Psyllid ID: psy859

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------

MVPSSLQPSESPACILIQRQSWGIGDPPLVFLDEPTSGVDPISRHRLWAVLSQIQKTGQSIVLTSHSMDECEALCNRLTIMRGNELRKRRNCLSFRKEKMRLILTFPLCFPSSMDECEALCNRLTIMVRGEMQCLGNITYLKQRYGQGFTLMIKLREGDLDQLKERIRTEFKGRVEIKDEHKGLIHYQILDTTFSWSVLFAKMEAVKTSMDIVEDYSLSDTTLEQVFIAFAKGRGQRHPDNTTITEL

ccccccccccccccccccEEEEEcccccEEEEccccccccHHHHHHHHHHHHHHHHcccEEEEEcccHHHHHHHHcccEEEEccEEEEEcccHHHHHcccEEEEEEEEcccccHHHHHHHHHHHHHHccccEEEcccccHHcccccccEEEEEEEccccHHHHHHHHHHHccccEEEEEEEccEEEEEEccccccHHHHHHHHHHHHHHcccccEEEEccccHHHHHHHHccccccccccccccccc

cccccHHHHHHHHHHHHHHHHHHHccccEEEEccccccccHHHHHHHHHHHHHHHHcccEEEEEcccHHHHHHHHcHEEEEEccEEEEcccHHHHHHHccccEEEEEEEcccccHHHHccccccEEEEcccccccccHHHHHcccccccEEEEEEccccHHHHHHHHHHHcccccEEEEccccEEEEEccccccHHHHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHcccccccccccccc

mvpsslqpsespaciliqrqswgigdpplvfldeptsgvdpisrHRLWAVLSQIQKTGQSIVLTSHSMDECEALCNRLTIMRGNELRKRRNCLSFRKEKMRLILtfplcfpssmdECEALCNRLTIMVRGEMQCLGNITYLKQRYGQGFTLMIKLREGDLDQLKERIRTEFKGRVEIKDEHKGLIHYQILDTTFSWSVLFAKMEAVKTSMDIvedyslsdtTLEQVFIAFAkgrgqrhpdnttitel

mvpsslqpsespACILIQRQSWGIGDPPLVFLDEPTSGVDPISRHRLWAVLSQIQKTGQSIVLTSHSMDECEALCNRltimrgnelrkrRNCLSFRKEKMRLILTFPLCFPSSMDECEALCNRLTIMVRGEMQCLGNITYLKQRYGQGFTLMIKLREGDLDQLKERIRTefkgrveikdehkglihyqiLDTTFSWSVLFAKMEAVKTSMDIVEDYSLSDTTLEQVFIAFakgrgqrhpdnttitel

************ACILIQRQSWGIGDPPLVFLDEPTSGVDPISRHRLWAVLSQIQKTGQSIVLTSHSMDECEALCNRLTIMRGNELRKRRNCLSFRKEKMRLILTFPLCFPSSMDECEALCNRLTIMVRGEMQCLGNITYLKQRYGQGFTLMIKLREGDLDQLKERIRTEFKGRVEIKDEHKGLIHYQILDTTFSWSVLFAKMEAVKTSMDIVEDYSLSDTTLEQVFIAFAK***************

****************IQRQSWGIGDPPLVFLDEPTSGVDPISRHRLWAVLSQIQKTGQSIVLTSHSMDECEALCNRLTIMRGNELRKRRNCLSFRKEKMRLILTFPLCFP*******************************QRYGQGFTLMIKLREGDLDQLKERIRTEFKGRVEIKDEHKGLIHYQILDTTFSWSVLFAKMEAVKTSMDIVEDYSLSDTTLEQVFIAF*****************

**********SPACILIQRQSWGIGDPPLVFLDEPTSGVDPISRHRLWAVLSQIQKTGQSIVLTSHSMDECEALCNRLTIMRGNELRKRRNCLSFRKEKMRLILTFPLCFPSSMDECEALCNRLTIMVRGEMQCLGNITYLKQRYGQGFTLMIKLREGDLDQLKERIRTEFKGRVEIKDEHKGLIHYQILDTTFSWSVLFAKMEAVKTSMDIVEDYSLSDTTLEQVFIAFAKGRGQRHPDNTTITEL

****SLQPSESPACILIQRQSWGIGDPPLVFLDEPTSGVDPISRHRLWAVLSQIQKTGQSIVLTSHSMDECEALCNRLTIMRGNELRKRRNCLSFRKEKMRLILTFPLCFPSSMDECEALCNRLTIMVRGEMQCLGNITYLKQRYGQGFTLMIKLREGDLDQLKERIRTEFKGRVEIKDEHKGLIHYQILDTTFSWSVLFAKMEAVKTSMDIVEDYSLSDTTLEQVFIAFAKGR*************

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		247	2.2.26 [Sep-21-2011]
Q99758		1704	ATP-binding cassette sub-	yes	N/A	0.647	0.093	0.339	2e-31
Q8R420		1704	ATP-binding cassette sub-	yes	N/A	0.647	0.093	0.344	3e-31
Q9BZC7		2435	ATP-binding cassette sub-	no	N/A	0.647	0.065	0.364	9e-29
P41234		2434	ATP-binding cassette sub-	no	N/A	0.647	0.065	0.364	1e-28
Q9ESR9		2434	ATP-binding cassette sub-	no	N/A	0.647	0.065	0.360	4e-28
P41233		2261	ATP-binding cassette sub-	no	N/A	0.647	0.070	0.353	1e-27
P78363		2273	Retinal-specific ATP-bind	no	N/A	0.668	0.072	0.321	2e-27
O95477		2261	ATP-binding cassette sub-	no	N/A	0.647	0.070	0.349	3e-27
O35600		2310	Retinal-specific ATP-bind	no	N/A	0.639	0.068	0.317	7e-26
Q86UK0		2595	ATP-binding cassette sub-	no	N/A	0.696	0.066	0.306	7e-26

>sp\|Q99758\|ABCA3_HUMAN ATP-binding cassette sub-family A member 3 OS=Homo sapiens GN=ABCA3 PE=1 SV=2	Back alignment and function desciption

 Score =  136 bits (342), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 72/212 (33%), Positives = 119/212 (56%), Gaps = 52/212 (24%)

Query: 24   IGDPPLVFLDEPTSGVDPISRHRLWAVLSQIQKTGQSIVLTSHSMDECEALCNRLTIMRG 83
            IG+P ++FLDEP++G+DP++R  LW  +++ +++G++I++TSHS                
Sbjct: 1530 IGEPAVIFLDEPSTGMDPVARRLLWDTVARARESGKAIIITSHS---------------- 1573

Query: 84   NELRKRRNCLSFRKEKMRLILTFPLCFPSSMDECEALCNRLTIMVRGEMQCLGNITYLKQ 143
                                          M+ECEALC RL IMV+G+ +CLG+  +LK 
Sbjct: 1574 ------------------------------MEECEALCTRLAIMVQGQFKCLGSPQHLKS 1603

Query: 144  RYGQGFTLMIKLR-EGD---LDQLKERIRTEFKGRVEIKDEHKGLIHYQILDTTFSWSVL 199
            ++G G++L  K++ EG    L++ K  +   F G V ++DEH+G++HY +     SW+ +
Sbjct: 1604 KFGSGYSLRAKVQSEGQQEALEEFKAFVDLTFPGSV-LEDEHQGMVHYHLPGRDLSWAKV 1662

Query: 200  FAKMEAVKTSMDIVEDYSLSDTTLEQVFIAFA 231
            F  +E  K     V+DYS+S  +LEQVF++FA
Sbjct: 1663 FGILEKAKEKYG-VDDYSVSQISLEQVFLSFA 1693

Plays an important role in the formation of pulmonary surfactant, probably by transporting lipids such as cholesterol.
Homo sapiens (taxid: 9606)

>sp\|Q8R420\|ABCA3_MOUSE ATP-binding cassette sub-family A member 3 OS=Mus musculus GN=Abca3 PE=2 SV=3	Back alignment and function description

>sp\|Q9BZC7\|ABCA2_HUMAN ATP-binding cassette sub-family A member 2 OS=Homo sapiens GN=ABCA2 PE=1 SV=3	Back alignment and function description

>sp\|P41234\|ABCA2_MOUSE ATP-binding cassette sub-family A member 2 OS=Mus musculus GN=Abca2 PE=1 SV=4	Back alignment and function description

>sp\|Q9ESR9\|ABCA2_RAT ATP-binding cassette sub-family A member 2 OS=Rattus norvegicus GN=Abca2 PE=1 SV=1	Back alignment and function description

>sp\|P41233\|ABCA1_MOUSE ATP-binding cassette sub-family A member 1 OS=Mus musculus GN=Abca1 PE=1 SV=4	Back alignment and function description

>sp\|P78363\|ABCA4_HUMAN Retinal-specific ATP-binding cassette transporter OS=Homo sapiens GN=ABCA4 PE=1 SV=3	Back alignment and function description

>sp\|O95477\|ABCA1_HUMAN ATP-binding cassette sub-family A member 1 OS=Homo sapiens GN=ABCA1 PE=1 SV=3	Back alignment and function description

>sp\|O35600\|ABCA4_MOUSE Retinal-specific ATP-binding cassette transporter OS=Mus musculus GN=Abca4 PE=2 SV=1	Back alignment and function description

>sp\|Q86UK0\|ABCAC_HUMAN ATP-binding cassette sub-family A member 12 OS=Homo sapiens GN=ABCA12 PE=1 SV=3	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		247
328705811		1747	PREDICTED: ATP-binding cassette sub-fami	0.672	0.095	0.479	6e-50
328722868		670	PREDICTED: ATP-binding cassette sub-fami	0.659	0.243	0.476	1e-48
390335777		361	PREDICTED: ATP-binding cassette sub-fami	0.651	0.445	0.413	5e-38
291240099		1731	PREDICTED: rCG33625-like [Saccoglossus k	0.676	0.096	0.409	5e-37
321459231		1818	hypothetical protein DAPPUDRAFT_347506 [	0.659	0.089	0.382	1e-36
443712485		1745	hypothetical protein CAPTEDRAFT_103477 [	0.651	0.092	0.378	1e-35
291232644		1719	PREDICTED: ATP-binding cassette transpor	0.672	0.096	0.389	1e-35
432869357		1778	PREDICTED: LOW QUALITY PROTEIN: ATP-bind	0.651	0.090	0.362	4e-35
449672576		1594	PREDICTED: ATP-binding cassette sub-fami	0.672	0.104	0.394	4e-35
391342738		1726	PREDICTED: ATP-binding cassette sub-fami	0.708	0.101	0.385	9e-35

>gi\|328705811\|ref\|XP_001947916.2\| PREDICTED: ATP-binding cassette sub-family A member 3-like [Acyrthosiphon pisum]	Back alignment and taxonomy information

 Score =  203 bits (516), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 103/215 (47%), Positives = 131/215 (60%), Gaps = 49/215 (22%)

Query: 24   IGDPPLVFLDEPTSGVDPISRHRLWAVLSQIQKTGQSIVLTSHSMDECEALCNRLTIMRG 83
            IGDPP+VFLDEPTSGVDP++R  LW +L+  Q+ GQ++VLTSHS                
Sbjct: 1573 IGDPPVVFLDEPTSGVDPVARRNLWQLLAASQRGGQAVVLTSHS---------------- 1616

Query: 84   NELRKRRNCLSFRKEKMRLILTFPLCFPSSMDECEALCNRLTIMVRGEMQCLGNITYLKQ 143
                                          MDECEALCNRLTIMV G M+C+GNI YLK 
Sbjct: 1617 ------------------------------MDECEALCNRLTIMVDGVMKCIGNIQYLKN 1646

Query: 144  RYGQGFTLMIKLR---EGDLDQLKERIRTEFKGRVEIKDEHKGLIHYQILDTTFSWSVLF 200
            RYGQGFT+MIKLR     ++ +LK  I  +F   + +KDEHKGL+HY I +     S +F
Sbjct: 1647 RYGQGFTIMIKLRYIENSNVTELKSDIERQFSPDISLKDEHKGLLHYHITNPNIPLSEIF 1706

Query: 201  AKMEAVKTSMDIVEDYSLSDTTLEQVFIAFAKGRG 235
             +M+A+K +  I+EDY++SDTTLEQVFIAFAK + 
Sbjct: 1707 GQMKAIKDNYTIIEDYTVSDTTLEQVFIAFAKKQA 1741

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi\|328722868\|ref\|XP_001949822.2\| PREDICTED: ATP-binding cassette sub-family A member 1-like [Acyrthosiphon pisum]	Back alignment and taxonomy information

>gi\|390335777\|ref\|XP_003724219.1\| PREDICTED: ATP-binding cassette sub-family A member 3-like [Strongylocentrotus purpuratus]	Back alignment and taxonomy information

>gi\|291240099\|ref\|XP_002739960.1\| PREDICTED: rCG33625-like [Saccoglossus kowalevskii]	Back alignment and taxonomy information

>gi\|321459231\|gb\|EFX70287.1\| hypothetical protein DAPPUDRAFT_347506 [Daphnia pulex]	Back alignment and taxonomy information

>gi\|443712485\|gb\|ELU05777.1\| hypothetical protein CAPTEDRAFT_103477 [Capitella teleta]	Back alignment and taxonomy information

>gi\|291232644\|ref\|XP_002736270.1\| PREDICTED: ATP-binding cassette transporter subfamily A-like [Saccoglossus kowalevskii]	Back alignment and taxonomy information

>gi\|432869357\|ref\|XP_004071707.1\| PREDICTED: LOW QUALITY PROTEIN: ATP-binding cassette sub-family A member 3-like [Oryzias latipes]	Back alignment and taxonomy information

>gi\|449672576\|ref\|XP_002168706.2\| PREDICTED: ATP-binding cassette sub-family A member 3-like [Hydra magnipapillata]	Back alignment and taxonomy information

>gi\|391342738\|ref\|XP_003745672.1\| PREDICTED: ATP-binding cassette sub-family A member 1-like [Metaseiulus occidentalis]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		247
UNIPROTKB\|F1MIB8		1703	LOC777692 "Uncharacterized pro	0.473	0.068	0.422	1.3e-39
UNIPROTKB\|E1BCR1		1704	ABCA3 "Uncharacterized protein	0.473	0.068	0.439	4.3e-39
UNIPROTKB\|F1RFA0		1702	ABCA3 "Uncharacterized protein	0.473	0.068	0.439	5.5e-39
UNIPROTKB\|F1Q1F1		1702	ABCA3 "Uncharacterized protein	0.473	0.068	0.430	5.5e-39
UNIPROTKB\|E2R3M5		1776	E2R3M5 "Uncharacterized protei	0.469	0.065	0.393	7.9e-39
UNIPROTKB\|H0Y3H2		1646	ABCA3 "ATP-binding cassette su	0.473	0.071	0.430	8.2e-39
UNIPROTKB\|Q99758		1704	ABCA3 "ATP-binding cassette su	0.473	0.068	0.430	8.9e-39
UNIPROTKB\|F1MAJ3		1447	Abca3 "Protein Abca3" [Rattus	0.473	0.080	0.430	1.2e-38
MGI\|MGI:1351617		1704	Abca3 "ATP-binding cassette, s	0.473	0.068	0.430	1.5e-38
UNIPROTKB\|E9PU20		1704	Abca3 "Protein Abca3" [Rattus	0.473	0.068	0.430	1.5e-38

UNIPROTKB\|F1MIB8 LOC777692 "Uncharacterized protein" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

 Score = 269 (99.8 bits), Expect = 1.3e-39, Sum P(2) = 1.3e-39
 Identities = 52/123 (42%), Positives = 84/123 (68%)

Query:   113 SMDECEALCNRLTIMVRGEMQCLGNITYLKQRYGQGFTLMIKLR-EGD---LDQLKERIR 168
             SM+ECEALC RL IMV+G+ +CLG+  +LK ++G G++L  K+R +G    L++ K  + 
Sbjct:  1572 SMEECEALCTRLAIMVQGQFKCLGSPQHLKSKFGSGYSLRAKIRSDGQQEALEEFKAFVG 1631

Query:   169 TEFKGRVEIKDEHKGLIHYQILDTTFSWSVLFAKMEAVKTSMDIVEDYSLSDTTLEQVFI 228
               F G V ++DEH+G++HY +     SW+ +F  ME  KT M ++EDYS++  +LE +F+
Sbjct:  1632 LTFPGSV-LEDEHQGMVHYHLPGDELSWAKVFGIMEQAKT-MYMLEDYSVNQISLEDIFL 1689

Query:   229 AFA 231
             +F+
Sbjct:  1690 SFS 1692

GO:0006638 "neutral lipid metabolic process" evidence=IEA

GO:0005783 "endoplasmic reticulum" evidence=IEA

GO:0005524 "ATP binding" evidence=IEA

GO:0016887 "ATPase activity" evidence=IEA

UNIPROTKB\|E1BCR1 ABCA3 "Uncharacterized protein" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|F1RFA0 ABCA3 "Uncharacterized protein" [Sus scrofa (taxid:9823)]	Back alignment and assigned GO terms

UNIPROTKB\|F1Q1F1 ABCA3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|E2R3M5 E2R3M5 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)]	Back alignment and assigned GO terms

UNIPROTKB\|H0Y3H2 ABCA3 "ATP-binding cassette sub-family A member 3" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|Q99758 ABCA3 "ATP-binding cassette sub-family A member 3" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

UNIPROTKB\|F1MAJ3 Abca3 "Protein Abca3" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

MGI\|MGI:1351617 Abca3 "ATP-binding cassette, sub-family A (ABC1), member 3" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

UNIPROTKB\|E9PU20 Abca3 "Protein Abca3" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database

ID	Alignment Graph	Length	Definition	E-value
Query		247
TIGR01257		2272	TIGR01257, rim_protein, retinal-specific rim ABC t	5e-33
cd03263		220	cd03263, ABC_subfamily_A, ATP-binding cassette dom	7e-25
cd03230		173	cd03230, ABC_DR_subfamily_A, ATP-binding cassette	6e-21
COG1131		293	COG1131, CcmA, ABC-type multidrug transport system	1e-17
cd00267		157	cd00267, ABC_ATPase, ATP-binding cassette transpor	3e-15
TIGR01188		302	TIGR01188, drrA, daunorubicin resistance ABC trans	4e-15
cd03265		220	cd03265, ABC_DrrA, Daunorubicin/doxorubicin resist	1e-14
cd03225		211	cd03225, ABC_cobalt_CbiO_domain1, First domain of	5e-14
PRK13536		340	PRK13536, PRK13536, nodulation factor exporter sub	8e-14
PRK13537		306	PRK13537, PRK13537, nodulation ABC transporter Nod	2e-13
TIGR01288		303	TIGR01288, nodI, ATP-binding ABC transporter famil	3e-13
cd03229		178	cd03229, ABC_Class3, ATP-binding cassette domain o	1e-12
cd03269		210	cd03269, ABC_putative_ATPase, ATP-binding cassette	1e-11
cd03264		211	cd03264, ABC_drug_resistance_like, ABC-type multid	4e-11
TIGR01257		2272	TIGR01257, rim_protein, retinal-specific rim ABC t	6e-11
COG1125		309	COG1125, OpuBA, ABC-type proline/glycine betaine t	7e-11
cd03266		218	cd03266, ABC_NatA_sodium_exporter, ATP-binding cas	2e-10
cd03216		163	cd03216, ABC_Carb_Monos_I, First domain of the ATP	4e-10
cd03295		242	cd03295, ABC_OpuCA_Osmoprotection, ATP-binding cas	1e-09
cd03267		236	cd03267, ABC_NatA_like, ATP-binding cassette domai	1e-09
cd03268		208	cd03268, ABC_BcrA_bacitracin_resist, ATP-binding c	2e-09
COG4555		245	COG4555, NatA, ABC-type Na+ transport system, ATPa	3e-09
COG4152		300	COG4152, COG4152, ABC-type uncharacterized transpo	4e-09
COG1122		235	COG1122, CbiO, ABC-type cobalt transport system, A	4e-09
COG4586		325	COG4586, COG4586, ABC-type uncharacterized transpo	2e-08
COG1135		339	COG1135, AbcC, ABC-type metal ion transport system	2e-08
PRK13646		286	PRK13646, cbiO, cobalt transporter ATP-binding sub	2e-08
TIGR01186		363	TIGR01186, proV, glycine betaine/L-proline transpo	3e-08
COG1129		500	COG1129, MglA, ABC-type sugar transport system, AT	5e-08
COG1116		248	COG1116, TauB, ABC-type nitrate/sulfonate/bicarbon	5e-08
TIGR03522		301	TIGR03522, GldA_ABC_ATP, gliding motility-associat	9e-08
cd03213		194	cd03213, ABCG_EPDR, Eye pigment and drug resistanc	1e-07
cd03226		205	cd03226, ABC_cobalt_CbiO_domain2, Second domain of	1e-07
cd03293		220	cd03293, ABC_NrtD_SsuB_transporters, ATP-binding c	1e-07
COG1127		263	COG1127, Ttg2A, ABC-type transport system involved	1e-07
COG1121		254	COG1121, ZnuC, ABC-type Mn/Zn transport systems, A	2e-07
COG4175		386	COG4175, ProV, ABC-type proline/glycine betaine tr	2e-07
cd03235		213	cd03235, ABC_Metallic_Cations, ATP-binding cassett	2e-07
COG1129		500	COG1129, MglA, ABC-type sugar transport system, AT	3e-07
cd03259		213	cd03259, ABC_Carb_Solutes_like, ATP-binding casset	3e-07
TIGR03269		520	TIGR03269, met_CoM_red_A2, methyl coenzyme M reduc	3e-07
cd03258		233	cd03258, ABC_MetN_methionine_transporter, ATP-bind	3e-07
cd03219		236	cd03219, ABC_Mj1267_LivG_branched, ATP-binding cas	4e-07
TIGR03415		382	TIGR03415, ABC_choXWV_ATP, choline ABC transporter	4e-07
PRK13643		288	PRK13643, cbiO, cobalt transporter ATP-binding sub	4e-07
PRK13641		287	PRK13641, cbiO, cobalt transporter ATP-binding sub	5e-07
cd03246		173	cd03246, ABCC_Protease_Secretion, ATP-binding cass	9e-07
cd03297		214	cd03297, ABC_ModC_molybdenum_transporter, ATP-bind	1e-06
COG3845		501	COG3845, COG3845, ABC-type uncharacterized transpo	1e-06
PRK13649		280	PRK13649, cbiO, cobalt transporter ATP-binding sub	1e-06
cd03261		235	cd03261, ABC_Org_Solvent_Resistant, ATP-binding ca	1e-06
COG1120		258	COG1120, FepC, ABC-type cobalamin/Fe3+-siderophore	1e-06
COG1119		257	COG1119, ModF, ABC-type molybdenum transport syste	2e-06
cd03294		269	cd03294, ABC_Pro_Gly_Betaine, ATP-binding cassette	2e-06
COG4525		259	COG4525, TauB, ABC-type taurine transport system,	2e-06
PRK09700		510	PRK09700, PRK09700, D-allose transporter ATP-bindi	2e-06
PRK15439		510	PRK15439, PRK15439, autoinducer 2 ABC transporter	2e-06
COG1123		539	COG1123, COG1123, ATPase components of various ABC	3e-06
PRK13637		287	PRK13637, cbiO, cobalt transporter ATP-binding sub	4e-06
TIGR03740		223	TIGR03740, galliderm_ABC, gallidermin-class lantib	7e-06
PRK13634		290	PRK13634, cbiO, cobalt transporter ATP-binding sub	7e-06
TIGR00955		617	TIGR00955, 3a01204, The Eye Pigment Precursor Tran	8e-06
cd03228		171	cd03228, ABCC_MRP_Like, ATP-binding cassette domai	9e-06
COG1124		252	COG1124, DppF, ABC-type dipeptide/oligopeptide/nic	9e-06
PRK15439		510	PRK15439, PRK15439, autoinducer 2 ABC transporter	1e-05
cd03257		228	cd03257, ABC_NikE_OppD_transporters, ATP-binding c	1e-05
TIGR01166		190	TIGR01166, cbiO, cobalt transport protein ATP-bind	1e-05
PRK13639		275	PRK13639, cbiO, cobalt transporter ATP-binding sub	1e-05
PRK10982		491	PRK10982, PRK10982, galactose/methyl galaxtoside t	1e-05
cd03299		235	cd03299, ABC_ModC_like, ATP-binding cassette domai	1e-05
cd03245		220	cd03245, ABCC_bacteriocin_exporters, ATP-binding c	1e-05
cd03215		182	cd03215, ABC_Carb_Monos_II, Second domain of the A	2e-05
TIGR03375		694	TIGR03375, type_I_sec_LssB, type I secretion syste	2e-05
PRK10895		241	PRK10895, PRK10895, lipopolysaccharide ABC transpo	2e-05
COG0444		316	COG0444, DppD, ABC-type dipeptide/oligopeptide/nic	2e-05
cd03218		232	cd03218, ABC_YhbG, ATP-binding cassette component	2e-05
cd03224		222	cd03224, ABC_TM1139_LivF_branched, ATP-binding cas	3e-05
cd03234		226	cd03234, ABCG_White, White pigment protein homolog	3e-05
cd03255		218	cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding casse	3e-05
cd03214		180	cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-bind	3e-05
PRK09700		510	PRK09700, PRK09700, D-allose transporter ATP-bindi	4e-05
PRK14253		249	PRK14253, PRK14253, phosphate ABC transporter ATP-	4e-05
PRK13638		271	PRK13638, cbiO, cobalt transporter ATP-binding sub	4e-05
PRK11288		501	PRK11288, araG, L-arabinose transporter ATP-bindin	5e-05
TIGR02314		343	TIGR02314, ABC_MetN, D-methionine ABC transporter,	7e-05
cd03298		211	cd03298, ABC_ThiQ_thiamine_transporter, ATP-bindin	8e-05
TIGR03771		223	TIGR03771, anch_rpt_ABC, anchored repeat-type ABC	8e-05
COG1123		539	COG1123, COG1123, ATPase components of various ABC	1e-04
COG1126		240	COG1126, GlnQ, ABC-type polar amino acid transport	1e-04
COG1136		226	COG1136, SalX, ABC-type antimicrobial peptide tran	1e-04
COG1118		345	COG1118, CysA, ABC-type sulfate/molybdate transpor	1e-04
COG0411		250	COG0411, LivG, ABC-type branched-chain amino acid	1e-04
PRK10982		491	PRK10982, PRK10982, galactose/methyl galaxtoside t	2e-04
TIGR03608		206	TIGR03608, L_ocin_972_ABC, putative bacteriocin ex	2e-04
cd03232		192	cd03232, ABCG_PDR_domain2, Second domain of the pl	2e-04
COG4170		330	COG4170, SapD, ABC-type antimicrobial peptide tran	2e-04
PRK13651		305	PRK13651, PRK13651, cobalt transporter ATP-binding	2e-04
PRK10762		501	PRK10762, PRK10762, D-ribose transporter ATP bindi	3e-04
TIGR02142		354	TIGR02142, modC_ABC, molybdenum ABC transporter, A	3e-04
PRK14239		252	PRK14239, PRK14239, phosphate transporter ATP-bind	3e-04
TIGR00956		1394	TIGR00956, 3a01205, Pleiotropic Drug Resistance (P	4e-04
PRK13636		283	PRK13636, cbiO, cobalt transporter ATP-binding sub	4e-04
PRK14248		268	PRK14248, PRK14248, phosphate ABC transporter ATP-	5e-04
COG1137		243	COG1137, YhbG, ABC-type (unclassified) transport s	5e-04
COG3638		258	COG3638, COG3638, ABC-type phosphate/phosphonate t	5e-04
PRK15134		529	PRK15134, PRK15134, microcin C ABC transporter ATP	5e-04
PRK09493		240	PRK09493, glnQ, glutamine ABC transporter ATP-bind	5e-04
PRK10070		400	PRK10070, PRK10070, glycine betaine transporter AT	5e-04
PRK13647		274	PRK13647, cbiO, cobalt transporter ATP-binding sub	6e-04
PLN03211		659	PLN03211, PLN03211, ABC transporter G-25; Provisio	6e-04
PRK13642		277	PRK13642, cbiO, cobalt transporter ATP-binding sub	7e-04
PRK14262		250	PRK14262, PRK14262, phosphate ABC transporter ATP-	7e-04
TIGR02673		214	TIGR02673, FtsE, cell division ATP-binding protein	7e-04
TIGR02633		500	TIGR02633, xylG, D-xylose ABC transporter, ATP-bin	7e-04
cd03301		213	cd03301, ABC_MalK_N, The N-terminal ATPase domain	8e-04
cd03262		213	cd03262, ABC_HisP_GlnQ, ATP-binding cassette domai	8e-04
TIGR02324		224	TIGR02324, CP_lyasePhnL, phosphonate C-P lyase sys	9e-04
COG4172		534	COG4172, COG4172, ABC-type uncharacterized transpo	9e-04
PRK14238		271	PRK14238, PRK14238, phosphate transporter ATP-bind	0.001
PRK11248		255	PRK11248, tauB, taurine transporter ATP-binding su	0.001
PRK11153		343	PRK11153, metN, DL-methionine transporter ATP-bind	0.001
TIGR03864		236	TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-bindi	0.001
TIGR00972		247	TIGR00972, 3a0107s01c2, phosphate ABC transporter,	0.001
COG3840		231	COG3840, ThiQ, ABC-type thiamine transport system,	0.001
COG4987		573	COG4987, CydC, ABC-type transport system involved	0.002
PRK13549		506	PRK13549, PRK13549, xylose transporter ATP-binding	0.002
cd03292		214	cd03292, ABC_FtsE_transporter, ATP-binding cassett	0.002
cd03260		227	cd03260, ABC_PstB_phosphate_transporter, ATP-bindi	0.002
TIGR01842		544	TIGR01842, type_I_sec_PrtD, type I secretion syste	0.002
PRK14257		329	PRK14257, PRK14257, phosphate ABC transporter ATP-	0.002
COG2274		709	COG2274, SunT, ABC-type bacteriocin/lantibiotic ex	0.002
cd03220		224	cd03220, ABC_KpsT_Wzt, ATP-binding cassette compon	0.002
cd03256		241	cd03256, ABC_PhnC_transporter, ATP-binding cassett	0.002
pfam13304		256	pfam13304, AAA_21, AAA domain	0.003
PRK13652		277	PRK13652, cbiO, cobalt transporter ATP-binding sub	0.003
PRK13632		271	PRK13632, cbiO, cobalt transporter ATP-binding sub	0.003
PRK10938		490	PRK10938, PRK10938, putative molybdenum transport	0.004
cd03227		162	cd03227, ABC_Class2, ATP-binding cassette domain o	0.004
PRK14255		252	PRK14255, PRK14255, phosphate ABC transporter ATP-	0.004
PRK14272		252	PRK14272, PRK14272, phosphate ABC transporter ATP-	0.004
PRK14268		258	PRK14268, PRK14268, phosphate ABC transporter ATP-	0.004

>gnl\|CDD\|130324 TIGR01257, rim_protein, retinal-specific rim ABC transporter	Back alignment and domain information

 Score =  126 bits (317), Expect = 5e-33
 Identities = 71/221 (32%), Positives = 118/221 (53%), Gaps = 56/221 (25%)

Query: 24   IGDPPLVFLDEPTSGVDPISRHRLWAVLSQIQKTGQSIVLTSHSMDECEALCNRLTIMRG 83
            IG PPLV LDEPT+G+DP +R  LW  +  I + G+++VLTSHSM+ECE           
Sbjct: 2086 IGCPPLVLLDEPTTGMDPQARRMLWNTIVSIIREGRAVVLTSHSMEECE----------- 2134

Query: 84   NELRKRRNCLSFRKEKMRLILTFPLCFPSSMDECEALCNRLTIMVRGEMQCLGNITYLKQ 143
                                               ALC RL IMV+G  QCLG I +LK 
Sbjct: 2135 -----------------------------------ALCTRLAIMVKGAFQCLGTIQHLKS 2159

Query: 144  RYGQGFTLMIKLRE------GDLDQLKERIRTEFKGRVEIKDEHKGLIHYQILDTTFSWS 197
            ++G G+ + +K++        DL+ +++  +  F G V+ ++ H  ++ +Q+  ++ S +
Sbjct: 2160 KFGDGYIVTMKIKSPKDDLLPDLNPVEQFFQGNFPGSVQ-RERHYNMLQFQV--SSSSLA 2216

Query: 198  VLFAKMEAVKTSMDIVEDYSLSDTTLEQVFIAFAKGRGQRH 238
             +F  + + K S+ ++E+YS++ TTL+QVF+ FAK + + +
Sbjct: 2217 RIFQLLISHKDSL-LIEEYSVTQTTLDQVFVNFAKQQTETY 2256

This model describes the photoreceptor protein (rim protein) in eukaryotes. It is the member of ABC transporter superfamily. Rim protein is a membrane glycoprotein which is localized in the photoreceptor outer segment discs. Mutation/s in its genetic loci is implicated in the recessive Stargardt's disease [Transport and binding proteins, Other]. Length = 2272

>gnl\|CDD\|213230 cd03263, ABC_subfamily_A, ATP-binding cassette domain of the lipid transporters, subfamily A	Back alignment and domain information

>gnl\|CDD\|213197 cd03230, ABC_DR_subfamily_A, ATP-binding cassette domain of the drug resistance transporter and related proteins, subfamily A	Back alignment and domain information

>gnl\|CDD\|224054 COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms]	Back alignment and domain information

>gnl\|CDD\|213179 cd00267, ABC_ATPase, ATP-binding cassette transporter nucleotide-binding domain	Back alignment and domain information

>gnl\|CDD\|130256 TIGR01188, drrA, daunorubicin resistance ABC transporter ATP-binding subunit	Back alignment and domain information

>gnl\|CDD\|213232 cd03265, ABC_DrrA, Daunorubicin/doxorubicin resistance ATP-binding protein	Back alignment and domain information

>gnl\|CDD\|213192 cd03225, ABC_cobalt_CbiO_domain1, First domain of the ATP-binding cassette component of cobalt transport system	Back alignment and domain information

>gnl\|CDD\|237419 PRK13536, PRK13536, nodulation factor exporter subunit NodI; Provisional	Back alignment and domain information

>gnl\|CDD\|237420 PRK13537, PRK13537, nodulation ABC transporter NodI; Provisional	Back alignment and domain information

>gnl\|CDD\|130355 TIGR01288, nodI, ATP-binding ABC transporter family nodulation protein NodI	Back alignment and domain information

>gnl\|CDD\|213196 cd03229, ABC_Class3, ATP-binding cassette domain of the binding protein-dependent transport systems	Back alignment and domain information

>gnl\|CDD\|213236 cd03269, ABC_putative_ATPase, ATP-binding cassette domain of an uncharacterized transporter	Back alignment and domain information

>gnl\|CDD\|213231 cd03264, ABC_drug_resistance_like, ABC-type multidrug transport system, ATPase component	Back alignment and domain information

>gnl\|CDD\|130324 TIGR01257, rim_protein, retinal-specific rim ABC transporter	Back alignment and domain information

>gnl\|CDD\|224050 COG1125, OpuBA, ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|213233 cd03266, ABC_NatA_sodium_exporter, ATP-binding cassette domain of the Na+ transporter	Back alignment and domain information

>gnl\|CDD\|213183 cd03216, ABC_Carb_Monos_I, First domain of the ATP-binding cassette component of monosaccharide transport system	Back alignment and domain information

>gnl\|CDD\|213262 cd03295, ABC_OpuCA_Osmoprotection, ATP-binding cassette domain of the osmoprotectant transporter	Back alignment and domain information

>gnl\|CDD\|213234 cd03267, ABC_NatA_like, ATP-binding cassette domain of an uncharacterized transporter similar in sequence to NatA	Back alignment and domain information

>gnl\|CDD\|213235 cd03268, ABC_BcrA_bacitracin_resist, ATP-binding cassette domain of the bacitracin-resistance transporter	Back alignment and domain information

>gnl\|CDD\|226927 COG4555, NatA, ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|226631 COG4152, COG4152, ABC-type uncharacterized transport system, ATPase component [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|224047 COG1122, CbiO, ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|226952 COG4586, COG4586, ABC-type uncharacterized transport system, ATPase component [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|224058 COG1135, AbcC, ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|184205 PRK13646, cbiO, cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|130254 TIGR01186, proV, glycine betaine/L-proline transport ATP binding subunit	Back alignment and domain information

>gnl\|CDD\|224053 COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|224041 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|132561 TIGR03522, GldA_ABC_ATP, gliding motility-associated ABC transporter ATP-binding subunit GldA	Back alignment and domain information

>gnl\|CDD\|213180 cd03213, ABCG_EPDR, Eye pigment and drug resistance transporter subfamily G of the ATP-binding cassette superfamily	Back alignment and domain information

>gnl\|CDD\|213193 cd03226, ABC_cobalt_CbiO_domain2, Second domain of the ATP-binding cassette component of cobalt transport system	Back alignment and domain information

>gnl\|CDD\|213260 cd03293, ABC_NrtD_SsuB_transporters, ATP-binding cassette domain of the nitrate and sulfonate transporters	Back alignment and domain information

>gnl\|CDD\|224052 COG1127, Ttg2A, ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>gnl\|CDD\|224046 COG1121, ZnuC, ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|226643 COG4175, ProV, ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|213202 cd03235, ABC_Metallic_Cations, ATP-binding cassette domain of the metal-type transporters	Back alignment and domain information

>gnl\|CDD\|224053 COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|213226 cd03259, ABC_Carb_Solutes_like, ATP-binding cassette domain of the carbohydrate and solute transporters-like	Back alignment and domain information

>gnl\|CDD\|132313 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase system, component A2	Back alignment and domain information

>gnl\|CDD\|213225 cd03258, ABC_MetN_methionine_transporter, ATP-binding cassette domain of methionine transporter	Back alignment and domain information

>gnl\|CDD\|213186 cd03219, ABC_Mj1267_LivG_branched, ATP-binding cassette component of branched chain amino acids transport system	Back alignment and domain information

>gnl\|CDD\|188317 TIGR03415, ABC_choXWV_ATP, choline ABC transporter, ATP-binding protein	Back alignment and domain information

>gnl\|CDD\|184203 PRK13643, cbiO, cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|237456 PRK13641, cbiO, cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|213213 cd03246, ABCC_Protease_Secretion, ATP-binding cassette domain of PrtD, subfamily C	Back alignment and domain information

>gnl\|CDD\|213264 cd03297, ABC_ModC_molybdenum_transporter, ATP-binding cassette domain of the molybdenum transport system	Back alignment and domain information

>gnl\|CDD\|226364 COG3845, COG3845, ABC-type uncharacterized transport systems, ATPase components [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|184208 PRK13649, cbiO, cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|213228 cd03261, ABC_Org_Solvent_Resistant, ATP-binding cassette transport system involved in resistant to organic solvents	Back alignment and domain information

>gnl\|CDD\|224045 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism]	Back alignment and domain information

>gnl\|CDD\|224044 COG1119, ModF, ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|213261 cd03294, ABC_Pro_Gly_Betaine, ATP-binding cassette domain of the osmoprotectant proline/glycine betaine uptake system	Back alignment and domain information

>gnl\|CDD\|226905 COG4525, TauB, ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|182036 PRK09700, PRK09700, D-allose transporter ATP-binding protein; Provisional	Back alignment and domain information

>gnl\|CDD\|185336 PRK15439, PRK15439, autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional	Back alignment and domain information

>gnl\|CDD\|224048 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|237455 PRK13637, cbiO, cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|163452 TIGR03740, galliderm_ABC, gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit	Back alignment and domain information

>gnl\|CDD\|237454 PRK13634, cbiO, cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|233207 TIGR00955, 3a01204, The Eye Pigment Precursor Transporter (EPP) Family protein	Back alignment and domain information

>gnl\|CDD\|213195 cd03228, ABCC_MRP_Like, ATP-binding cassette domain of multidrug resistance protein-like transporters	Back alignment and domain information

>gnl\|CDD\|224049 COG1124, DppF, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|185336 PRK15439, PRK15439, autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional	Back alignment and domain information

>gnl\|CDD\|213224 cd03257, ABC_NikE_OppD_transporters, ATP-binding cassette domain of nickel/oligopeptides specific transporters	Back alignment and domain information

>gnl\|CDD\|130234 TIGR01166, cbiO, cobalt transport protein ATP-binding subunit	Back alignment and domain information

>gnl\|CDD\|184199 PRK13639, cbiO, cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|182880 PRK10982, PRK10982, galactose/methyl galaxtoside transporter ATP-binding protein; Provisional	Back alignment and domain information

>gnl\|CDD\|213266 cd03299, ABC_ModC_like, ATP-binding cassette domain similar to the molybdate transporter	Back alignment and domain information

>gnl\|CDD\|213212 cd03245, ABCC_bacteriocin_exporters, ATP-binding cassette domain of bacteriocin exporters, subfamily C	Back alignment and domain information

>gnl\|CDD\|213182 cd03215, ABC_Carb_Monos_II, Second domain of the ATP-binding cassette component of monosaccharide transport system	Back alignment and domain information

>gnl\|CDD\|234189 TIGR03375, type_I_sec_LssB, type I secretion system ATPase, LssB family	Back alignment and domain information

>gnl\|CDD\|182817 PRK10895, PRK10895, lipopolysaccharide ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>gnl\|CDD\|223521 COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|213185 cd03218, ABC_YhbG, ATP-binding cassette component of YhbG transport system	Back alignment and domain information

>gnl\|CDD\|213191 cd03224, ABC_TM1139_LivF_branched, ATP-binding cassette domain of branched-chain amino acid transporter	Back alignment and domain information

>gnl\|CDD\|213201 cd03234, ABCG_White, White pigment protein homolog of ABCG transporter subfamily	Back alignment and domain information

>gnl\|CDD\|213222 cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding cassette domain of the transporters involved in export of lipoprotein and macrolide, and cell division protein	Back alignment and domain information

>gnl\|CDD\|213181 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-binding component of iron-siderophores, vitamin B12 and hemin transporters and related proteins	Back alignment and domain information

>gnl\|CDD\|182036 PRK09700, PRK09700, D-allose transporter ATP-binding protein; Provisional	Back alignment and domain information

>gnl\|CDD\|172741 PRK14253, PRK14253, phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>gnl\|CDD\|184198 PRK13638, cbiO, cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|183077 PRK11288, araG, L-arabinose transporter ATP-binding protein; Provisional	Back alignment and domain information

>gnl\|CDD\|131367 TIGR02314, ABC_MetN, D-methionine ABC transporter, ATP-binding protein	Back alignment and domain information

>gnl\|CDD\|213265 cd03298, ABC_ThiQ_thiamine_transporter, ATP-binding cassette domain of the thiamine transport system	Back alignment and domain information

>gnl\|CDD\|163483 TIGR03771, anch_rpt_ABC, anchored repeat-type ABC transporter, ATP-binding subunit	Back alignment and domain information

>gnl\|CDD\|224048 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|224051 COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|224059 COG1136, SalX, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms]	Back alignment and domain information

>gnl\|CDD\|224043 COG1118, CysA, ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|223488 COG0411, LivG, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|182880 PRK10982, PRK10982, galactose/methyl galaxtoside transporter ATP-binding protein; Provisional	Back alignment and domain information

>gnl\|CDD\|188353 TIGR03608, L_ocin_972_ABC, putative bacteriocin export ABC transporter, lactococcin 972 group	Back alignment and domain information

>gnl\|CDD\|213199 cd03232, ABCG_PDR_domain2, Second domain of the pleiotropic drug resistance-like (PDR) subfamily G of ATP-binding cassette transporters	Back alignment and domain information

>gnl\|CDD\|226639 COG4170, SapD, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms]	Back alignment and domain information

>gnl\|CDD\|184210 PRK13651, PRK13651, cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|236755 PRK10762, PRK10762, D-ribose transporter ATP binding protein; Provisional	Back alignment and domain information

>gnl\|CDD\|131197 TIGR02142, modC_ABC, molybdenum ABC transporter, ATP-binding protein	Back alignment and domain information

>gnl\|CDD\|184585 PRK14239, PRK14239, phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>gnl\|CDD\|233208 TIGR00956, 3a01205, Pleiotropic Drug Resistance (PDR) Family protein	Back alignment and domain information

>gnl\|CDD\|184196 PRK13636, cbiO, cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|237647 PRK14248, PRK14248, phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>gnl\|CDD\|224060 COG1137, YhbG, ABC-type (unclassified) transport system, ATPase component [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|226164 COG3638, COG3638, ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>gnl\|CDD\|237917 PRK15134, PRK15134, microcin C ABC transporter ATP-binding protein YejF; Provisional	Back alignment and domain information

>gnl\|CDD\|181906 PRK09493, glnQ, glutamine ABC transporter ATP-binding protein; Reviewed	Back alignment and domain information

>gnl\|CDD\|182221 PRK10070, PRK10070, glycine betaine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|237457 PRK13647, cbiO, cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|215634 PLN03211, PLN03211, ABC transporter G-25; Provisional	Back alignment and domain information

>gnl\|CDD\|184202 PRK13642, cbiO, cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|172750 PRK14262, PRK14262, phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>gnl\|CDD\|131721 TIGR02673, FtsE, cell division ATP-binding protein FtsE	Back alignment and domain information

>gnl\|CDD\|131681 TIGR02633, xylG, D-xylose ABC transporter, ATP-binding protein	Back alignment and domain information

>gnl\|CDD\|213268 cd03301, ABC_MalK_N, The N-terminal ATPase domain of the maltose transporter, MalK	Back alignment and domain information

>gnl\|CDD\|213229 cd03262, ABC_HisP_GlnQ, ATP-binding cassette domain of the histidine and glutamine transporters	Back alignment and domain information

>gnl\|CDD\|131377 TIGR02324, CP_lyasePhnL, phosphonate C-P lyase system protein PhnL	Back alignment and domain information

>gnl\|CDD\|226641 COG4172, COG4172, ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|184584 PRK14238, PRK14238, phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>gnl\|CDD\|183056 PRK11248, tauB, taurine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|236863 PRK11153, metN, DL-methionine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|188394 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system	Back alignment and domain information

>gnl\|CDD\|188099 TIGR00972, 3a0107s01c2, phosphate ABC transporter, ATP-binding protein	Back alignment and domain information

>gnl\|CDD\|226360 COG3840, ThiQ, ABC-type thiamine transport system, ATPase component [Coenzyme metabolism]	Back alignment and domain information

>gnl\|CDD\|227320 COG4987, CydC, ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>gnl\|CDD\|184134 PRK13549, PRK13549, xylose transporter ATP-binding subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|213259 cd03292, ABC_FtsE_transporter, ATP-binding cassette domain of the cell division transporter	Back alignment and domain information

>gnl\|CDD\|213227 cd03260, ABC_PstB_phosphate_transporter, ATP-binding cassette domain of the phosphate transport system	Back alignment and domain information

>gnl\|CDD\|200134 TIGR01842, type_I_sec_PrtD, type I secretion system ABC transporter, PrtD family	Back alignment and domain information

>gnl\|CDD\|172745 PRK14257, PRK14257, phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>gnl\|CDD\|225183 COG2274, SunT, ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms]	Back alignment and domain information

>gnl\|CDD\|213187 cd03220, ABC_KpsT_Wzt, ATP-binding cassette component of polysaccharide transport system	Back alignment and domain information

>gnl\|CDD\|213223 cd03256, ABC_PhnC_transporter, ATP-binding cassette domain of the binding protein-dependent phosphonate transport system	Back alignment and domain information

>gnl\|CDD\|222036 pfam13304, AAA_21, AAA domain	Back alignment and domain information

>gnl\|CDD\|172200 PRK13652, cbiO, cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|237452 PRK13632, cbiO, cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|182852 PRK10938, PRK10938, putative molybdenum transport ATP-binding protein ModF; Provisional	Back alignment and domain information

>gnl\|CDD\|213194 cd03227, ABC_Class2, ATP-binding cassette domain of non-transporter proteins	Back alignment and domain information

>gnl\|CDD\|172743 PRK14255, PRK14255, phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>gnl\|CDD\|172760 PRK14272, PRK14272, phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>gnl\|CDD\|172756 PRK14268, PRK14268, phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		247
KOG0059\|consensus		885		99.96
TIGR01257		2272	rim_protein retinal-specific rim ABC transporter.	99.94
TIGR01257		2272	rim_protein retinal-specific rim ABC transporter.	99.93
COG4152		300	ABC-type uncharacterized transport system, ATPase	99.91
TIGR01188		302	drrA daunorubicin resistance ABC transporter ATP-b	99.9
PRK13537		306	nodulation ABC transporter NodI; Provisional	99.9
PRK13536		340	nodulation factor exporter subunit NodI; Provision	99.89
TIGR03522		301	GldA_ABC_ATP gliding motility-associated ABC trans	99.88
COG1131		293	CcmA ABC-type multidrug transport system, ATPase c	99.88
TIGR01288		303	nodI ATP-binding ABC transporter family nodulation	99.87
COG4555		245	NatA ABC-type Na+ transport system, ATPase compone	99.82
COG4586		325	ABC-type uncharacterized transport system, ATPase	99.81
COG1127		263	Ttg2A ABC-type transport system involved in resist	99.71
cd03226		205	ABC_cobalt_CbiO_domain2 Domain II of the ABC compo	99.71
PRK09536		402	btuD corrinoid ABC transporter ATPase; Reviewed	99.7
cd03219		236	ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans	99.69
PRK11614		237	livF leucine/isoleucine/valine transporter ATP-bin	99.69
cd03261		235	ABC_Org_Solvent_Resistant ABC (ATP-binding cassett	99.69
cd03256		241	ABC_PhnC_transporter ABC-type phosphate/phosphonat	99.69
PRK13641		287	cbiO cobalt transporter ATP-binding subunit; Provi	99.69
PRK13643		288	cbiO cobalt transporter ATP-binding subunit; Provi	99.69
PRK13637		287	cbiO cobalt transporter ATP-binding subunit; Provi	99.69
TIGR00960		216	3a0501s02 Type II (General) Secretory Pathway (IIS	99.68
cd03296		239	ABC_CysA_sulfate_importer Part of the ABC transpor	99.68
cd03259		213	ABC_Carb_Solutes_like ABC Carbohydrate and Solute	99.68
cd03224		222	ABC_TM1139_LivF_branched LivF (TM1139) is part of	99.68
cd03258		233	ABC_MetN_methionine_transporter MetN (also known a	99.68
PRK15093		330	antimicrobial peptide ABC transporter ATP-binding	99.68
cd03218		232	ABC_YhbG The ABC transporters belonging to the Yhb	99.68
PRK11264		250	putative amino-acid ABC transporter ATP-binding pr	99.68
PRK11300		255	livG leucine/isoleucine/valine transporter ATP-bin	99.68
COG1122		235	CbiO ABC-type cobalt transport system, ATPase comp	99.68
cd03268		208	ABC_BcrA_bacitracin_resist The BcrA subfamily repr	99.68
PRK13651		305	cobalt transporter ATP-binding subunit; Provisiona	99.68
PRK11153		343	metN DL-methionine transporter ATP-binding subunit	99.68
PRK13634		290	cbiO cobalt transporter ATP-binding subunit; Provi	99.67
TIGR02315		243	ABC_phnC phosphonate ABC transporter, ATP-binding	99.67
COG1126		240	GlnQ ABC-type polar amino acid transport system, A	99.67
PRK13652		277	cbiO cobalt transporter ATP-binding subunit; Provi	99.67
cd03265		220	ABC_DrrA DrrA is the ATP-binding protein component	99.67
cd03225		211	ABC_cobalt_CbiO_domain1 Domain I of the ABC compon	99.67
PRK11022		326	dppD dipeptide transporter ATP-binding subunit; Pr	99.67
PRK13636		283	cbiO cobalt transporter ATP-binding subunit; Provi	99.67
TIGR01978		243	sufC FeS assembly ATPase SufC. SufC is part of the	99.67
PRK13638		271	cbiO cobalt transporter ATP-binding subunit; Provi	99.67
cd03262		213	ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-	99.67
PRK09493		240	glnQ glutamine ABC transporter ATP-binding protein	99.67
TIGR02314		343	ABC_MetN D-methionine ABC transporter, ATP-binding	99.67
cd03257		228	ABC_NikE_OppD_transporters The ABC transporter sub	99.67
cd03294		269	ABC_Pro_Gly_Bertaine This family comprises the gly	99.67
cd03216		163	ABC_Carb_Monos_I This family represents the domain	99.67
PRK13647		274	cbiO cobalt transporter ATP-binding subunit; Provi	99.67
TIGR02770		230	nickel_nikD nickel import ATP-binding protein NikD	99.67
TIGR02673		214	FtsE cell division ATP-binding protein FtsE. This	99.67
cd03297		214	ABC_ModC_molybdenum_transporter ModC is an ABC-typ	99.67
cd03215		182	ABC_Carb_Monos_II This family represents domain II	99.66
TIGR03410		230	urea_trans_UrtE urea ABC transporter, ATP-binding	99.66
PRK10619		257	histidine/lysine/arginine/ornithine transporter su	99.66
TIGR01184		230	ntrCD nitrate transport ATP-binding subunits C and	99.66
cd03293		220	ABC_NrtD_SsuB_transporters NrtD and SsuB are the A	99.66
cd03260		227	ABC_PstB_phosphate_transporter Phosphate uptake is	99.66
cd03266		218	ABC_NatA_sodium_exporter NatA is the ATPase compon	99.66
PRK09473		330	oppD oligopeptide transporter ATP-binding componen	99.66
PRK13649		280	cbiO cobalt transporter ATP-binding subunit; Provi	99.66
TIGR03258		362	PhnT 2-aminoethylphosphonate ABC transport system,	99.66
PRK10908		222	cell division protein FtsE; Provisional	99.66
cd03301		213	ABC_MalK_N The N-terminal ATPase domain of the mal	99.66
cd03255		218	ABC_MJ0796_Lo1CDE_FtsE This family is comprised of	99.66
PRK13646		286	cbiO cobalt transporter ATP-binding subunit; Provi	99.66
COG0444		316	DppD ABC-type dipeptide/oligopeptide/nickel transp	99.66
cd03298		211	ABC_ThiQ_thiamine_transporter ABC-type thiamine tr	99.66
TIGR03411		242	urea_trans_UrtD urea ABC transporter, ATP-binding	99.66
PRK11831		269	putative ABC transporter ATP-binding protein YrbF;	99.66
PRK14268		258	phosphate ABC transporter ATP-binding protein; Pro	99.66
TIGR01187		325	potA spermidine/putrescine ABC transporter ATP-bin	99.66
TIGR01186		363	proV glycine betaine/L-proline transport ATP bindi	99.65
PRK15079		331	oligopeptide ABC transporter ATP-binding protein O	99.65
cd03295		242	ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin	99.65
PRK10895		241	lipopolysaccharide ABC transporter ATP-binding pro	99.65
PRK14242		253	phosphate transporter ATP-binding protein; Provisi	99.65
cd03235		213	ABC_Metallic_Cations ABC component of the metal-ty	99.65
PRK10771		232	thiQ thiamine transporter ATP-binding subunit; Pro	99.65
PRK13645		289	cbiO cobalt transporter ATP-binding subunit; Provi	99.65
PRK11231		255	fecE iron-dicitrate transporter ATP-binding subuni	99.65
PRK13644		274	cbiO cobalt transporter ATP-binding subunit; Provi	99.65
cd03292		214	ABC_FtsE_transporter FtsE is a hydrophilic nucleot	99.65
PRK13631		320	cbiO cobalt transporter ATP-binding subunit; Provi	99.65
PRK11308		327	dppF dipeptide transporter ATP-binding subunit; Pr	99.65
cd03269		210	ABC_putative_ATPase This subfamily is involved in	99.65
PRK13639		275	cbiO cobalt transporter ATP-binding subunit; Provi	99.65
PRK14245		250	phosphate ABC transporter ATP-binding protein; Pro	99.64
TIGR03771		223	anch_rpt_ABC anchored repeat-type ABC transporter,	99.64
TIGR03864		236	PQQ_ABC_ATP ABC transporter, ATP-binding subunit,	99.64
COG1125		309	OpuBA ABC-type proline/glycine betaine transport s	99.64
PRK10575		265	iron-hydroxamate transporter ATP-binding subunit;	99.64
TIGR00972		247	3a0107s01c2 phosphate ABC transporter, ATP-binding	99.64
PRK11701		258	phnK phosphonate C-P lyase system protein PhnK; Pr	99.64
cd03249		238	ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6)	99.64
TIGR02769		265	nickel_nikE nickel import ATP-binding protein NikE	99.64
PRK11124		242	artP arginine transporter ATP-binding subunit; Pro	99.64
PRK13546		264	teichoic acids export protein ATP-binding subunit;	99.64
PRK11650		356	ugpC glycerol-3-phosphate transporter ATP-binding	99.64
TIGR03415		382	ABC_choXWV_ATP choline ABC transporter, ATP-bindin	99.64
PRK10851		353	sulfate/thiosulfate transporter subunit; Provision	99.64
PRK15112		267	antimicrobial peptide ABC system ATP-binding prote	99.64
cd03263		220	ABC_subfamily_A The ABCA subfamily mediates the tr	99.64
TIGR03873		256	F420-0_ABC_ATP proposed F420-0 ABC transporter, AT	99.64
PRK14273		254	phosphate ABC transporter ATP-binding protein; Pro	99.64
cd03220		224	ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo	99.64
TIGR01277		213	thiQ thiamine ABC transporter, ATP-binding protein	99.64
PRK14250		241	phosphate ABC transporter ATP-binding protein; Pro	99.64
PRK14241		258	phosphate transporter ATP-binding protein; Provisi	99.64
PRK10418		254	nikD nickel transporter ATP-binding protein NikD;	99.64
PRK11000		369	maltose/maltodextrin transporter ATP-binding prote	99.64
cd03246		173	ABCC_Protease_Secretion This family represents the	99.64
PRK14274		259	phosphate ABC transporter ATP-binding protein; Pro	99.63
PRK14248		268	phosphate ABC transporter ATP-binding protein; Pro	99.63
TIGR02142		354	modC_ABC molybdenum ABC transporter, ATP-binding p	99.63
PRK03695		248	vitamin B12-transporter ATPase; Provisional	99.63
TIGR03740		223	galliderm_ABC gallidermin-class lantibiotic protec	99.63
PRK14239		252	phosphate transporter ATP-binding protein; Provisi	99.63
PRK13633		280	cobalt transporter ATP-binding subunit; Provisiona	99.63
PRK11144		352	modC molybdate transporter ATP-binding protein; Pr	99.63
PRK13650		279	cbiO cobalt transporter ATP-binding subunit; Provi	99.63
TIGR02323		253	CP_lyasePhnK phosphonate C-P lyase system protein	99.63
PRK09580		248	sufC cysteine desulfurase ATPase component; Review	99.63
cd03254		229	ABCC_Glucan_exporter_like Glucan exporter ATP-bind	99.63
PRK13548		258	hmuV hemin importer ATP-binding subunit; Provision	99.63
PRK14247		250	phosphate ABC transporter ATP-binding protein; Pro	99.63
COG1123		539	ATPase components of various ABC-type transport sy	99.63
cd03230		173	ABC_DR_subfamily_A This family of ATP-binding prot	99.63
TIGR02211		221	LolD_lipo_ex lipoprotein releasing system, ATP-bin	99.63
cd03251		234	ABCC_MsbA MsbA is an essential ABC transporter, cl	99.63
PRK14267		253	phosphate ABC transporter ATP-binding protein; Pro	99.63
PRK11432		351	fbpC ferric transporter ATP-binding subunit; Provi	99.63
cd03252		237	ABCC_Hemolysin The ABC-transporter hemolysin B is	99.63
TIGR03265		353	PhnT2 putative 2-aminoethylphosphonate ABC transpo	99.63
PRK14270		251	phosphate ABC transporter ATP-binding protein; Pro	99.63
PRK10070		400	glycine betaine transporter ATP-binding subunit; P	99.63
cd03300		232	ABC_PotA_N PotA is an ABC-type transporter and the	99.63
cd03214		180	ABC_Iron-Siderophores_B12_Hemin ABC transporters,	99.63
cd03264		211	ABC_drug_resistance_like ABC-type multidrug transp	99.63
PRK13635		279	cbiO cobalt transporter ATP-binding subunit; Provi	99.63
PRK09984		262	phosphonate/organophosphate ester transporter subu	99.63
PRK14240		250	phosphate transporter ATP-binding protein; Provisi	99.63
TIGR03005		252	ectoine_ehuA ectoine/hydroxyectoine ABC transporte	99.63
PRK10253		265	iron-enterobactin transporter ATP-binding protein;	99.63
PRK14244		251	phosphate ABC transporter ATP-binding protein; Pro	99.63
COG1124		252	DppF ABC-type dipeptide/oligopeptide/nickel transp	99.62
COG1121		254	ZnuC ABC-type Mn/Zn transport systems, ATPase comp	99.62
cd03217		200	ABC_FeS_Assembly ABC-type transport system involve	99.62
PRK14259		269	phosphate ABC transporter ATP-binding protein; Pro	99.62
TIGR00968		237	3a0106s01 sulfate ABC transporter, ATP-binding pro	99.62
CHL00131		252	ycf16 sulfate ABC transporter protein; Validated	99.62
COG4175		386	ProV ABC-type proline/glycine betaine transport sy	99.62
cd03267		236	ABC_NatA_like Similar in sequence to NatA, this is	99.62
PRK14253		249	phosphate ABC transporter ATP-binding protein; Pro	99.62
PRK13549		506	xylose transporter ATP-binding subunit; Provisiona	99.62
PRK14262		250	phosphate ABC transporter ATP-binding protein; Pro	99.62
PRK10938		490	putative molybdenum transport ATP-binding protein	99.62
COG1135		339	AbcC ABC-type metal ion transport system, ATPase c	99.62
PRK14272		252	phosphate ABC transporter ATP-binding protein; Pro	99.62
PRK10584		228	putative ABC transporter ATP-binding protein YbbA;	99.62
PRK14249		251	phosphate ABC transporter ATP-binding protein; Pro	99.62
PRK14235		267	phosphate transporter ATP-binding protein; Provisi	99.62
PRK10744		260	pstB phosphate transporter ATP-binding protein; Pr	99.61
PRK14256		252	phosphate ABC transporter ATP-binding protein; Pro	99.61
cd03229		178	ABC_Class3 This class is comprised of all BPD (Bin	99.61
PRK14243		264	phosphate transporter ATP-binding protein; Provisi	99.61
PRK13549		506	xylose transporter ATP-binding subunit; Provisiona	99.61
cd03299		235	ABC_ModC_like Archeal protein closely related to M	99.61
PRK14258		261	phosphate ABC transporter ATP-binding protein; Pro	99.61
PRK14269		246	phosphate ABC transporter ATP-binding protein; Pro	99.61
PRK10762		501	D-ribose transporter ATP binding protein; Provisio	99.61
PRK09700		510	D-allose transporter ATP-binding protein; Provisio	99.61
TIGR03269		520	met_CoM_red_A2 methyl coenzyme M reductase system,	99.61
PRK14238		271	phosphate transporter ATP-binding protein; Provisi	99.61
PRK11247		257	ssuB aliphatic sulfonates transport ATP-binding su	99.61
cd03213		194	ABCG_EPDR ABCG transporters are involved in eye pi	99.61
PRK14236		272	phosphate transporter ATP-binding protein; Provisi	99.61
cd03234		226	ABCG_White The White subfamily represents ABC tran	99.61
PRK11288		501	araG L-arabinose transporter ATP-binding protein;	99.61
PRK15134		529	microcin C ABC transporter ATP-binding protein Yej	99.61
PRK11248		255	tauB taurine transporter ATP-binding subunit; Prov	99.6
PRK14261		253	phosphate ABC transporter ATP-binding protein; Pro	99.6
cd03253		236	ABCC_ATM1_transporter ATM1 is an ABC transporter t	99.6
PRK15439		510	autoinducer 2 ABC transporter ATP-binding protein	99.6
PRK13648		269	cbiO cobalt transporter ATP-binding subunit; Provi	99.6
TIGR02633		500	xylG D-xylose ABC transporter, ATP-binding protein	99.6
PRK14251		251	phosphate ABC transporter ATP-binding protein; Pro	99.6
PRK13640		282	cbiO cobalt transporter ATP-binding subunit; Provi	99.6
PRK14275		286	phosphate ABC transporter ATP-binding protein; Pro	99.6
PRK10762		501	D-ribose transporter ATP binding protein; Provisio	99.6
PRK15134		529	microcin C ABC transporter ATP-binding protein Yej	99.6
PRK09452		375	potA putrescine/spermidine ABC transporter ATPase	99.6
PRK15439		510	autoinducer 2 ABC transporter ATP-binding protein	99.6
PRK10982		491	galactose/methyl galaxtoside transporter ATP-bindi	99.6
PRK11607		377	potG putrescine transporter ATP-binding subunit; P	99.6
cd03232		192	ABC_PDR_domain2 The pleiotropic drug resistance-li	99.6
PRK15056		272	manganese/iron transporter ATP-binding protein; Pr	99.6
PRK11629		233	lolD lipoprotein transporter ATP-binding subunit;	99.6
PRK10419		268	nikE nickel transporter ATP-binding protein NikE;	99.6
COG1120		258	FepC ABC-type cobalamin/Fe3+-siderophores transpor	99.6
cd03245		220	ABCC_bacteriocin_exporters ABC-type bacteriocin ex	99.6
PRK10261		623	glutathione transporter ATP-binding protein; Provi	99.6
PRK10982		491	galactose/methyl galaxtoside transporter ATP-bindi	99.59
TIGR02633		500	xylG D-xylose ABC transporter, ATP-binding protein	99.59
PRK13642		277	cbiO cobalt transporter ATP-binding subunit; Provi	99.59
PRK10261		623	glutathione transporter ATP-binding protein; Provi	99.59
PRK09700		510	D-allose transporter ATP-binding protein; Provisio	99.59
PRK13547		272	hmuV hemin importer ATP-binding subunit; Provision	99.59
PRK14263		261	phosphate ABC transporter ATP-binding protein; Pro	99.59
TIGR03269		520	met_CoM_red_A2 methyl coenzyme M reductase system,	99.59
cd03228		171	ABCC_MRP_Like The MRP (Mutidrug Resistance Protein	99.59
PRK14255		252	phosphate ABC transporter ATP-binding protein; Pro	99.59
PRK13632		271	cbiO cobalt transporter ATP-binding subunit; Provi	99.58
PRK13545		549	tagH teichoic acids export protein ATP-binding sub	99.58
PRK14237		267	phosphate transporter ATP-binding protein; Provisi	99.58
PRK14265		274	phosphate ABC transporter ATP-binding protein; Pro	99.58
cd03247		178	ABCC_cytochrome_bd The CYD subfamily implicated in	99.58
PRK14260		259	phosphate ABC transporter ATP-binding protein; Pro	99.58
cd03238		176	ABC_UvrA The excision repair protein UvrA; Nucleot	99.58
PRK14246		257	phosphate ABC transporter ATP-binding protein; Pro	99.58
PRK14266		250	phosphate ABC transporter ATP-binding protein; Pro	99.58
PRK11288		501	araG L-arabinose transporter ATP-binding protein;	99.57
PRK14271		276	phosphate ABC transporter ATP-binding protein; Pro	99.57
PRK09544		251	znuC high-affinity zinc transporter ATPase; Review	99.57
PRK14252		265	phosphate ABC transporter ATP-binding protein; Pro	99.57
PRK14257		329	phosphate ABC transporter ATP-binding protein; Pro	99.56
cd03369		207	ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty	99.56
cd03270		226	ABC_UvrA_I The excision repair protein UvrA domain	99.55
PRK15177		213	Vi polysaccharide export ATP-binding protein VexC;	99.55
cd03248		226	ABCC_TAP TAP, the Transporter Associated with Anti	99.55
PRK14254		285	phosphate ABC transporter ATP-binding protein; Pro	99.55
cd03233		202	ABC_PDR_domain1 The pleiotropic drug resistance (P	99.55
cd03288		257	ABCC_SUR2 The SUR domain 2. The sulfonylurea recep	99.55
cd03289		275	ABCC_CFTR2 The CFTR subfamily domain 2. The cystic	99.54
cd03244		221	ABCC_MRP_domain2 Domain 2 of the ABC subfamily C.	99.54
cd03237		246	ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o	99.54
cd03221		144	ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is	99.53
PRK14264		305	phosphate ABC transporter ATP-binding protein; Pro	99.53
cd03222		177	ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi	99.53
TIGR02982		220	heterocyst_DevA ABC exporter ATP-binding subunit,	99.53
cd00267		157	ABC_ATPase ABC (ATP-binding cassette) transporter	99.52
COG1123		539	ATPase components of various ABC-type transport sy	99.52
COG1116		248	TauB ABC-type nitrate/sulfonate/bicarbonate transp	99.52
PRK13543		214	cytochrome c biogenesis protein CcmA; Provisional	99.52
PLN03211		659	ABC transporter G-25; Provisional	99.52
PRK10938		490	putative molybdenum transport ATP-binding protein	99.5
TIGR02324		224	CP_lyasePhnL phosphonate C-P lyase system protein	99.5
COG3840		231	ThiQ ABC-type thiamine transport system, ATPase co	99.5
TIGR03608		206	L_ocin_972_ABC putative bacteriocin export ABC tra	99.5
COG1118		345	CysA ABC-type sulfate/molybdate transport systems,	99.5
PRK15064		530	ABC transporter ATP-binding protein; Provisional	99.49
cd03250		204	ABCC_MRP_domain1 Domain 1 of the ABC subfamily C.	99.49
COG1137		243	YhbG ABC-type (unclassified) transport system, ATP	99.49
PRK10247		225	putative ABC transporter ATP-binding protein YbbL;	99.49
cd03290		218	ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec	99.49
PRK15064		530	ABC transporter ATP-binding protein; Provisional	99.48
cd03291		282	ABCC_CFTR1 The CFTR subfamily domain 1. The cystic	99.48
cd03236		255	ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o	99.46
TIGR01842		544	type_I_sec_PrtD type I secretion system ABC transp	99.46
PRK10636		638	putative ABC transporter ATP-binding protein; Prov	99.45
PRK11819		556	putative ABC transporter ATP-binding protein; Revi	99.45
COG1129		500	MglA ABC-type sugar transport system, ATPase compo	99.45
TIGR00955		617	3a01204 The Eye Pigment Precursor Transporter (EPP	99.45
cd03271		261	ABC_UvrA_II The excision repair protein UvrA domai	99.44
cd03223		166	ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass	99.44
TIGR01192		585	chvA glucan exporter ATP-binding protein. This mod	99.44
PRK13538		204	cytochrome c biogenesis protein CcmA; Provisional	99.43
cd03279		213	ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complex	99.43
COG1136		226	SalX ABC-type antimicrobial peptide transport syst	99.43
COG4172		534	ABC-type uncharacterized transport system, duplica	99.43
TIGR03375		694	type_I_sec_LssB type I secretion system ATPase, Ls	99.42
PRK10789		569	putative multidrug transporter membrane\ATP-bindin	99.42
TIGR03719		552	ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa	99.41
cd03231		201	ABC_CcmA_heme_exporter CcmA, the ATP-binding compo	99.41
PRK11819		556	putative ABC transporter ATP-binding protein; Revi	99.41
PRK11147		635	ABC transporter ATPase component; Reviewed	99.41
TIGR01846		694	type_I_sec_HlyB type I secretion system ABC transp	99.41
PRK11174		588	cysteine/glutathione ABC transporter membrane/ATP-	99.41
TIGR03796		710	NHPM_micro_ABC1 NHPM bacteriocin system ABC transp	99.41
COG0411		250	LivG ABC-type branched-chain amino acid transport	99.41
COG3638		258	ABC-type phosphate/phosphonate transport system, A	99.4
TIGR03797		686	NHPM_micro_ABC2 NHPM bacteriocin system ABC transp	99.4
PRK10636		638	putative ABC transporter ATP-binding protein; Prov	99.4
COG4987		573	CydC ABC-type transport system involved in cytochr	99.4
PRK13409		590	putative ATPase RIL; Provisional	99.4
PRK11176		582	lipid transporter ATP-binding/permease protein; Pr	99.4
TIGR03719		552	ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa	99.39
PRK10790		592	putative multidrug transporter membrane\ATP-bindin	99.39
PRK13539		207	cytochrome c biogenesis protein CcmA; Provisional	99.39
PRK11160		574	cysteine/glutathione ABC transporter membrane/ATP-	99.39
COG4172		534	ABC-type uncharacterized transport system, duplica	99.39
COG2274		709	SunT ABC-type bacteriocin/lantibiotic exporters, c	99.38
COG1132		567	MdlB ABC-type multidrug transport system, ATPase a	99.38
PRK13409		590	putative ATPase RIL; Provisional	99.38
COG1117		253	PstB ABC-type phosphate transport system, ATPase c	99.38
COG1129		500	MglA ABC-type sugar transport system, ATPase compo	99.38
PRK13657		588	cyclic beta-1,2-glucan ABC transporter; Provisiona	99.37
COG3839		338	MalK ABC-type sugar transport systems, ATPase comp	99.37
TIGR01193		708	bacteriocin_ABC ABC-type bacteriocin transporter.	99.37
COG3842		352	PotA ABC-type spermidine/putrescine transport syst	99.37
PLN03073		718	ABC transporter F family; Provisional	99.36
COG4608		268	AppF ABC-type oligopeptide transport system, ATPas	99.36
PRK10535		648	macrolide transporter ATP-binding /permease protei	99.36
PLN03073		718	ABC transporter F family; Provisional	99.36
TIGR01166		190	cbiO cobalt transport protein ATP-binding subunit.	99.35
COG4598		256	HisP ABC-type histidine transport system, ATPase c	99.35
TIGR01194		555	cyc_pep_trnsptr cyclic peptide transporter. This m	99.35
PRK11147		635	ABC transporter ATPase component; Reviewed	99.35
COG3845		501	ABC-type uncharacterized transport systems, ATPase	99.34
TIGR00958		711	3a01208 Conjugate Transporter-2 (CT2) Family prote	99.34
TIGR02204		576	MsbA_rel ABC transporter, permease/ATP-binding pro	99.33
COG4988		559	CydD ABC-type transport system involved in cytochr	99.33
PLN03140		1470	ABC transporter G family member; Provisional	99.32
TIGR02203		571	MsbA_lipidA lipid A export permease/ATP-binding pr	99.32
PRK10522		547	multidrug transporter membrane component/ATP-bindi	99.32
TIGR00956		1394	3a01205 Pleiotropic Drug Resistance (PDR) Family p	99.31
KOG0055\|consensus		1228		99.31
PRK00349		943	uvrA excinuclease ABC subunit A; Reviewed	99.3
TIGR00630		924	uvra excinuclease ABC, A subunit. This family is b	99.3
COG2884		223	FtsE Predicted ATPase involved in cell division [C	99.29
TIGR00956		1394	3a01205 Pleiotropic Drug Resistance (PDR) Family p	99.29
PRK00635		1809	excinuclease ABC subunit A; Provisional	99.28
PTZ00265		1466	multidrug resistance protein (mdr1); Provisional	99.28
TIGR01189		198	ccmA heme ABC exporter, ATP-binding protein CcmA.	99.27
COG0410		237	LivF ABC-type branched-chain amino acid transport	99.27
PRK00349		943	uvrA excinuclease ABC subunit A; Reviewed	99.26
PLN03140		1470	ABC transporter G family member; Provisional	99.26
cd03276		198	ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC protein	99.26
PRK13541		195	cytochrome c biogenesis protein CcmA; Provisional	99.25
PRK13540		200	cytochrome c biogenesis protein CcmA; Provisional	99.25
COG1119		257	ModF ABC-type molybdenum transport system, ATPase	99.25
cd03272		243	ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC protein	99.24
cd03278		197	ABC_SMC_barmotin Barmotin is a tight junction-asso	99.24
COG4559		259	ABC-type hemin transport system, ATPase component	99.23
PLN03232		1495	ABC transporter C family member; Provisional	99.23
COG4107		258	PhnK ABC-type phosphonate transport system, ATPase	99.23
TIGR00630		924	uvra excinuclease ABC, A subunit. This family is b	99.23
cd03240		204	ABC_Rad50 The catalytic domains of Rad50 are simil	99.22
PRK00635		1809	excinuclease ABC subunit A; Provisional	99.22
COG4148		352	ModC ABC-type molybdate transport system, ATPase c	99.21
cd03277		213	ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC protein	99.21
PLN03130		1622	ABC transporter C family member; Provisional	99.2
TIGR00957		1522	MRP_assoc_pro multi drug resistance-associated pro	99.2
cd03275		247	ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC protein	99.19
COG4525		259	TauB ABC-type taurine transport system, ATPase com	99.19
COG4161		242	ArtP ABC-type arginine transport system, ATPase co	99.19
cd03274		212	ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC protein	99.18
COG1134		249	TagH ABC-type polysaccharide/polyol phosphate tran	99.17
KOG0061\|consensus		613		99.16
PTZ00265		1466	multidrug resistance protein (mdr1); Provisional	99.16
TIGR01271		1490	CFTR_protein cystic fibrosis transmembrane conduct	99.15
cd03280		200	ABC_MutS2 MutS2 homologs in bacteria and eukaryote	99.15
TIGR01271		1490	CFTR_protein cystic fibrosis transmembrane conduct	99.14
PTZ00243		1560	ABC transporter; Provisional	99.13
TIGR00957		1522	MRP_assoc_pro multi drug resistance-associated pro	99.13
COG1101		263	PhnK ABC-type uncharacterized transport system, AT	99.12
TIGR02857		529	CydD thiol reductant ABC exporter, CydD subunit. U	99.12
PTZ00243		1560	ABC transporter; Provisional	99.11
TIGR00954		659	3a01203 Peroxysomal Fatty Acyl CoA Transporter (FA	99.1
cd03273		251	ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC protein	99.1
PLN03232		1495	ABC transporter C family member; Provisional	99.08
COG4674		249	Uncharacterized ABC-type transport system, ATPase	99.06
cd03239		178	ABC_SMC_head The structural maintenance of chromos	99.06
cd03241		276	ABC_RecN RecN ATPase involved in DNA repair; ABC (	99.06
COG0488		530	Uup ATPase components of ABC transporters with dup	99.05
PLN03130		1622	ABC transporter C family member; Provisional	99.03
KOG0058\|consensus		716		99.0
COG4181		228	Predicted ABC-type transport system involved in ly	99.0
KOG0057\|consensus		591		98.98
COG4604		252	CeuD ABC-type enterochelin transport system, ATPas	98.98
cd03227		162	ABC_Class2 ABC-type Class 2 contains systems invol	98.97
TIGR00618		1042	sbcc exonuclease SbcC. This family is based on the	98.93
KOG0055\|consensus		1228		98.92
COG4618		580	ArpD ABC-type protease/lipase transport system, AT	98.92
COG4138		248	BtuD ABC-type cobalamin transport system, ATPase c	98.91
COG3845		501	ABC-type uncharacterized transport systems, ATPase	98.91
COG4619		223	ABC-type uncharacterized transport system, ATPase	98.9
TIGR00634		563	recN DNA repair protein RecN. All proteins in this	98.9
COG0396		251	sufC Cysteine desulfurase activator ATPase [Posttr	98.9
KOG0927\|consensus		614		98.78
TIGR02868		529	CydC thiol reductant ABC exporter, CydC subunit. T	98.77
PRK03918		880	chromosome segregation protein; Provisional	98.77
cd03285		222	ABC_MSH2_euk MutS2 homolog in eukaryotes. The MutS	98.76
PHA02562		562	46 endonuclease subunit; Provisional	98.76
KOG0065\|consensus		1391		98.76
COG0488		530	Uup ATPase components of ABC transporters with dup	98.74
cd03243		202	ABC_MutS_homologs The MutS protein initiates DNA m	98.74
COG0178		935	UvrA Excinuclease ATPase subunit [DNA replication,	98.73
cd03242		270	ABC_RecF RecF is a recombinational DNA repair ATPa	98.72
PRK10869		553	recombination and repair protein; Provisional	98.71
cd03283		199	ABC_MutS-like MutS-like homolog in eukaryotes. The	98.67
COG5265		497	ATM1 ABC-type transport system involved in Fe-S cl	98.63
COG4170		330	SapD ABC-type antimicrobial peptide transport syst	98.62
TIGR00606		1311	rad50 rad50. This family is based on the phylogeno	98.6
PRK10246		1047	exonuclease subunit SbcC; Provisional	98.6
smart00534		185	MUTSac ATPase domain of DNA mismatch repair MUTS f	98.57
PRK01156		895	chromosome segregation protein; Provisional	98.57
KOG0062\|consensus		582		98.56
PRK00064		361	recF recombination protein F; Reviewed	98.54
COG4167		267	SapF ABC-type antimicrobial peptide transport syst	98.53
KOG0054\|consensus		1381		98.52
KOG0054\|consensus		1381		98.49
TIGR02168		1179	SMC_prok_B chromosome segregation protein SMC, com	98.48
cd03282		204	ABC_MSH4_euk MutS4 homolog in eukaryotes. The MutS	98.42
KOG0927\|consensus		614		98.4
KOG2355\|consensus		291		98.37
KOG0056\|consensus		790		98.35
KOG0062\|consensus		582		98.33
PRK02224		880	chromosome segregation protein; Provisional	98.32
COG0178		935	UvrA Excinuclease ATPase subunit [DNA replication,	98.29
COG4133		209	CcmA ABC-type transport system involved in cytochr	98.24
TIGR02169		1164	SMC_prok_A chromosome segregation protein SMC, pri	98.21
cd01124		187	KaiC KaiC is a circadian clock protein primarily f	98.19
PF13732		84	DUF4162: Domain of unknown function (DUF4162)	98.18
cd03284		216	ABC_MutS1 MutS1 homolog in eukaryotes. The MutS pr	98.15
TIGR00611		365	recf recF protein. All proteins in this family for	98.11
COG4136		213	ABC-type uncharacterized transport system, ATPase	98.11
COG4778		235	PhnL ABC-type phosphonate transport system, ATPase	98.1
cd03281		213	ABC_MSH5_euk MutS5 homolog in eukaryotes. The MutS	98.08
PRK00409		782	recombination and DNA strand exchange inhibitor pr	98.07
COG4615		546	PvdE ABC-type siderophore export system, fused ATP	98.05
COG1245		591	Predicted ATPase, RNase L inhibitor (RLI) homolog	98.01
PRK13830		818	conjugal transfer protein TrbE; Provisional	97.98
PRK14079		349	recF recombination protein F; Provisional	97.89
cd03286		218	ABC_MSH6_euk MutS6 homolog in eukaryotes. The MutS	97.85
TIGR02858		270	spore_III_AA stage III sporulation protein AA. Mem	97.78
PF13304		303	AAA_21: AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T	97.77
KOG0066\|consensus		807		97.73
TIGR01069		771	mutS2 MutS2 family protein. Function of MutS2 is u	97.72
PF02463		220	SMC_N: RecF/RecN/SMC N terminal domain; InterPro:	97.69
COG0419		908	SbcC ATPase involved in DNA repair [DNA replicatio	97.69
TIGR02680		1353	conserved hypothetical protein TIGR02680. Members	97.62
COG1245		591	Predicted ATPase, RNase L inhibitor (RLI) homolog	97.59
PRK13695		174	putative NTPase; Provisional	97.55
cd03287		222	ABC_MSH3_euk MutS3 homolog in eukaryotes. The MutS	97.53
KOG0065\|consensus		1391		97.45
PRK08533		230	flagellar accessory protein FlaH; Reviewed	97.43
COG4178		604	ABC-type uncharacterized transport system, permeas	97.38
KOG0066\|consensus		807		97.36
PRK07721		438	fliI flagellum-specific ATP synthase; Validated	97.24
PRK06067		234	flagellar accessory protein FlaH; Validated	97.13
PRK13891		852	conjugal transfer protein TrbE; Provisional	97.08
PTZ00132		215	GTP-binding nuclear protein Ran; Provisional	96.96
COG3910		233	Predicted ATPase [General function prediction only	96.7
PRK13873		811	conjugal transfer ATPase TrbE; Provisional	96.68
cd01120		165	RecA-like_NTPases RecA-like NTPases. This family i	96.6
TIGR03880		224	KaiC_arch_3 KaiC domain protein, AF_0351 family. T	96.36
PRK13898		800	type IV secretion system ATPase VirB4; Provisional	96.29
PF13558		90	SbcCD_C: Putative exonuclease SbcCD, C subunit; PD	96.04
KOG0059\|consensus		885		96.03
TIGR00152		188	dephospho-CoA kinase. This model produces scores i	96.01
PF13175		415	AAA_15: AAA ATPase domain	95.9
KOG0063\|consensus		592		95.85
KOG0060\|consensus		659		95.84
PRK05399		854	DNA mismatch repair protein MutS; Provisional	95.3
cd01125		239	repA Hexameric Replicative Helicase RepA. RepA is	95.24
COG2401		593	ABC-type ATPase fused to a predicted acetyltransfe	95.03
PRK08699		325	DNA polymerase III subunit delta'; Validated	95.0
COG4637		373	Predicted ATPase [General function prediction only	94.61
TIGR02788		308	VirB11 P-type DNA transfer ATPase VirB11. The VirB	94.45
KOG0063\|consensus		592		94.4
TIGR02655		484	circ_KaiC circadian clock protein KaiC. Members of	94.15
PRK14088		440	dnaA chromosomal replication initiation protein; P	93.73
PRK09302		509	circadian clock protein KaiC; Reviewed	93.72
TIGR03881		229	KaiC_arch_4 KaiC domain protein, PAE1156 family. M	93.55
COG3044		554	Predicted ATPase of the ABC class [General functio	92.61
PF00488		235	MutS_V: MutS domain V C-terminus.; InterPro: IPR00	92.34
KOG0962\|consensus		1294		91.87
PRK06793		432	fliI flagellum-specific ATP synthase; Validated	91.8
COG1195		363	RecF Recombinational DNA repair ATPase (RecF pathw	90.91
PRK06893		229	DNA replication initiation factor; Validated	90.56
cd01128		249	rho_factor Transcription termination factor rho is	90.27
TIGR00416		454	sms DNA repair protein RadA. The gene protuct code	90.14
TIGR01070		840	mutS1 DNA mismatch repair protein MutS.	89.92
PRK08181		269	transposase; Validated	89.8
PF13166		712	AAA_13: AAA domain	89.75
KOG0728\|consensus		404		89.5
PRK04296		190	thymidine kinase; Provisional	88.9
cd00561		159	CobA_CobO_BtuR ATP:corrinoid adenosyltransferase B	88.29
PRK13764		602	ATPase; Provisional	87.12
cd01131		198	PilT Pilus retraction ATPase PilT. PilT is a nucle	86.3
KOG0064\|consensus		728		85.92
PTZ00454		398	26S protease regulatory subunit 6B-like protein; P	85.85
TIGR01026		440	fliI_yscN ATPase FliI/YscN family. This family of	84.11
cd01122		271	GP4d_helicase GP4d_helicase is a homohexameric 5'-	82.93
PRK14087		450	dnaA chromosomal replication initiation protein; P	82.4
TIGR03185		650	DNA_S_dndD DNA sulfur modification protein DndD. T	81.95
PRK06921		266	hypothetical protein; Provisional	81.86
cd01121		372	Sms Sms (bacterial radA) DNA repair protein. This	81.82
TIGR00929		785	VirB4_CagE type IV secretion/conjugal transfer ATP	80.08

>KOG0059\|consensus	Back alignment and domain information

Probab=99.96  E-value=8.4e-29  Score=254.82  Aligned_cols=180  Identities=39%  Similarity=0.755  Sum_probs=156.8

Q ss_pred             chhhhHHHHHHhh-----CCCCCEEEEeCCCCCCCHHHHHHHHHHHHHHHhCCcEEEEEcCCHHHHHhhcCEEEEEeCCE
Q psy859           11 SPACILIQRQSWG-----IGDPPLVFLDEPTSGVDPISRHRLWAVLSQIQKTGQSIVLTSHSMDECEALCNRLTIMRGNE   85 (247)
Q Consensus        11 ~~~~~~~~r~~~~-----~~~P~lLiLDEPTsGLDp~~r~~i~~~l~~l~~~G~TIllsSH~l~e~e~l~drV~ii~~G~   85 (247)
                      +-.||.|+|+|+.     +++|++++|||||+|+||.+|+.+|+++.+++++|+.||+|||+|+|+|.            
T Consensus       696 ~~~ySgG~kRkLs~aialig~p~vi~LDEPstGmDP~arr~lW~ii~~~~k~g~aiiLTSHsMeE~Ea------------  763 (885)
T KOG0059|consen  696 VRTYSGGNKRRLSFAIALIGDPSVILLDEPSTGLDPKARRHLWDIIARLRKNGKAIILTSHSMEEAEA------------  763 (885)
T ss_pred             hhhCCCcchhhHHHHHHHhcCCCEEEecCCCCCCCHHHHHHHHHHHHHHHhcCCEEEEEcCCHHHHHH------------
Confidence            4568889988887     89999999999999999999999999999999888899999999999888            


Q ss_pred             EeeccccchhhhhhhhhhhcCCCCCCCChhHHHhHhhheeeeeCCeeeecCChHHHHHhhCCceEEEEEecCC-CHHHHH
Q psy859           86 LRKRRNCLSFRKEKMRLILTFPLCFPSSMDECEALCNRLTIMVRGEMQCLGNITYLKQRYGQGFTLMIKLREG-DLDQLK  164 (247)
Q Consensus        86 i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~lc~ri~i~~~G~~~~~Gt~~~L~~~~~~~~~~~l~~~~~-~~~~l~  164 (247)
                                                        ||||+|||++|+++|.|++++||.+||++|.+.+++.+. +.+.+.
T Consensus       764 ----------------------------------LCtR~aImv~G~l~ciGs~q~LKsrfG~gy~l~~~~~~~~~~~~v~  809 (885)
T KOG0059|consen  764 ----------------------------------LCTRTAIMVIGQLRCIGSPQELKSRYGSGYTLTVRIKELPEVSEVE  809 (885)
T ss_pred             ----------------------------------HhhhhheeecCeeEEecChHHHHhhcCCcEEEEEEECCCcccchHH
Confidence                                              899999999999999999999999999999999998652 224677


Q ss_pred             HHHHhhccCceEEeeecCCEEEEEEcCC-CcCHHHHHHHHHHhhcCCCcccEEEecCCCHHHHHHHHHhcCCCCC
Q psy859          165 ERIRTEFKGRVEIKDEHKGLIHYQILDT-TFSWSVLFAKMEAVKTSMDIVEDYSLSDTTLEQVFIAFAKGRGQRH  238 (247)
Q Consensus       165 ~~l~~~~~~~~~~~~~~~~~~~~~i~~~-~~~~~~l~~~l~~~~~~~~~i~~~~~~~~sLEdvFl~~~~~~~~~~  238 (247)
                      ..+...+| .+.....+...+.+.++.. ...++.+|..++..+...+ +++|++++++|||||+++++......
T Consensus       810 ~~~~~~~p-~a~~~~~~~~~~~~~ip~~~~~~~~~vF~~le~~~~~~~-i~dyslsq~tLe~VFi~~a~~q~~~~  882 (885)
T KOG0059|consen  810 KLLQNRFP-GAVLKERHAGLLAFEIPKDEVVSLSEVFLALEKAKESFG-IEDYSLSQTTLEDVFLILAKTQEDDN  882 (885)
T ss_pred             HHHHHhCC-CcchhhhhhceEEEEcccchhhHHHHHHHHHHHHHHhcC-HHHHHHHHhhHHHHHHHHhccccccc
Confidence            77888899 6666666677788999844 4557789999999988888 99999999999999999998765543

>TIGR01257 rim_protein retinal-specific rim ABC transporter	Back alignment and domain information

>TIGR01257 rim_protein retinal-specific rim ABC transporter	Back alignment and domain information

>COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only]	Back alignment and domain information

>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit	Back alignment and domain information

>PRK13537 nodulation ABC transporter NodI; Provisional	Back alignment and domain information

>PRK13536 nodulation factor exporter subunit NodI; Provisional	Back alignment and domain information

>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA	Back alignment and domain information

>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms]	Back alignment and domain information

>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI	Back alignment and domain information

>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism]	Back alignment and domain information

>COG4586 ABC-type uncharacterized transport system, ATPase component [General function prediction only]	Back alignment and domain information

>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota	Back alignment and domain information

>PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed	Back alignment and domain information

>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine	Back alignment and domain information

>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules	Back alignment and domain information

>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system	Back alignment and domain information

>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein	Back alignment and domain information

>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import	Back alignment and domain information

>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup	Back alignment and domain information

>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids	Back alignment and domain information

>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport	Back alignment and domain information

>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids	Back alignment and domain information

>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional	Back alignment and domain information

>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance	Back alignment and domain information

>PRK13651 cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein	Back alignment and domain information

>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin	Back alignment and domain information

>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota	Back alignment and domain information

>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>TIGR01978 sufC FeS assembly ATPase SufC	Back alignment and domain information

>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively	Back alignment and domain information

>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed	Back alignment and domain information

>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein	Back alignment and domain information

>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE)	Back alignment and domain information

>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea	Back alignment and domain information

>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos)	Back alignment and domain information

>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD	Back alignment and domain information

>TIGR02673 FtsE cell division ATP-binding protein FtsE	Back alignment and domain information

>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB	Back alignment and domain information

>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos)	Back alignment and domain information

>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE	Back alignment and domain information

>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional	Back alignment and domain information

>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D	Back alignment and domain information

>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively	Back alignment and domain information

>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient	Back alignment and domain information

>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake	Back alignment and domain information

>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional	Back alignment and domain information

>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT	Back alignment and domain information

>PRK10908 cell division protein FtsE; Provisional	Back alignment and domain information

>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK	Back alignment and domain information

>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE)	Back alignment and domain information

>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism]	Back alignment and domain information

>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP	Back alignment and domain information

>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD	Back alignment and domain information

>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional	Back alignment and domain information

>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR01187 potA spermidine/putrescine ABC transporter ATP-binding subunit	Back alignment and domain information

>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit	Back alignment and domain information

>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional	Back alignment and domain information

>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment	Back alignment and domain information

>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14242 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters	Back alignment and domain information

>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane	Back alignment and domain information

>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity	Back alignment and domain information

>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit	Back alignment and domain information

>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system	Back alignment and domain information

>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism]	Back alignment and domain information

>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional	Back alignment and domain information

>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein	Back alignment and domain information

>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional	Back alignment and domain information

>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1	Back alignment and domain information

>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE	Back alignment and domain information

>PRK11124 artP arginine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional	Back alignment and domain information

>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional	Back alignment and domain information

>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein	Back alignment and domain information

>PRK10851 sulfate/thiosulfate transporter subunit; Provisional	Back alignment and domain information

>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional	Back alignment and domain information

>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds	Back alignment and domain information

>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein	Back alignment and domain information

>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export	Back alignment and domain information

>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein	Back alignment and domain information

>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14241 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional	Back alignment and domain information

>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain	Back alignment and domain information

>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein	Back alignment and domain information

>PRK03695 vitamin B12-transporter ATPase; Provisional	Back alignment and domain information

>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit	Back alignment and domain information

>PRK14239 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK13633 cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK11144 modC molybdate transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK	Back alignment and domain information

>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed	Back alignment and domain information

>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein	Back alignment and domain information

>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional	Back alignment and domain information

>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only]	Back alignment and domain information

>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity	Back alignment and domain information

>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein	Back alignment and domain information

>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins	Back alignment and domain information

>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E	Back alignment and domain information

>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein	Back alignment and domain information

>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D	Back alignment and domain information

>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea	Back alignment and domain information

>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component	Back alignment and domain information

>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional	Back alignment and domain information

>PRK14240 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein	Back alignment and domain information

>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism]	Back alignment and domain information

>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component	Back alignment and domain information

>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein	Back alignment and domain information

>CHL00131 ycf16 sulfate ABC transporter protein; Validated	Back alignment and domain information

>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake	Back alignment and domain information

>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK13549 xylose transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional	Back alignment and domain information

>COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional	Back alignment and domain information

>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14235 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment	Back alignment and domain information

>PRK14243 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK13549 xylose transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03299 ABC_ModC_like Archeal protein closely related to ModC	Back alignment and domain information

>PRK14258 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK10762 D-ribose transporter ATP binding protein; Provisional	Back alignment and domain information

>PRK09700 D-allose transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2	Back alignment and domain information

>PRK14238 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional	Back alignment and domain information

>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR)	Back alignment and domain information

>PRK14236 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors	Back alignment and domain information

>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional	Back alignment and domain information

>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria	Back alignment and domain information

>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional	Back alignment and domain information

>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein	Back alignment and domain information

>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK14275 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK10762 D-ribose transporter ATP binding protein; Provisional	Back alignment and domain information

>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional	Back alignment and domain information

>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed	Back alignment and domain information

>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional	Back alignment and domain information

>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional	Back alignment and domain information

>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters	Back alignment and domain information

>PRK15056 manganese/iron transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional	Back alignment and domain information

>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism]	Back alignment and domain information

>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters	Back alignment and domain information

>PRK10261 glutathione transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein	Back alignment and domain information

>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK10261 glutathione transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK09700 D-allose transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional	Back alignment and domain information

>PRK14263 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2	Back alignment and domain information

>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export	Back alignment and domain information

>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional	Back alignment and domain information

>PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional	Back alignment and domain information

>PRK14237 phosphate transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis	Back alignment and domain information

>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion	Back alignment and domain information

>PRK14246 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14266 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed	Back alignment and domain information

>PRK14252 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK14257 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1)	Back alignment and domain information

>cd03270 ABC_UvrA_I The excision repair protein UvrA domain I; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion	Back alignment and domain information

>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional	Back alignment and domain information

>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules	Back alignment and domain information

>PRK14254 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters	Back alignment and domain information

>cd03288 ABCC_SUR2 The SUR domain 2	Back alignment and domain information

>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2	Back alignment and domain information

>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C	Back alignment and domain information

>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor	Back alignment and domain information

>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth	Back alignment and domain information

>PRK14264 phosphate ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids	Back alignment and domain information

>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family	Back alignment and domain information

>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules	Back alignment and domain information

>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only]	Back alignment and domain information

>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK13543 cytochrome c biogenesis protein CcmA; Provisional	Back alignment and domain information

>PLN03211 ABC transporter G-25; Provisional	Back alignment and domain information

>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional	Back alignment and domain information

>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL	Back alignment and domain information

>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism]	Back alignment and domain information

>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group	Back alignment and domain information

>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>PRK15064 ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C	Back alignment and domain information

>COG1137 YhbG ABC-type (unclassified) transport system, ATPase component [General function prediction only]	Back alignment and domain information

>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional	Back alignment and domain information

>cd03290 ABCC_SUR1_N The SUR domain 1	Back alignment and domain information

>PRK15064 ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>cd03291 ABCC_CFTR1 The CFTR subfamily domain 1	Back alignment and domain information

>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor	Back alignment and domain information

>TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family	Back alignment and domain information

>PRK10636 putative ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>PRK11819 putative ABC transporter ATP-binding protein; Reviewed	Back alignment and domain information

>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism]	Back alignment and domain information

>TIGR00955 3a01204 The Eye Pigment Precursor Transporter (EPP) Family protein	Back alignment and domain information

>cd03271 ABC_UvrA_II The excision repair protein UvrA domain II; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion	Back alignment and domain information

>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome	Back alignment and domain information

>TIGR01192 chvA glucan exporter ATP-binding protein	Back alignment and domain information

>PRK13538 cytochrome c biogenesis protein CcmA; Provisional	Back alignment and domain information

>cd03279 ABC_sbcCD SbcCD and other Mre11/Rad50 (MR) complexes are implicated in the metabolism of DNA ends	Back alignment and domain information

>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms]	Back alignment and domain information

>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only]	Back alignment and domain information

>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family	Back alignment and domain information

>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional	Back alignment and domain information

>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family	Back alignment and domain information

>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter	Back alignment and domain information

>PRK11819 putative ABC transporter ATP-binding protein; Reviewed	Back alignment and domain information

>PRK11147 ABC transporter ATPase component; Reviewed	Back alignment and domain information

>TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family	Back alignment and domain information

>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed	Back alignment and domain information

>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein	Back alignment and domain information

>COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein	Back alignment and domain information

>PRK10636 putative ABC transporter ATP-binding protein; Provisional	Back alignment and domain information

>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PRK13409 putative ATPase RIL; Provisional	Back alignment and domain information

>PRK11176 lipid transporter ATP-binding/permease protein; Provisional	Back alignment and domain information

>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family	Back alignment and domain information

>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional	Back alignment and domain information

>PRK13539 cytochrome c biogenesis protein CcmA; Provisional	Back alignment and domain information

>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed	Back alignment and domain information

>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only]	Back alignment and domain information

>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms]	Back alignment and domain information

>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms]	Back alignment and domain information

>PRK13409 putative ATPase RIL; Provisional	Back alignment and domain information

>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism]	Back alignment and domain information

>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional	Back alignment and domain information

>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism]	Back alignment and domain information

>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter	Back alignment and domain information

>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism]	Back alignment and domain information

>PLN03073 ABC transporter F family; Provisional	Back alignment and domain information

>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>PRK10535 macrolide transporter ATP-binding /permease protein; Provisional	Back alignment and domain information

>PLN03073 ABC transporter F family; Provisional	Back alignment and domain information

>TIGR01166 cbiO cobalt transport protein ATP-binding subunit	Back alignment and domain information

>COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>TIGR01194 cyc_pep_trnsptr cyclic peptide transporter	Back alignment and domain information

>PRK11147 ABC transporter ATPase component; Reviewed	Back alignment and domain information

>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only]	Back alignment and domain information

>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein	Back alignment and domain information

>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein	Back alignment and domain information

>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PLN03140 ABC transporter G family member; Provisional	Back alignment and domain information

>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA	Back alignment and domain information

>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional	Back alignment and domain information

>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein	Back alignment and domain information

>KOG0055\|consensus	Back alignment and domain information

>PRK00349 uvrA excinuclease ABC subunit A; Reviewed	Back alignment and domain information

>TIGR00630 uvra excinuclease ABC, A subunit	Back alignment and domain information

>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning]	Back alignment and domain information

>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein	Back alignment and domain information

>PRK00635 excinuclease ABC subunit A; Provisional	Back alignment and domain information

>PTZ00265 multidrug resistance protein (mdr1); Provisional	Back alignment and domain information

>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA	Back alignment and domain information

>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>PRK00349 uvrA excinuclease ABC subunit A; Reviewed	Back alignment and domain information

>PLN03140 ABC transporter G family member; Provisional	Back alignment and domain information

>cd03276 ABC_SMC6_euk Eukaryotic SMC6 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains	Back alignment and domain information

>PRK13541 cytochrome c biogenesis protein CcmA; Provisional	Back alignment and domain information

>PRK13540 cytochrome c biogenesis protein CcmA; Provisional	Back alignment and domain information

>COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism]	Back alignment and domain information

>cd03272 ABC_SMC3_euk Eukaryotic SMC3 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains	Back alignment and domain information

>cd03278 ABC_SMC_barmotin Barmotin is a tight junction-associated protein expressed in rat epithelial cells which is thought to have an important regulatory role in tight junction barrier function	Back alignment and domain information

>COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>PLN03232 ABC transporter C family member; Provisional	Back alignment and domain information

>COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>TIGR00630 uvra excinuclease ABC, A subunit	Back alignment and domain information

>cd03240 ABC_Rad50 The catalytic domains of Rad50 are similar to the ATP-binding cassette of ABC transporters, but are not associated with membrane-spanning domains	Back alignment and domain information

>PRK00635 excinuclease ABC subunit A; Provisional	Back alignment and domain information

>COG4148 ModC ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>cd03277 ABC_SMC5_euk Eukaryotic SMC5 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains	Back alignment and domain information

>PLN03130 ABC transporter C family member; Provisional	Back alignment and domain information

>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP)	Back alignment and domain information

>cd03275 ABC_SMC1_euk Eukaryotic SMC1 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains	Back alignment and domain information

>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>COG4161 ArtP ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism]	Back alignment and domain information

>cd03274 ABC_SMC4_euk Eukaryotic SMC4 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains	Back alignment and domain information

>COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane]	Back alignment and domain information

>KOG0061\|consensus	Back alignment and domain information

>PTZ00265 multidrug resistance protein (mdr1); Provisional	Back alignment and domain information

>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR)	Back alignment and domain information

>cd03280 ABC_MutS2 MutS2 homologs in bacteria and eukaryotes	Back alignment and domain information

>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR)	Back alignment and domain information

>PTZ00243 ABC transporter; Provisional	Back alignment and domain information

>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP)	Back alignment and domain information

>COG1101 PhnK ABC-type uncharacterized transport system, ATPase component [General function prediction only]	Back alignment and domain information

>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit	Back alignment and domain information

>PTZ00243 ABC transporter; Provisional	Back alignment and domain information

>TIGR00954 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei	Back alignment and domain information

>cd03273 ABC_SMC2_euk Eukaryotic SMC2 proteins; SMC proteins are large (approximately 110 to 170 kDa), and each is arranged into five recognizable domains	Back alignment and domain information

>PLN03232 ABC transporter C family member; Provisional	Back alignment and domain information

>COG4674 Uncharacterized ABC-type transport system, ATPase component [General function prediction only]	Back alignment and domain information

>cd03239 ABC_SMC_head The structural maintenance of chromosomes (SMC) proteins are essential for successful chromosome transmission during replication and segregation of the genome in all organisms	Back alignment and domain information

>cd03241 ABC_RecN RecN ATPase involved in DNA repair; ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds including sugars, ions, peptides, and more complex organic molecules	Back alignment and domain information

>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only]	Back alignment and domain information

>PLN03130 ABC transporter C family member; Provisional	Back alignment and domain information

>KOG0058\|consensus	Back alignment and domain information

>COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism]	Back alignment and domain information

>KOG0057\|consensus	Back alignment and domain information

>COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>cd03227 ABC_Class2 ABC-type Class 2 contains systems involved in cellular processes other than transport	Back alignment and domain information

>TIGR00618 sbcc exonuclease SbcC	Back alignment and domain information

>KOG0055\|consensus	Back alignment and domain information

>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only]	Back alignment and domain information

>COG4138 BtuD ABC-type cobalamin transport system, ATPase component [Coenzyme metabolism]	Back alignment and domain information

>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only]	Back alignment and domain information

>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only]	Back alignment and domain information

>TIGR00634 recN DNA repair protein RecN	Back alignment and domain information

>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>KOG0927\|consensus	Back alignment and domain information

>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit	Back alignment and domain information

>PRK03918 chromosome segregation protein; Provisional	Back alignment and domain information

>cd03285 ABC_MSH2_euk MutS2 homolog in eukaryotes	Back alignment and domain information

>PHA02562 46 endonuclease subunit; Provisional	Back alignment and domain information

>KOG0065\|consensus	Back alignment and domain information

>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only]	Back alignment and domain information

>cd03243 ABC_MutS_homologs The MutS protein initiates DNA mismatch repair by recognizing mispaired and unpaired bases embedded in duplex DNA and activating endo- and exonucleases to remove the mismatch	Back alignment and domain information

>COG0178 UvrA Excinuclease ATPase subunit [DNA replication, recombination, and repair]	Back alignment and domain information

>cd03242 ABC_RecF RecF is a recombinational DNA repair ATPase that maintains replication in the presence of DNA damage	Back alignment and domain information

>PRK10869 recombination and repair protein; Provisional	Back alignment and domain information

>cd03283 ABC_MutS-like MutS-like homolog in eukaryotes	Back alignment and domain information

>COG5265 ATM1 ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>COG4170 SapD ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms]	Back alignment and domain information

>TIGR00606 rad50 rad50	Back alignment and domain information

>PRK10246 exonuclease subunit SbcC; Provisional	Back alignment and domain information

>smart00534 MUTSac ATPase domain of DNA mismatch repair MUTS family	Back alignment and domain information

>PRK01156 chromosome segregation protein; Provisional	Back alignment and domain information

>KOG0062\|consensus	Back alignment and domain information

>PRK00064 recF recombination protein F; Reviewed	Back alignment and domain information

>COG4167 SapF ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms]	Back alignment and domain information

>KOG0054\|consensus	Back alignment and domain information

>KOG0054\|consensus	Back alignment and domain information

>TIGR02168 SMC_prok_B chromosome segregation protein SMC, common bacterial type	Back alignment and domain information

>cd03282 ABC_MSH4_euk MutS4 homolog in eukaryotes	Back alignment and domain information

>KOG0927\|consensus	Back alignment and domain information

>KOG2355\|consensus	Back alignment and domain information

>KOG0056\|consensus	Back alignment and domain information

>KOG0062\|consensus	Back alignment and domain information

>PRK02224 chromosome segregation protein; Provisional	Back alignment and domain information

>COG0178 UvrA Excinuclease ATPase subunit [DNA replication, recombination, and repair]	Back alignment and domain information

>COG4133 CcmA ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>TIGR02169 SMC_prok_A chromosome segregation protein SMC, primarily archaeal type	Back alignment and domain information

>cd01124 KaiC KaiC is a circadian clock protein primarily found in cyanobacteria KaiC is a RecA-like ATPase, having both Walker A and Walker B motifs	Back alignment and domain information

>PF13732 DUF4162: Domain of unknown function (DUF4162)	Back alignment and domain information

>cd03284 ABC_MutS1 MutS1 homolog in eukaryotes	Back alignment and domain information

>TIGR00611 recf recF protein	Back alignment and domain information

>COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only]	Back alignment and domain information

>COG4778 PhnL ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism]	Back alignment and domain information

>cd03281 ABC_MSH5_euk MutS5 homolog in eukaryotes	Back alignment and domain information

>PRK00409 recombination and DNA strand exchange inhibitor protein; Reviewed	Back alignment and domain information

>COG4615 PvdE ABC-type siderophore export system, fused ATPase and permease components [Secondary metabolites biosynthesis, transport, and catabolism / Inorganic ion transport and metabolism]	Back alignment and domain information

>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only]	Back alignment and domain information

>PRK13830 conjugal transfer protein TrbE; Provisional	Back alignment and domain information

>PRK14079 recF recombination protein F; Provisional	Back alignment and domain information

>cd03286 ABC_MSH6_euk MutS6 homolog in eukaryotes	Back alignment and domain information

>TIGR02858 spore_III_AA stage III sporulation protein AA	Back alignment and domain information

>PF13304 AAA_21: AAA domain; PDB: 3QKS_B 1US8_B 1F2U_B 1F2T_B 3QKT_A 1II8_B 3QKR_B 3QKU_A	Back alignment and domain information

>KOG0066\|consensus	Back alignment and domain information

>TIGR01069 mutS2 MutS2 family protein	Back alignment and domain information

>PF02463 SMC_N: RecF/RecN/SMC N terminal domain; InterPro: IPR003395 This domain is found at the N terminus of structural maintenance of chromosomes (SMC) proteins, which function together with other proteins in a range of chromosomal transactions, including chromosome condensation, sister-chromatid cohesion, recombination, DNA repair and epigenetic silencing of gene expression []	Back alignment and domain information

>COG0419 SbcC ATPase involved in DNA repair [DNA replication, recombination, and repair]	Back alignment and domain information

>TIGR02680 conserved hypothetical protein TIGR02680	Back alignment and domain information

>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only]	Back alignment and domain information

>PRK13695 putative NTPase; Provisional	Back alignment and domain information

>cd03287 ABC_MSH3_euk MutS3 homolog in eukaryotes	Back alignment and domain information

>KOG0065\|consensus	Back alignment and domain information

>PRK08533 flagellar accessory protein FlaH; Reviewed	Back alignment and domain information

>COG4178 ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only]	Back alignment and domain information

>KOG0066\|consensus	Back alignment and domain information

>PRK07721 fliI flagellum-specific ATP synthase; Validated	Back alignment and domain information

>PRK06067 flagellar accessory protein FlaH; Validated	Back alignment and domain information

>PRK13891 conjugal transfer protein TrbE; Provisional	Back alignment and domain information

>PTZ00132 GTP-binding nuclear protein Ran; Provisional	Back alignment and domain information

>COG3910 Predicted ATPase [General function prediction only]	Back alignment and domain information

>PRK13873 conjugal transfer ATPase TrbE; Provisional	Back alignment and domain information

>cd01120 RecA-like_NTPases RecA-like NTPases	Back alignment and domain information

>TIGR03880 KaiC_arch_3 KaiC domain protein, AF_0351 family	Back alignment and domain information

>PRK13898 type IV secretion system ATPase VirB4; Provisional	Back alignment and domain information

>PF13558 SbcCD_C: Putative exonuclease SbcCD, C subunit; PDB: 3QG5_B 3QF7_A 3THO_A 3EUK_H 3EUJ_A 3AV0_B 3AUY_B 3AUX_A	Back alignment and domain information

>KOG0059\|consensus	Back alignment and domain information

>TIGR00152 dephospho-CoA kinase	Back alignment and domain information

>PF13175 AAA_15: AAA ATPase domain	Back alignment and domain information

>KOG0063\|consensus	Back alignment and domain information

>KOG0060\|consensus	Back alignment and domain information

>PRK05399 DNA mismatch repair protein MutS; Provisional	Back alignment and domain information

>cd01125 repA Hexameric Replicative Helicase RepA	Back alignment and domain information

>COG2401 ABC-type ATPase fused to a predicted acetyltransferase domain [General function prediction only]	Back alignment and domain information

>PRK08699 DNA polymerase III subunit delta'; Validated	Back alignment and domain information

>COG4637 Predicted ATPase [General function prediction only]	Back alignment and domain information

>TIGR02788 VirB11 P-type DNA transfer ATPase VirB11	Back alignment and domain information

>KOG0063\|consensus	Back alignment and domain information

>TIGR02655 circ_KaiC circadian clock protein KaiC	Back alignment and domain information

>PRK14088 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>PRK09302 circadian clock protein KaiC; Reviewed	Back alignment and domain information

>TIGR03881 KaiC_arch_4 KaiC domain protein, PAE1156 family	Back alignment and domain information

>COG3044 Predicted ATPase of the ABC class [General function prediction only]	Back alignment and domain information

>PF00488 MutS_V: MutS domain V C-terminus	Back alignment and domain information

>KOG0962\|consensus	Back alignment and domain information

>PRK06793 fliI flagellum-specific ATP synthase; Validated	Back alignment and domain information

>COG1195 RecF Recombinational DNA repair ATPase (RecF pathway) [DNA replication, recombination, and repair]	Back alignment and domain information

>PRK06893 DNA replication initiation factor; Validated	Back alignment and domain information

>cd01128 rho_factor Transcription termination factor rho is a bacterial ATP-dependent RNA/DNA helicase	Back alignment and domain information

>TIGR00416 sms DNA repair protein RadA	Back alignment and domain information

>TIGR01070 mutS1 DNA mismatch repair protein MutS	Back alignment and domain information

>PRK08181 transposase; Validated	Back alignment and domain information

>PF13166 AAA_13: AAA domain	Back alignment and domain information

>KOG0728\|consensus	Back alignment and domain information

>PRK04296 thymidine kinase; Provisional	Back alignment and domain information

>cd00561 CobA_CobO_BtuR ATP:corrinoid adenosyltransferase BtuR/CobO/CobP	Back alignment and domain information

>PRK13764 ATPase; Provisional	Back alignment and domain information

>cd01131 PilT Pilus retraction ATPase PilT	Back alignment and domain information

>KOG0064\|consensus	Back alignment and domain information

>PTZ00454 26S protease regulatory subunit 6B-like protein; Provisional	Back alignment and domain information

>TIGR01026 fliI_yscN ATPase FliI/YscN family	Back alignment and domain information

>cd01122 GP4d_helicase GP4d_helicase is a homohexameric 5'-3' helicases	Back alignment and domain information

>PRK14087 dnaA chromosomal replication initiation protein; Provisional	Back alignment and domain information

>TIGR03185 DNA_S_dndD DNA sulfur modification protein DndD	Back alignment and domain information

>PRK06921 hypothetical protein; Provisional	Back alignment and domain information

>cd01121 Sms Sms (bacterial radA) DNA repair protein	Back alignment and domain information

>TIGR00929 VirB4_CagE type IV secretion/conjugal transfer ATPase, VirB4 family	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		247
1vpl_A		256	Crystal Structure Of Abc Transporter Atp-binding Pr		1e-07
3gfo_A		275	Structure Of Cbio1 From Clostridium Perfringens: Pa		3e-05
3c41_J		242	Abc Protein Artp In Complex With Amp-PnpMG2+ Length		3e-04
2olj_A		263	Abc Protein Artp In Complex With AdpMG2+ Length = 2		4e-04
2it1_A		362	Structure Of Ph0203 Protein From Pyrococcus Horikos		6e-04

>pdb|1VPL|A Chain A, Crystal Structure Of Abc Transporter Atp-binding Protein (tm0544) From Thermotoga Maritima At 2.10 A Resolution Length = 256