BEND, contractIle protein; 2.00A {Gallus gallus} SCOP: h.1.5.1 Back     alignment and structure
>2efr_A General control protein GCN4 and tropomyosin 1 Al; destabilizing cluster, hydrophobic core, contractIle protein; 1.80A {Saccharomyces cerevisiae} PDB: 2efs_A 2d3e_A Back     alignment and structure
>3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus} Back     alignment and structure
>2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>3ghg_A Fibrinogen alpha chain; triple-stranded coiled coil, beta sheets, alpha helices, AMY amyloidosis, blood coagulation, disease mutation, glycoprot phosphoprotein; HET: NAG NDG BMA MAN GAL SIA; 2.90A {Homo sapiens} PDB: 3h32_A* 2a45_G* Back     alignment and structure
>3s4r_A Vimentin; alpha-helix, cytoskeleton, intermediate filament, structural; 2.45A {Homo sapiens} PDB: 3ssu_A Back     alignment and structure
>3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} Back     alignment and structure
>3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Back     alignment and structure
>3tnu_B Keratin, type II cytoskeletal 5; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Back     alignment and structure
>3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A Back     alignment and structure
>2i1j_A Moesin; FERM, coiled-coil, C-ermad, ERM, radixin, ezrin, MER actin binding, masking, regulation, SELF-inhibition, cell A membrane protein; 2.10A {Spodoptera frugiperda} PDB: 2i1k_A 1e5w_A Back     alignment and structure
>4dk0_A Putative MACA; alpha-hairpin, lipoyl, beta-barrel, periplasmic protein, MEM protein; 3.50A {Aggregatibacter actinomycetemcomitans} PDB: 4dk1_A Back     alignment and structure
>3q8t_A Beclin-1; autophagy, ATG14L uvrag, apoptosis; 1.90A {Rattus norvegicus} Back     alignment and structure
>2v4h_A NF-kappa-B essential modulator; transcription, metal-binding, NEMO - IKK gamma - NFKB pathwa darpin, transcription regulation; 2.9A {Mus musculus} Back     alignment and structure
>3hnw_A Uncharacterized protein; coiled-coil, structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.20A {Eubacterium eligens} Back     alignment and structure
>3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Back     alignment and structure
>3u1c_A Tropomyosin alpha-1 chain; anti-parallel coiled coil, contractIle protein; 1.80A {Gallus gallus} PDB: 3u1a_A Back     alignment and structure
>3swk_A Vimentin; cytoskeleton, intermediate filament, alpha-helix, structural; 1.70A {Homo sapiens} Back     alignment and structure
>2fxo_A Myosin heavy chain, cardiac muscle beta isoform; coiled coil (dimeric, parallel), familial hypertrophic cardiomyopathy, FHC-associated mutant E924K; 2.50A {Homo sapiens} SCOP: h.1.26.1 PDB: 2fxm_A Back     alignment and structure
>3tnu_A Keratin, type I cytoskeletal 14; coiled-coil, structural support, cytosolic protein; 3.00A {Homo sapiens} Back     alignment and structure
>3u59_A Tropomyosin beta chain; muscle contraction, actin, contractIle protein; 2.50A {Gallus gallus} Back     alignment and structure
>3o0z_A RHO-associated protein kinase 1; coiled-coil, transferase; HET: MSE; 2.33A {Homo sapiens} Back     alignment and structure
>1x79_B RAB GTPase binding effector protein 1; rabaptin5, GGA protein, GAT domain, intracellular trafficking, protein transport; 2.41A {Homo sapiens} SCOP: h.1.27.2 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 237
d1jmma_ 377 b.30.6.1 (A:) V-region of surface antigen I/II (SA 0.003
>d1jmma_ b.30.6.1 (A:) V-region of surface antigen I/II (SA I/II, PAC) {Streptococcus mutans [TaxId: 1309]} Length = 377 Back     information, alignment and structure

class: All beta proteins
fold: Supersandwich
superfamily: V-region of surface antigen I/II (SA I/II, PAC)
family: V-region of surface antigen I/II (SA I/II, PAC)
domain: V-region of surface antigen I/II (SA I/II, PAC)
species: Streptococcus mutans [TaxId: 1309]

 Score = 35.8 bits (82), Expect = 0.003
 Identities = 16/38 (42%), Positives = 25/38 (65%), Gaps = 2/38 (5%)

Query: 48 ERDIAEYKLKLHAYESEVEELELGKSKAELDKAANEVG 85
          ++D+A+Y +KL AYE E   ++   + AEL+K  NE G
Sbjct: 1  QKDLADYPVKLKAYEDEQASIK--AALAELEKHKNEDG 36

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

No hit with probability above 80.00