Psyllid ID: psy8603

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180----
AVVQKYLLEKSRICSQGRGERNYHVFYYLLAGASDQDRHSLHLKKIESYHYLNRIELELPSFPGASNETLLQKFNTVHRDNPFYEIPQRRENAFIVKHYAGKVKYQSGPYTLDNGGPERNVEFVPRKSAYHHDESVTVRNTEVVVLISELLRVKKETLLAALTAKHARASDETLVINYRLPEVL
cEEEEEEcccccccccccccccHHHHHHHHccccHHHHHHcccccccccccccccccccccccccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHcccEEEEEHHHHHcccccccccEEEEEccccccccccEEEccHHHHHHHHHHccccHHHHHHHHHHcEEEEccEEEEEcccHHHcc
ccHHHEHHHccEEEEEccccccHHHHHHHHccccHHHHHHcccccHcHEEEEcccccccccccccccccccEEEcccccHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccEEEEcccEEcccccccccccccccccHHHHHHHHHHHcccHHHHHHHHHccEEEEcccEEEEcccHHHcc
AVVQKYLLEKSricsqgrgernYHVFYYLLAgasdqdrhslHLKKIESYHYLNRIelelpsfpgasnetLLQKFNtvhrdnpfyeipqrRENAFIVKHYAGkvkyqsgpytldnggpernvefvprksayhhdesvtvRNTEVVVLISELLRVKKETLLAALTAKharasdetLVINYRLPEVL
avvqkylleksricsqgrgerNYHVFYYLLAGASDQDRHSLHLKKIESYHYLNRIELELPSFPGASNETLLQKFNTVHRDNPFYEIPQRRENAFIVKHYAGKVKYQSGPYTLDNGGPERNVEFVPRKsayhhdesvtvrntEVVVLISELLRVKKETLLAALtakharasdetlvinyrlpevl
AVVQKYLLEKSRICSQGRGERNYHVFYYLLAGASDQDRHSLHLKKIESYHYLNRIELELPSFPGASNETLLQKFNTVHRDNPFYEIPQRRENAFIVKHYAGKVKYQSGPYTLDNGGPERNVEFVPRKSAYHHDESVTVRNTEVVVLISELLRVKKETLLAALTAKHARASDETLVINYRLPEVL
*****YLLEKSRICSQGRGERNYHVFYYLLAGASDQDRHSLHLKKIESYHYLNRIELELPSFPGASNETLLQKFNTVHRDNPFYEIPQRRENAFIVKHYAGKVKYQSGPYTLDNG****NVEFVPRKSAYHHDESVTVRNTEVVVLISELLRVKKETLLAALTAKHARASDETLVINYR*****
AVVQKYLLEKSRICSQGRGERNYHVFYYLLAGASDQDRHSLHLKKIESYHYLNRIELELPSFPGASNETLLQKFNTVHRDNPFYEIPQRRENAFIVKHYAGKVKYQSGPYTLDNGGPERNVEFVPR************RNTEVVVLISELLRVKKETLLAALTAKHARASDETLVINYRLPE**
AVVQKYLLEKSRICSQGRGERNYHVFYYLLAGASDQDRHSLHLKKIESYHYLNRIELELPSFPGASNETLLQKFNTVHRDNPFYEIPQRRENAFIVKHYAGKVKYQSGPYTLDNGGPERNVEFVPRKSAYHHDESVTVRNTEVVVLISELLRVKKETLLAALTAKHARASDETLVINYRLPEVL
AVVQKYLLEKSRICSQGRGERNYHVFYYLLAGASDQDRHSLHLKKIESYHYLNRIELELPSFPGASNETLLQKFNTVHRDNPFYEIPQRRENAFIVKHYAGKVKYQSGPYTLDNGGPERNVEFVPR*SAY*HDESVTVRNTEVVVLISELLRVKKETLLAALTAKHARASDETLVINYRLP***
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
AVVQKYLLEKSRICSQGRGERNYHVFYYLLAGASDQDRHSLHLKKIESYHYLNRIELELPSFPGASNETLLQKFNTVHRDNPFYEIPQRRENAFIVKHYAGKVKYQSGPYTLDNGGPERNVEFVPRKSAYHHDESVTVRNTEVVVLISELLRVKKETLLAALTAKHARASDETLVINYRLPEVL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query184 2.2.26 [Sep-21-2011]
B2RTY4 2548 Unconventional myosin-IXa yes N/A 0.902 0.065 0.338 2e-19
Q8C170 2542 Unconventional myosin-IXa no N/A 0.902 0.065 0.333 5e-19
Q9Z1N3 2626 Unconventional myosin-IXa yes N/A 0.902 0.063 0.333 5e-19
Q63358 1980 Unconventional myosin-IXb no N/A 0.864 0.080 0.345 6e-19
Q9QY06 2114 Unconventional myosin-IXb no N/A 0.864 0.075 0.345 1e-18
Q13459 2157 Unconventional myosin-IXb no N/A 0.864 0.073 0.340 2e-18
Q9UM54 1294 Unconventional myosin-VI no N/A 0.293 0.041 0.592 6e-12
Q29122 1254 Unconventional myosin-VI no N/A 0.293 0.043 0.592 9e-12
P08799 2116 Myosin-2 heavy chain OS=D yes N/A 0.282 0.024 0.555 2e-11
Q64331 1265 Unconventional myosin-VI no N/A 0.282 0.041 0.596 3e-11
>sp|B2RTY4|MYO9A_HUMAN Unconventional myosin-IXa OS=Homo sapiens GN=MYO9A PE=1 SV=2 Back     alignment and function desciption
 Score = 95.5 bits (236), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 67/198 (33%), Positives = 100/198 (50%), Gaps = 32/198 (16%)

Query: 1   AVVQKYLLEKSRICSQGRGERNYHVFYYLLAGASDQDRHSLHLKKIESYHYLNRIELELP 60
           A V+KYLLEKSR+  Q   ERNYHVFYYLLAGAS+ +R + HLK+ E YHYLN+I     
Sbjct: 313 AYVEKYLLEKSRLVYQEHNERNYHVFYYLLAGASEDERSAFHLKQPEEYHYLNQI----- 367

Query: 61  SFPGASNETLLQKFNTVHRDNPFYEIPQRRENAFIVKHYAGKVKYQSGPYTLDNGG--PE 118
                + + L Q ++    D+          + F V+    +  ++     ++  G  P+
Sbjct: 368 -----TKKPLRQSWDDYCYDS--------EPDCFTVEGEDLRHDFERLQLAMEMVGFLPK 414

Query: 119 RNVEFVPRKSAYHH------------DESVTVRNTEVVVLISELLRVKKETLLAALTAKH 166
              +     SA  H            D+S+ + N EV+ ++SELL VK+E L  AL  + 
Sbjct: 415 TRRQIFSLLSAILHLGNICYKKKTYRDDSIDICNPEVLPIVSELLEVKEEMLFEALVTRK 474

Query: 167 ARASDETLVINYRLPEVL 184
                E L++ Y+L E +
Sbjct: 475 TVTVGEKLILPYKLAEAV 492
Myosins are actin-based motor molecules with ATPase activity. Unconventional myosins serve in intracellular movements. Regulates Rho activity in neurons, has a role in the regulation of neuronal morphology and function.
Homo sapiens (taxid: 9606)
>sp|Q8C170|MYO9A_MOUSE Unconventional myosin-IXa OS=Mus musculus GN=Myo9a PE=1 SV=2 Back     alignment and function description
>sp|Q9Z1N3|MYO9A_RAT Unconventional myosin-IXa OS=Rattus norvegicus GN=Myo9a PE=1 SV=1 Back     alignment and function description
>sp|Q63358|MYO9B_RAT Unconventional myosin-IXb OS=Rattus norvegicus GN=Myo9b PE=1 SV=1 Back     alignment and function description
>sp|Q9QY06|MYO9B_MOUSE Unconventional myosin-IXb OS=Mus musculus GN=Myo9b PE=1 SV=2 Back     alignment and function description
>sp|Q13459|MYO9B_HUMAN Unconventional myosin-IXb OS=Homo sapiens GN=MYO9B PE=1 SV=3 Back     alignment and function description
>sp|Q9UM54|MYO6_HUMAN Unconventional myosin-VI OS=Homo sapiens GN=MYO6 PE=1 SV=4 Back     alignment and function description
>sp|Q29122|MYO6_PIG Unconventional myosin-VI OS=Sus scrofa GN=MYO6 PE=1 SV=1 Back     alignment and function description
>sp|P08799|MYS2_DICDI Myosin-2 heavy chain OS=Dictyostelium discoideum GN=mhcA PE=1 SV=3 Back     alignment and function description
>sp|Q64331|MYO6_MOUSE Unconventional myosin-VI OS=Mus musculus GN=Myo6 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query184
357623270 1062 hypothetical protein KGM_18974 [Danaus p 0.896 0.155 0.532 5e-40
307173524 2287 Myosin-IXa [Camponotus floridanus] 0.891 0.071 0.551 2e-39
328701265 1863 PREDICTED: myosin-IXb isoform 3 [Acyrtho 0.891 0.088 0.529 3e-39
328701269 1847 PREDICTED: myosin-IXb isoform 1 [Acyrtho 0.891 0.088 0.529 3e-39
328701263 1931 PREDICTED: myosin-IXb isoform 2 [Acyrtho 0.891 0.084 0.529 4e-39
328701267 1776 PREDICTED: myosin-IXb isoform 4 [Acyrtho 0.891 0.092 0.529 4e-39
189234985 1843 PREDICTED: similar to myosin-rhogap prot 0.880 0.087 0.521 4e-39
350414458 2176 PREDICTED: myosin-IXa-like [Bombus impat 0.891 0.075 0.540 5e-39
340715385 2139 PREDICTED: LOW QUALITY PROTEIN: myosin-I 0.891 0.076 0.540 6e-39
270002356 2021 hypothetical protein TcasGA2_TC001372 [T 0.880 0.080 0.521 6e-39
>gi|357623270|gb|EHJ74495.1| hypothetical protein KGM_18974 [Danaus plexippus] Back     alignment and taxonomy information
 Score =  169 bits (428), Expect = 5e-40,   Method: Compositional matrix adjust.
 Identities = 98/184 (53%), Positives = 117/184 (63%), Gaps = 19/184 (10%)

Query: 1   AVVQKYLLEKSRICSQGRGERNYHVFYYLLAGASDQDRHSLHLKKIESYHYLNRIELELP 60
           AVVQKYLLEKSRICSQGR ERNYHVFYYLLAGAS+Q++  LHL  ++ Y+YL++    + 
Sbjct: 304 AVVQKYLLEKSRICSQGRNERNYHVFYYLLAGASEQEKEQLHLLSVDKYNYLSKTGCSV- 362

Query: 61  SFPGASNETLLQKFNTVHRDNPFYEIPQRRENAFIVKHYAGKVKYQSGPYTLDNGGPERN 120
             PG   +    +         F    QRR  A +           S    L       N
Sbjct: 363 -VPGVDEQYEFSRLKQSMDMVGFTMDKQRRLFAVL-----------SAVLLLG------N 404

Query: 121 VEFVPRKSAYHHDESVTVRNTEVVVLISELLRVKKETLLAALTAKHARASDETLVINYRL 180
           VEF P++ +YHHDE+V VRN EVV LIS LLRVK+ETLLAALT+K ARAS ETLVINYRL
Sbjct: 405 VEFHPQRKSYHHDEAVGVRNPEVVSLISSLLRVKQETLLAALTSKRARASGETLVINYRL 464

Query: 181 PEVL 184
           PE +
Sbjct: 465 PEAI 468

Source: Danaus plexippus

Species: Danaus plexippus

Genus: Danaus

Family: Nymphalidae

Order: Lepidoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|307173524|gb|EFN64434.1| Myosin-IXa [Camponotus floridanus] Back     alignment and taxonomy information
>gi|328701265|ref|XP_003241547.1| PREDICTED: myosin-IXb isoform 3 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328701269|ref|XP_001944223.2| PREDICTED: myosin-IXb isoform 1 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328701263|ref|XP_003241546.1| PREDICTED: myosin-IXb isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328701267|ref|XP_003241548.1| PREDICTED: myosin-IXb isoform 4 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|189234985|ref|XP_968193.2| PREDICTED: similar to myosin-rhogap protein, myr [Tribolium castaneum] Back     alignment and taxonomy information
>gi|350414458|ref|XP_003490324.1| PREDICTED: myosin-IXa-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340715385|ref|XP_003396195.1| PREDICTED: LOW QUALITY PROTEIN: myosin-IXa-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|270002356|gb|EEZ98803.1| hypothetical protein TcasGA2_TC001372 [Tribolium castaneum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query184
UNIPROTKB|H3BRD5 2396 MYO9A "Unconventional myosin-I 0.298 0.022 0.672 4.9e-27
UNIPROTKB|B2RTY4 2548 MYO9A "Unconventional myosin-I 0.298 0.021 0.672 6e-27
UNIPROTKB|E2RNI0 2628 MYO9A "Uncharacterized protein 0.298 0.020 0.672 1.7e-26
UNIPROTKB|E1BKW7 2637 Bt.27781 "Uncharacterized prot 0.298 0.020 0.672 1.7e-26
MGI|MGI:107735 2542 Myo9a "myosin IXa" [Mus muscul 0.298 0.021 0.654 2e-26
UNIPROTKB|E1BR51 2628 Gga.54670 "Uncharacterized pro 0.298 0.020 0.654 2.2e-26
RGD|621395 2626 Myo9a "myosin IXA" [Rattus nor 0.298 0.020 0.654 4.5e-26
UNIPROTKB|Q9Z1N3 2626 Myo9a "Unconventional myosin-I 0.298 0.020 0.654 4.5e-26
UNIPROTKB|G3MXH1 1104 Bt.27781 "Uncharacterized prot 0.293 0.048 0.666 7.2e-26
UNIPROTKB|G3MXE8 1951 Bt.27781 "Uncharacterized prot 0.298 0.028 0.672 1.1e-25
UNIPROTKB|H3BRD5 MYO9A "Unconventional myosin-IXa" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
 Score = 197 (74.4 bits), Expect = 4.9e-27, Sum P(3) = 4.9e-27
 Identities = 37/55 (67%), Positives = 44/55 (80%)

Query:     1 AVVQKYLLEKSRICSQGRGERNYHVFYYLLAGASDQDRHSLHLKKIESYHYLNRI 55
             A V+KYLLEKSR+  Q   ERNYHVFYYLLAGAS+ +R + HLK+ E YHYLN+I
Sbjct:   313 AYVEKYLLEKSRLVYQEHNERNYHVFYYLLAGASEDERSAFHLKQPEEYHYLNQI 367
GO:0003774 "motor activity" evidence=IEA
GO:0035556 "intracellular signal transduction" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0016459 "myosin complex" evidence=IEA
GO:0046872 "metal ion binding" evidence=IEA
UNIPROTKB|B2RTY4 MYO9A "Unconventional myosin-IXa" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2RNI0 MYO9A "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E1BKW7 Bt.27781 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:107735 Myo9a "myosin IXa" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E1BR51 Gga.54670 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|621395 Myo9a "myosin IXA" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q9Z1N3 Myo9a "Unconventional myosin-IXa" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|G3MXH1 Bt.27781 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|G3MXE8 Bt.27781 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query184
cd01385 692 cd01385, MYSc_type_IX, Myosin motor domain, type I 4e-39
smart00242 677 smart00242, MYSc, Myosin 6e-24
cd00124 679 cd00124, MYSc, Myosin motor domain 2e-23
pfam00063 679 pfam00063, Myosin_head, Myosin head (motor domain) 5e-21
cd01385 692 cd01385, MYSc_type_IX, Myosin motor domain, type I 8e-19
cd01382 717 cd01382, MYSc_type_VI, Myosin motor domain, type V 1e-18
cd01378 674 cd01378, MYSc_type_I, Myosin motor domain, type I 3e-18
cd01381 671 cd01381, MYSc_type_VII, Myosin motor domain, type 9e-17
cd01377 693 cd01377, MYSc_type_II, Myosin motor domain, type I 8e-16
cd01380 691 cd01380, MYSc_type_V, Myosin motor domain, type V 2e-15
COG5022 1463 COG5022, COG5022, Myosin heavy chain [Cytoskeleton 4e-15
cd01383 677 cd01383, MYSc_type_VIII, Myosin motor domain, plan 6e-15
cd01384 674 cd01384, MYSc_type_XI, Myosin motor domain, plant- 8e-15
cd01387 677 cd01387, MYSc_type_XV, Myosin motor domain, type X 1e-14
PTZ00014 821 PTZ00014, PTZ00014, myosin-A; Provisional 2e-14
smart00242 677 smart00242, MYSc, Myosin 1e-10
cd01379 653 cd01379, MYSc_type_III, Myosin motor domain, type 4e-08
cd00124 679 cd00124, MYSc, Myosin motor domain 5e-08
cd01381 671 cd01381, MYSc_type_VII, Myosin motor domain, type 2e-07
cd01384674 cd01384, MYSc_type_XI, Myosin motor domain, plant- 3e-07
cd01380 691 cd01380, MYSc_type_V, Myosin motor domain, type V 7e-06
cd01387 677 cd01387, MYSc_type_XV, Myosin motor domain, type X 9e-06
COG5022 1463 COG5022, COG5022, Myosin heavy chain [Cytoskeleton 1e-05
cd01386 767 cd01386, MYSc_type_XVIII, Myosin motor domain, typ 3e-05
cd01377 693 cd01377, MYSc_type_II, Myosin motor domain, type I 6e-05
cd01379653 cd01379, MYSc_type_III, Myosin motor domain, type 9e-05
pfam00063 679 pfam00063, Myosin_head, Myosin head (motor domain) 7e-04
cd01378674 cd01378, MYSc_type_I, Myosin motor domain, type I 0.002
>gnl|CDD|238681 cd01385, MYSc_type_IX, Myosin motor domain, type IX myosins Back     alignment and domain information 
 Score =  140 bits (355), Expect = 4e-39
 Identities = 77/184 (41%), Positives = 100/184 (54%), Gaps = 24/184 (13%)

Query: 1   AVVQKYLLEKSRICSQGRGERNYHVFYYLLAGASDQDRHSLHLKKIESYHYLNRIELELP 60
           AVV+KYLLEKSRI SQ + ERNYHVFYYLL GAS+++R    L K   Y YLN+  L++ 
Sbjct: 176 AVVEKYLLEKSRIVSQEKDERNYHVFYYLLLGASEEERKQEFLLKQPDYFYLNQHNLKIE 235

Query: 61  SFPGASNE--TLLQKFNTVHRDNPFYEIPQRRENAFIVKHYAGKVKYQSGPYTLDNGGPE 118
                 +E   L Q    V     F    Q++  A +           S    L      
Sbjct: 236 DGEDEKHEFERLKQAMEMVG----FLAATQKQIFAVL-----------SAVLLLG----- 275

Query: 119 RNVEFVPRKSAYHHDESVTVRNTEVVVLISELLRVKKETLLAALTAKHARASDETLVINY 178
            NV +  R + YH DES+ V N EVV L+S+LL+VK+ETL+ ALT K     +ETL++ Y
Sbjct: 276 -NVTYKKRAT-YHRDESLEVGNPEVVDLLSQLLKVKRETLMEALTKKRTVTVNETLILPY 333

Query: 179 RLPE 182
            L E
Sbjct: 334 SLSE 337

Myosin IX is a processive single-headed motor, which might play a role in signalling. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydrolysis causes the head to pivot and associate with a new actin subunit. The release of Pi causes the head to pivot and move the filament (power stroke). Release of ADP completes the cycle. Length = 692
>gnl|CDD|214580 smart00242, MYSc, Myosin Back     alignment and domain information
>gnl|CDD|238071 cd00124, MYSc, Myosin motor domain Back     alignment and domain information
>gnl|CDD|215687 pfam00063, Myosin_head, Myosin head (motor domain) Back     alignment and domain information
>gnl|CDD|238681 cd01385, MYSc_type_IX, Myosin motor domain, type IX myosins Back     alignment and domain information
>gnl|CDD|238678 cd01382, MYSc_type_VI, Myosin motor domain, type VI myosins Back     alignment and domain information
>gnl|CDD|238674 cd01378, MYSc_type_I, Myosin motor domain, type I myosins Back     alignment and domain information
>gnl|CDD|238677 cd01381, MYSc_type_VII, Myosin motor domain, type VII myosins Back     alignment and domain information
>gnl|CDD|238673 cd01377, MYSc_type_II, Myosin motor domain, type II myosins Back     alignment and domain information
>gnl|CDD|238676 cd01380, MYSc_type_V, Myosin motor domain, type V myosins Back     alignment and domain information
>gnl|CDD|227355 COG5022, COG5022, Myosin heavy chain [Cytoskeleton] Back     alignment and domain information
>gnl|CDD|238679 cd01383, MYSc_type_VIII, Myosin motor domain, plant-specific type VIII myosins, a subgroup which has been associated with endocytosis, cytokinesis, cell-to-cell coupling and gating at plasmodesmata Back     alignment and domain information
>gnl|CDD|238680 cd01384, MYSc_type_XI, Myosin motor domain, plant-specific type XI myosin, involved in organelle transport Back     alignment and domain information
>gnl|CDD|238683 cd01387, MYSc_type_XV, Myosin motor domain, type XV myosins Back     alignment and domain information
>gnl|CDD|240229 PTZ00014, PTZ00014, myosin-A; Provisional Back     alignment and domain information
>gnl|CDD|214580 smart00242, MYSc, Myosin Back     alignment and domain information
>gnl|CDD|238675 cd01379, MYSc_type_III, Myosin motor domain, type III myosins Back     alignment and domain information
>gnl|CDD|238071 cd00124, MYSc, Myosin motor domain Back     alignment and domain information
>gnl|CDD|238677 cd01381, MYSc_type_VII, Myosin motor domain, type VII myosins Back     alignment and domain information
>gnl|CDD|238680 cd01384, MYSc_type_XI, Myosin motor domain, plant-specific type XI myosin, involved in organelle transport Back     alignment and domain information
>gnl|CDD|238676 cd01380, MYSc_type_V, Myosin motor domain, type V myosins Back     alignment and domain information
>gnl|CDD|238683 cd01387, MYSc_type_XV, Myosin motor domain, type XV myosins Back     alignment and domain information
>gnl|CDD|227355 COG5022, COG5022, Myosin heavy chain [Cytoskeleton] Back     alignment and domain information
>gnl|CDD|238682 cd01386, MYSc_type_XVIII, Myosin motor domain, type XVIII myosins Back     alignment and domain information
>gnl|CDD|238673 cd01377, MYSc_type_II, Myosin motor domain, type II myosins Back     alignment and domain information
>gnl|CDD|238675 cd01379, MYSc_type_III, Myosin motor domain, type III myosins Back     alignment and domain information
>gnl|CDD|215687 pfam00063, Myosin_head, Myosin head (motor domain) Back     alignment and domain information
>gnl|CDD|238674 cd01378, MYSc_type_I, Myosin motor domain, type I myosins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 184
cd01381 671 MYSc_type_VII Myosin motor domain, type VII myosin 100.0
cd01377 693 MYSc_type_II Myosin motor domain, type II myosins. 100.0
COG5022 1463 Myosin heavy chain [Cytoskeleton] 100.0
PTZ00014 821 myosin-A; Provisional 100.0
cd01383 677 MYSc_type_VIII Myosin motor domain, plant-specific 100.0
cd01380 691 MYSc_type_V Myosin motor domain, type V myosins. M 100.0
cd01385 692 MYSc_type_IX Myosin motor domain, type IX myosins. 100.0
cd01378 674 MYSc_type_I Myosin motor domain, type I myosins. M 100.0
cd01387 677 MYSc_type_XV Myosin motor domain, type XV myosins. 100.0
cd01384 674 MYSc_type_XI Myosin motor domain, plant-specific t 100.0
cd00124 679 MYSc Myosin motor domain. This catalytic (head) do 100.0
cd01379 653 MYSc_type_III Myosin motor domain, type III myosin 100.0
smart00242 677 MYSc Myosin. Large ATPases. ATPase; molecular moto 100.0
cd01382 717 MYSc_type_VI Myosin motor domain, type VI myosins. 100.0
KOG0164|consensus 1001 100.0
PF00063 689 Myosin_head: Myosin head (motor domain); InterPro: 100.0
KOG0162|consensus 1106 100.0
cd01386 767 MYSc_type_XVIII Myosin motor domain, type XVIII my 100.0
KOG0163|consensus 1259 99.97
KOG0161|consensus 1930 99.97
KOG0160|consensus 862 99.97
KOG4229|consensus 1062 99.91
>cd01381 MYSc_type_VII Myosin motor domain, type VII myosins Back     alignment and domain information 
Probab=100.00  E-value=5.5e-41  Score=313.41  Aligned_cols=161  Identities=27%  Similarity=0.402  Sum_probs=151.3

Q ss_pred             CeeeeeecccceecccCCCCCchhhHHHHHhCCCHHHHhhcCCCCccccccccccc-ccCCCCCccc-hHHHHHHHHhhh
Q psy8603           1 AVVQKYLLEKSRICSQGRGERNYHVFYYLLAGASDQDRHSLHLKKIESYHYLNRIE-LELPSFPGAS-NETLLQKFNTVH   78 (184)
Q Consensus         1 a~i~~YLLEKSRVv~q~~gErNfHIFYqLl~g~~~~~~~~l~L~~~~~y~yl~~~~-~~~~~~dd~~-f~~l~~al~~l~   78 (184)
                      |+|++||||||||++|++|||||||||||++|++++++++|+|.++.+|+||++++ ..++++||+. |+.+++||+.+ 
T Consensus       165 a~i~~yLLEksRV~~q~~gERnfHIFYqLl~g~~~~~~~~l~L~~~~~y~yL~~~~~~~~~~~dD~~~f~~~~~al~~l-  243 (671)
T cd01381         165 AKIEQYLLEKSRIVRQARDERNYHIFYCMLAGLSTDEKERLKLGEASDYHYLAQGGCITCEGRDDAKDFADIRSAMKVL-  243 (671)
T ss_pred             EEEEEEeccCCceeecCCCCCcHHHHHHHHcCCCHHHHHHcCCCChhhceeecCCCCccCCCccHHHHHHHHHHHHHHc-
Confidence            68999999999999999999999999999999999999999999999999999887 5678999998 99999999999 


Q ss_pred             cCCCCCccccccceeeeeeccCcceeeeccceecCCCccccceeeecCCCCCCCCceeeecCHHHHHHHHHhcCCCHHHH
Q psy8603          79 RDNPFYEIPQRRENAFIVKHYAGKVKYQSGPYTLDNGGPERNVEFVPRKSAYHHDESVTVRNTEVVVLISELLRVKKETL  158 (184)
Q Consensus        79 ~~~gf~~~e~~~i~~il~~h~ag~V~y~aaIL~~~~~~~lGni~f~~~~~~~~~~~~~~~~~~~~l~~~a~LLgv~~~~L  158 (184)
                         ||+++++..||++|           ||||      |||||+|.+.+.  ...+.+.+.|.+.+..||+||||+.++|
T Consensus       244 ---G~~~~e~~~i~~il-----------aaIL------hLGni~F~~~~~--~~~~~~~i~~~~~l~~~a~LLgv~~~~L  301 (671)
T cd01381         244 ---MFTDQEIWEIFKLL-----------AAIL------HIGNLRFEATEV--DNLAACEVDDTPNLQRVAQLLGVPIQDL  301 (671)
T ss_pred             ---CCCHHHHHHHHHHH-----------HHHH------hhcceEEeeccC--CCCCceeeCChHHHHHHHHHhCCCHHHH
Confidence               99999999999999           9999      999999987653  1246788999999999999999999999


Q ss_pred             HHhHhhceEEecCeEEEEeCCccccC
Q psy8603         159 LAALTAKHARASDETLVINYRLPEVL  184 (184)
Q Consensus       159 ~~aLt~~~~~~~ge~i~~~~~~~ea~  184 (184)
                      .++||++++.++||.+++|++++||.
T Consensus       302 ~~~lt~~~~~~~~e~i~~~~~~~qA~  327 (671)
T cd01381         302 MDALTSRTIFTRGETVVTPLSREQAV  327 (671)
T ss_pred             hhhhceEEEEeCCceEEecCCHHHHH
Confidence            99999999999999999999999873

Myosins in this group have been associated with functions in sensory systems such as vision and hearing. This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Myosins are actin-dependent molecular motors that play important roles in muscle contraction, cell motility, and organelle transport. The head domain is a molecular motor, which utilizes ATP hydrolysis to generate directed movement toward the plus end along actin filaments. A cyclical interaction between myosin and actin provides the driving force. Rates of ATP hydrolysis and consequently the speed of movement along actin filaments vary widely, from about 0.04 micrometer per second for myosin I to 4.5 micrometer per second for myosin II in skeletal muscle. Myosin II moves in discrete steps about 5-10 nm long and generates 1-5 piconewtons of force. Upon ATP binding, the myosin head dissociates from an actin filament. ATP hydr
>cd01377 MYSc_type_II Myosin motor domain, type II myosins Back     alignment and domain information
>COG5022 Myosin heavy chain [Cytoskeleton] Back     alignment and domain information
>PTZ00014 myosin-A; Provisional Back     alignment and domain information
>cd01383 MYSc_type_VIII Myosin motor domain, plant-specific type VIII myosins, a subgroup which has been associated with endocytosis, cytokinesis, cell-to-cell coupling and gating at plasmodesmata Back     alignment and domain information
>cd01380 MYSc_type_V Myosin motor domain, type V myosins Back     alignment and domain information
>cd01385 MYSc_type_IX Myosin motor domain, type IX myosins Back     alignment and domain information
>cd01378 MYSc_type_I Myosin motor domain, type I myosins Back     alignment and domain information
>cd01387 MYSc_type_XV Myosin motor domain, type XV myosins Back     alignment and domain information
>cd01384 MYSc_type_XI Myosin motor domain, plant-specific type XI myosin, involved in organelle transport Back     alignment and domain information
>cd00124 MYSc Myosin motor domain Back     alignment and domain information
>cd01379 MYSc_type_III Myosin motor domain, type III myosins Back     alignment and domain information
>smart00242 MYSc Myosin Back     alignment and domain information
>cd01382 MYSc_type_VI Myosin motor domain, type VI myosins Back     alignment and domain information
>KOG0164|consensus Back     alignment and domain information
>PF00063 Myosin_head: Myosin head (motor domain); InterPro: IPR001609 Muscle contraction is caused by sliding between the thick and thin filaments of the myofibril Back     alignment and domain information
>KOG0162|consensus Back     alignment and domain information
>cd01386 MYSc_type_XVIII Myosin motor domain, type XVIII myosins Back     alignment and domain information
>KOG0163|consensus Back     alignment and domain information
>KOG0161|consensus Back     alignment and domain information
>KOG0160|consensus Back     alignment and domain information
>KOG4229|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query184
2bkh_A 814 Myosin Vi Nucleotide-Free (Mdinsert2) Crystal Struc 9e-13
2bki_A 858 Myosin Vi Nucleotide-Free (Mdinsert2-Iq) Crystal St 9e-13
2x51_A 789 M6 Delta Insert1 Length = 789 9e-13
2v26_A 784 Myosin Vi (Md) Pre-Powerstroke State (Mg.Adp.Vo4) L 9e-13
4dbp_A 814 Myosin Vi Nucleotide-free (mdinsert2) D179y Crystal 1e-12
4e7z_A 798 Myosin Vi (Md) Pre-Powerstroke State, P21 Crystal F 1e-12
4e7s_A 798 Myosin Vi D23r I24r R569e (Md) Pre-Powerstroke Stat 1e-12
3l9i_A 814 Myosin Vi Nucleotide-Free (Mdinsert2) L310g Mutant 1e-12
2vas_A 788 Myosin Vi (Md-Insert2-Cam, Delta-Insert1) Post-Rigo 1e-12
4anj_A 1052 Myosin Vi (Mdinsert2-Gfp Fusion) Pre-Powerstroke St 1e-12
4dbr_A 786 Myosin Vi D179y (md) Pre-powerstroke State Length = 1e-12
4dbq_A 788 Myosin Vi D179y (md-insert2-cam, Delta-insert1) Pos 1e-12
1g8x_A 1010 Structure Of A Genetically Engineered Molecular Mot 3e-12
1lvk_A 762 X-Ray Crystal Structure Of The Mg (Dot) 2'(3')-O-(N 3e-12
2xel_A 776 Molecular Mechanism Of Pentachloropseudilin Mediate 4e-12
2xo8_A 776 Crystal Structure Of Myosin-2 In Complex With Tribr 4e-12
2jhr_A 788 Crystal Structure Of Myosin-2 Motor Domain In Compl 4e-12
1mma_A 762 X-Ray Structures Of The Mgadp, Mgatpgammas, And Mga 4e-12
3mnq_A 788 Crystal Structure Of Myosin-2 Motor Domain In Compl 4e-12
2x9h_A 695 Crystal Structure Of Myosin-2 Motor Domain In Compl 4e-12
2y0r_X 758 Structural Basis For The Allosteric Interference Of 4e-12
1mmd_A 762 Truncated Head Of Myosin From Dictyostelium Discoid 4e-12
2y9e_X 758 Structural Basis For The Allosteric Interference Of 4e-12
2aka_A 776 Structure Of The Nucleotide-Free Myosin Ii Motor Do 4e-12
1fmv_A 761 Crystal Structure Of The Apo Motor Domain Of Dictyo 4e-12
1d0x_A 761 Dictyostelium Myosin S1dc (Motor Domain Fragment) C 4e-12
1jwy_A 776 Crystal Structure Of The Dynamin A Gtpase Domain Co 4e-12
3myh_X 762 Insights Into The Importance Of Hydrogen Bonding In 4e-12
1yv3_A 762 The Structural Basis Of Blebbistatin Inhibition And 4e-12
1w9k_A 770 Dictyostelium Discoideum Myosin Ii Motor Domain S45 4e-12
3mkd_A 692 Crystal Structure Of Myosin-2 Dictyostelium Discoid 5e-12
1w9i_A 770 Myosin Ii Dictyostelium Discoideum Motor Domain S45 5e-12
1w9l_A 770 Myosin Ii Dictyostelium Discoideum Motor Domain S45 5e-12
1w9j_A 770 Myosin Ii Dictyostelium Discoideum Motor Domain S45 5e-12
1mmg_A 762 X-Ray Structures Of The Mgadp, Mgatpgammas, And Mga 5e-12
1mmn_A 762 X-Ray Structures Of The Mgadp, Mgatpgammas, And Mga 5e-12
1br1_A 820 Smooth Muscle Myosin Motor Domain-Essential Light C 4e-10
1br2_A 791 Smooth Muscle Myosin Motor Domain Complexed With Mg 5e-10
3j04_A 909 Em Structure Of The Heavy Meromyosin Subfragment Of 6e-10
3dtp_B 973 Tarantula Heavy Meromyosin Obtained By Flexible Doc 6e-10
3dtp_A 971 Tarantula Heavy Meromyosin Obtained By Flexible Doc 6e-10
1i84_S 1184 Cryo-Em Structure Of The Heavy Meromyosin Subfragme 1e-09
2ycu_A 995 Crystal Structure Of Human Non Muscle Myosin 2c In 4e-06
1w8j_A 766 Crystal Structure Of Myosin V Motor Domain - Nucleo 8e-06
1oe9_A 795 Crystal Structure Of Myosin V Motor With Essential 8e-06
2dfs_A 1080 3-D Structure Of Myosin-V Inhibited State Length = 1e-05
1lkx_A 697 Motor Domain Of Myoe, A Class-I Myosin Length = 697 5e-05
4a7f_C 697 Structure Of The Actin-Tropomyosin-Myosin Complex ( 5e-05
3i5g_A 839 Crystal Structure Of Rigor-Like Squid Myosin S1 Len 6e-05
2w4g_M 840 Isometrically Contracting Insect Asynchronous Fligh 2e-04
1qvi_A 840 Crystal Structure Of Scallop Myosin S1 In The Pre-P 4e-04
1kk7_A 837 Scallop Myosin In The Near Rigor Conformation Lengt 4e-04
1b7t_A 835 Myosin Digested By Papain Length = 835 4e-04
1dfl_A 831 Scallop Myosin S1 Complexed With Mgadp:vanadate-Tra 4e-04
1dfk_A 830 Nucleotide-Free Scallop Myosin S1-Near Rigor State 4e-04
2os8_A 840 Rigor-Like Structures Of Muscle Myosins Reveal Key 4e-04
2ec6_A 838 Placopecten Striated Muscle Myosin Ii Length = 838 4e-04
>pdb|2BKH|A Chain A, Myosin Vi Nucleotide-Free (Mdinsert2) Crystal Structure Length = 814 Back     alignment and structure 
Iteration: 1

 Score = 69.7 bits (169), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 38/54 (70%)
Query: 1   AVVQKYLLEKSRICSQGRGERNYHVFYYLLAGASDQDRHSLHLKKIESYHYLNR 54
             V  YLLEKSRIC QG+ ERNYH+FY L AGAS+  R  LHL   +++ YLNR
Sbjct: 222 GFVSHYLLEKSRICVQGKEERNYHIFYRLCAGASEDIRERLHLSSPDNFRYLNR 275
>pdb|2BKI|A Chain A, Myosin Vi Nucleotide-Free (Mdinsert2-Iq) Crystal Structure Length = 858 Back     alignment and structure
>pdb|2X51|A Chain A, M6 Delta Insert1 Length = 789 Back     alignment and structure
>pdb|2V26|A Chain A, Myosin Vi (Md) Pre-Powerstroke State (Mg.Adp.Vo4) Length = 784 Back     alignment and structure
>pdb|4DBP|A Chain A, Myosin Vi Nucleotide-free (mdinsert2) D179y Crystal Structure Length = 814 Back     alignment and structure
>pdb|4E7Z|A Chain A, Myosin Vi (Md) Pre-Powerstroke State, P21 Crystal Form Length = 798 Back     alignment and structure
>pdb|4E7S|A Chain A, Myosin Vi D23r I24r R569e (Md) Pre-Powerstroke State Length = 798 Back     alignment and structure
>pdb|3L9I|A Chain A, Myosin Vi Nucleotide-Free (Mdinsert2) L310g Mutant Crystal Structure Length = 814 Back     alignment and structure
>pdb|2VAS|A Chain A, Myosin Vi (Md-Insert2-Cam, Delta-Insert1) Post-Rigor State Length = 788 Back     alignment and structure
>pdb|4ANJ|A Chain A, Myosin Vi (Mdinsert2-Gfp Fusion) Pre-Powerstroke State (Mg.Adp.Alf4) Length = 1052 Back     alignment and structure
>pdb|4DBR|A Chain A, Myosin Vi D179y (md) Pre-powerstroke State Length = 786 Back     alignment and structure
>pdb|4DBQ|A Chain A, Myosin Vi D179y (md-insert2-cam, Delta-insert1) Post-rigor State Length = 788 Back     alignment and structure
>pdb|1G8X|A Chain A, Structure Of A Genetically Engineered Molecular Motor Length = 1010 Back     alignment and structure
>pdb|1LVK|A Chain A, X-Ray Crystal Structure Of The Mg (Dot) 2'(3')-O-(N- Methylanthraniloyl) Nucleotide Bound To Dictyostelium Discoideum Myosin Motor Domain Length = 762 Back     alignment and structure
>pdb|2XEL|A Chain A, Molecular Mechanism Of Pentachloropseudilin Mediated Inhibition Of Myosin Motor Activity Length = 776 Back     alignment and structure
>pdb|2XO8|A Chain A, Crystal Structure Of Myosin-2 In Complex With Tribromodichloropseudilin Length = 776 Back     alignment and structure
>pdb|2JHR|A Chain A, Crystal Structure Of Myosin-2 Motor Domain In Complex With Adp-Metavanadate And Pentabromopseudilin Length = 788 Back     alignment and structure
>pdb|1MMA|A Chain A, X-Ray Structures Of The Mgadp, Mgatpgammas, And Mgamppnp Complexes Of The Dictyostelium Discoideum Myosin Motor Domain Length = 762 Back     alignment and structure
>pdb|3MNQ|A Chain A, Crystal Structure Of Myosin-2 Motor Domain In Complex With Adp- Metavanadate And Resveratrol Length = 788 Back     alignment and structure
>pdb|2X9H|A Chain A, Crystal Structure Of Myosin-2 Motor Domain In Complex With Adp-Metavanadate And Pentachlorocarbazole Length = 695 Back     alignment and structure
>pdb|2Y0R|X Chain X, Structural Basis For The Allosteric Interference Of Myosin Function By Mutants G680a And G680v Of Dictyostelium Myosin-2 Length = 758 Back     alignment and structure
>pdb|1MMD|A Chain A, Truncated Head Of Myosin From Dictyostelium Discoideum Complexed With Mgadp-Bef3 Length = 762 Back     alignment and structure
>pdb|2Y9E|X Chain X, Structural Basis For The Allosteric Interference Of Myosin Function By Mutants G680a And G680v Of Dictyostelium Myosin-2 Length = 758 Back     alignment and structure
>pdb|2AKA|A Chain A, Structure Of The Nucleotide-Free Myosin Ii Motor Domain From Dictyostelium Discoideum Fused To The Gtpase Domain Of Dynamin 1 From Rattus Norvegicus Length = 776 Back     alignment and structure
>pdb|1FMV|A Chain A, Crystal Structure Of The Apo Motor Domain Of Dictyostellium Myosin Ii Length = 761 Back     alignment and structure
>pdb|1D0X|A Chain A, Dictyostelium Myosin S1dc (Motor Domain Fragment) Complexed With M-Nitrophenyl Aminoethyldiphosphate Beryllium Trifluoride. Length = 761 Back     alignment and structure
>pdb|1JWY|A Chain A, Crystal Structure Of The Dynamin A Gtpase Domain Complexed With Gdp, Determined As Myosin Fusion Length = 776 Back     alignment and structure
>pdb|3MYH|X Chain X, Insights Into The Importance Of Hydrogen Bonding In The Gamma- Phosphate Binding Pocket Of Myosin: Structural And Functional Studies Of Ser236 Length = 762 Back     alignment and structure
>pdb|1YV3|A Chain A, The Structural Basis Of Blebbistatin Inhibition And Specificity For Myosin Ii Length = 762 Back     alignment and structure
>pdb|1W9K|A Chain A, Dictyostelium Discoideum Myosin Ii Motor Domain S456e With Bound Mgadp-Befx Length = 770 Back     alignment and structure
>pdb|3MKD|A Chain A, Crystal Structure Of Myosin-2 Dictyostelium Discoideum Motor Domain S456y Mutant In Complex With Adp-Orthovanadate Length = 692 Back     alignment and structure
>pdb|1W9I|A Chain A, Myosin Ii Dictyostelium Discoideum Motor Domain S456y Bound With Mgadp-Befx Length = 770 Back     alignment and structure
>pdb|1W9L|A Chain A, Myosin Ii Dictyostelium Discoideum Motor Domain S456e Bound With Mgadp-Alf4 Length = 770 Back     alignment and structure
>pdb|1W9J|A Chain A, Myosin Ii Dictyostelium Discoideum Motor Domain S456y Bound With Mgadp-Alf4 Length = 770 Back     alignment and structure
>pdb|1MMG|A Chain A, X-Ray Structures Of The Mgadp, Mgatpgammas, And Mgamppnp Complexes Of The Dictyostelium Discoideum Myosin Motor Domain Length = 762 Back     alignment and structure
>pdb|1MMN|A Chain A, X-Ray Structures Of The Mgadp, Mgatpgammas, And Mgamppnp Complexes Of The Dictyostelium Discoideum Myosin Motor Domain Length = 762 Back     alignment and structure
>pdb|1BR1|A Chain A, Smooth Muscle Myosin Motor Domain-Essential Light Chain Complex With Mgadp.Alf4 Bound At The Active Site Length = 820 Back     alignment and structure
>pdb|1BR2|A Chain A, Smooth Muscle Myosin Motor Domain Complexed With Mgadp.Alf4 Length = 791 Back     alignment and structure
>pdb|3J04|A Chain A, Em Structure Of The Heavy Meromyosin Subfragment Of Chick Smooth Muscle Myosin With Regulatory Light Chain In Phosphorylated State Length = 909 Back     alignment and structure
>pdb|3DTP|B Chain B, Tarantula Heavy Meromyosin Obtained By Flexible Docking To Tarantula Muscle Thick Filament Cryo-Em 3d-Map Length = 973 Back     alignment and structure
>pdb|3DTP|A Chain A, Tarantula Heavy Meromyosin Obtained By Flexible Docking To Tarantula Muscle Thick Filament Cryo-Em 3d-Map Length = 971 Back     alignment and structure
>pdb|1I84|S Chain S, Cryo-Em Structure Of The Heavy Meromyosin Subfragment Of Chicken Gizzard Smooth Muscle Myosin With Regulatory Light Chain In The Dephosphorylated State. Only C Alphas Provided For Regulatory Light Chain. Only Backbone Atoms Provided For S2 Fragment. Length = 1184 Back     alignment and structure
>pdb|2YCU|A Chain A, Crystal Structure Of Human Non Muscle Myosin 2c In Pre-power Stroke State Length = 995 Back     alignment and structure
>pdb|1W8J|A Chain A, Crystal Structure Of Myosin V Motor Domain - Nucleotide-Free Length = 766 Back     alignment and structure
>pdb|1OE9|A Chain A, Crystal Structure Of Myosin V Motor With Essential Light Chain - Nucleotide-Free Length = 795 Back     alignment and structure
>pdb|2DFS|A Chain A, 3-D Structure Of Myosin-V Inhibited State Length = 1080 Back     alignment and structure
>pdb|1LKX|A Chain A, Motor Domain Of Myoe, A Class-I Myosin Length = 697 Back     alignment and structure
>pdb|4A7F|C Chain C, Structure Of The Actin-Tropomyosin-Myosin Complex (Rigor Atm 3) Length = 697 Back     alignment and structure
>pdb|3I5G|A Chain A, Crystal Structure Of Rigor-Like Squid Myosin S1 Length = 839 Back     alignment and structure
>pdb|1QVI|A Chain A, Crystal Structure Of Scallop Myosin S1 In The Pre-Power Stroke State To 2.6 Angstrom Resolution: Flexibility And Function In The Head Length = 840 Back     alignment and structure
>pdb|1KK7|A Chain A, Scallop Myosin In The Near Rigor Conformation Length = 837 Back     alignment and structure
>pdb|1B7T|A Chain A, Myosin Digested By Papain Length = 835 Back     alignment and structure
>pdb|1DFL|A Chain A, Scallop Myosin S1 Complexed With Mgadp:vanadate-Transition State Length = 831 Back     alignment and structure
>pdb|1DFK|A Chain A, Nucleotide-Free Scallop Myosin S1-Near Rigor State Length = 830 Back     alignment and structure
>pdb|2OS8|A Chain A, Rigor-Like Structures Of Muscle Myosins Reveal Key Mechanical Elements In The Transduction Pathways Of This Allosteric Motor Length = 840 Back     alignment and structure
>pdb|2EC6|A Chain A, Placopecten Striated Muscle Myosin Ii Length = 838 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query184
2v26_A 784 Myosin VI; calmodulin-binding, nucleotide-binding, 7e-27
2v26_A 784 Myosin VI; calmodulin-binding, nucleotide-binding, 7e-10
2dfs_A 1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 8e-23
2dfs_A 1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 3e-10
1w7j_A 795 Myosin VA; motor protein, unconventional myosin, m 2e-22
1w7j_A 795 Myosin VA; motor protein, unconventional myosin, m 3e-10
1w9i_A 770 Myosin II heavy chain; molecular motor, ATPase, mo 2e-22
1w9i_A 770 Myosin II heavy chain; molecular motor, ATPase, mo 9e-11
2ycu_A 995 Non muscle myosin 2C, alpha-actinin; motor protein 2e-22
2ycu_A 995 Non muscle myosin 2C, alpha-actinin; motor protein 1e-10
1g8x_A 1010 Myosin II heavy chain fused to alpha-actinin 3; mo 4e-22
1g8x_A 1010 Myosin II heavy chain fused to alpha-actinin 3; mo 2e-10
1kk8_A 837 Myosin heavy chain, striated muscle; actin-detache 6e-22
1kk8_A 837 Myosin heavy chain, striated muscle; actin-detache 1e-08
1lkx_A 697 Myosin IE heavy chain; myosin motor domain, lever 2e-21
1lkx_A 697 Myosin IE heavy chain; myosin motor domain, lever 5e-10
4db1_A 783 Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb 1e-20
4db1_A 783 Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb 2e-09
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 3e-20
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 6e-10
>2v26_A Myosin VI; calmodulin-binding, nucleotide-binding, membrane, vanadate, transport, PRE- powerstroke, transition state, protein transport; HET: ADP; 1.75A {Sus scrofa} PDB: 2bki_A 2bkh_A 3l9i_A 2x51_A 2vb6_A* 2vas_A* Length = 784 Back     alignment and structure
 Score =  105 bits (264), Expect = 7e-27
 Identities = 48/177 (27%), Positives = 78/177 (44%), Gaps = 18/177 (10%)

Query: 1   AVVQKYLLEKSRICSQGRGERNYHVFYYLLAGASDQDRHSLHLKKIESYHYLNRIELELP 60
             V  YLLEKSRIC QG+ ERNYH+FY L AGAS+  R  LHL   +++ YLNR      
Sbjct: 219 GFVSHYLLEKSRICVQGKEERNYHIFYRLCAGASEDIRERLHLSSPDNFRYLNRGCTRYF 278

Query: 61  SFPGASNETLLQKFNTVHRDNPFYEIP--------QRRENAFIVKHYAGKVKYQSGPYTL 112
           +      + L  + +  +      + P         R   A          + +   + +
Sbjct: 279 ANKETDKQILQNRKSPEYLKAGSLKDPLLDDHGDFIRMCTAMKKIGL--DDEEKLDLFRV 336

Query: 113 DNG----GPERNVEFVPRKSAYHHDESVTVRNTEVVVLISELLRVKKETLLAALTAK 165
             G    G   N++F    S      ++  ++T+ +   +ELL + ++ L  +LT +
Sbjct: 337 VAGVLHLG---NIDFEEAGS-TSGGCNLKNKSTQALEYCAELLGLDQDDLRVSLTTR 389
>2v26_A Myosin VI; calmodulin-binding, nucleotide-binding, membrane, vanadate, transport, PRE- powerstroke, transition state, protein transport; HET: ADP; 1.75A {Sus scrofa} PDB: 2bki_A 2bkh_A 3l9i_A 2x51_A 2vb6_A* 2vas_A* Length = 784 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>1w7j_A Myosin VA; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Gallus gallus} SCOP: b.34.3.1 c.37.1.9 PDB: 1w7i_A* 1oe9_A* 1w8j_A Length = 795 Back     alignment and structure
>1w7j_A Myosin VA; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Gallus gallus} SCOP: b.34.3.1 c.37.1.9 PDB: 1w7i_A* 1oe9_A* 1w8j_A Length = 795 Back     alignment and structure
>1w9i_A Myosin II heavy chain; molecular motor, ATPase, motor domain, mutant, muscle contraction; HET: ADP; 1.75A {Dictyostelium discoideum} PDB: 1w9j_A* 1w9l_A* 1w9k_A* 1mma_A* 2aka_A 1d0x_A* 1d0y_A* 1d0z_A* 1d1a_A* 1d1b_A* 1d1c_A* 2xel_A* 1yv3_A* 3bz7_A* 3bz8_A* 3bz9_A* 1jwy_A* 1jx2_A* 3mjx_A* 2jhr_A* ... Length = 770 Back     alignment and structure
>1w9i_A Myosin II heavy chain; molecular motor, ATPase, motor domain, mutant, muscle contraction; HET: ADP; 1.75A {Dictyostelium discoideum} PDB: 1w9j_A* 1w9l_A* 1w9k_A* 1mma_A* 2aka_A 1d0x_A* 1d0y_A* 1d0z_A* 1d1a_A* 1d1b_A* 1d1c_A* 2xel_A* 1yv3_A* 3bz7_A* 3bz8_A* 3bz9_A* 1jwy_A* 1jx2_A* 3mjx_A* 2jhr_A* ... Length = 770 Back     alignment and structure
>2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* Length = 995 Back     alignment and structure
>2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* Length = 995 Back     alignment and structure
>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 Back     alignment and structure
>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 Back     alignment and structure
>1kk8_A Myosin heavy chain, striated muscle; actin-detached, mechanics of motor, contractIle PROT; HET: ADP; 2.30A {Argopecten irradians} SCOP: b.34.3.1 c.37.1.9 PDB: 1kk7_A* 1qvi_A* 1s5g_A* 1sr6_A 1b7t_A* 1kqm_A* 1kwo_A* 1l2o_A* 1dfl_A* 2w4t_C 2w4v_C 2w4w_C 1dfk_A 2ec6_A 2otg_A* 2os8_A* 2ovk_A 2ekv_A 2ekw_A 2oy6_A* ... Length = 837 Back     alignment and structure
>1kk8_A Myosin heavy chain, striated muscle; actin-detached, mechanics of motor, contractIle PROT; HET: ADP; 2.30A {Argopecten irradians} SCOP: b.34.3.1 c.37.1.9 PDB: 1kk7_A* 1qvi_A* 1s5g_A* 1sr6_A 1b7t_A* 1kqm_A* 1kwo_A* 1l2o_A* 1dfl_A* 2w4t_C 2w4v_C 2w4w_C 1dfk_A 2ec6_A 2otg_A* 2os8_A* 2ovk_A 2ekv_A 2ekw_A 2oy6_A* ... Length = 837 Back     alignment and structure
>1lkx_A Myosin IE heavy chain; myosin motor domain, lever ARM, converter domain, contractIle protein; HET: ADP; 3.00A {Dictyostelium discoideum} SCOP: c.37.1.9 Length = 697 Back     alignment and structure
>1lkx_A Myosin IE heavy chain; myosin motor domain, lever ARM, converter domain, contractIle protein; HET: ADP; 3.00A {Dictyostelium discoideum} SCOP: c.37.1.9 Length = 697 Back     alignment and structure
>4db1_A Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb, MYHC-beta, contractIle protein; HET: ANP; 2.60A {Homo sapiens} PDB: 2w4a_M 2w4g_M 2w4h_M 2mys_A* 1m8q_A* 1mvw_A* 1o18_A* 1o19_A* 1o1a_A* 1o1b_A* 1o1c_A* 1o1d_A* 1o1e_A* 1o1f_A* 1o1g_A* Length = 783 Back     alignment and structure
>4db1_A Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb, MYHC-beta, contractIle protein; HET: ANP; 2.60A {Homo sapiens} PDB: 2w4a_M 2w4g_M 2w4h_M 2mys_A* 1m8q_A* 1mvw_A* 1o18_A* 1o19_A* 1o1a_A* 1o1b_A* 1o1c_A* 1o1d_A* 1o1e_A* 1o1f_A* 1o1g_A* Length = 783 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query184
1lkx_A 697 Myosin IE heavy chain; myosin motor domain, lever 100.0
1kk8_A 837 Myosin heavy chain, striated muscle; actin-detache 100.0
1w7j_A 795 Myosin VA; motor protein, unconventional myosin, m 100.0
4db1_A 783 Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb 100.0
1w9i_A 770 Myosin II heavy chain; molecular motor, ATPase, mo 100.0
2ycu_A 995 Non muscle myosin 2C, alpha-actinin; motor protein 100.0
1g8x_A 1010 Myosin II heavy chain fused to alpha-actinin 3; mo 100.0
2dfs_A 1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 100.0
2v26_A 784 Myosin VI; calmodulin-binding, nucleotide-binding, 100.0
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 100.0
4anj_A 1052 Unconventional myosin-VI, green fluorescent prote; 100.0
>1lkx_A Myosin IE heavy chain; myosin motor domain, lever ARM, converter domain, contractIle protein; HET: ADP; 3.00A {Dictyostelium discoideum} SCOP: c.37.1.9 Back     alignment and structure
Probab=100.00  E-value=1.9e-42  Score=323.01  Aligned_cols=162  Identities=20%  Similarity=0.366  Sum_probs=143.8

Q ss_pred             CeeeeeecccceecccCCCCCchhhHHHHHhCCCHHHHhhcCCC-Cccccccccccc-ccCCCCCccc-hHHHHHHHHhh
Q psy8603           1 AVVQKYLLEKSRICSQGRGERNYHVFYYLLAGASDQDRHSLHLK-KIESYHYLNRIE-LELPSFPGAS-NETLLQKFNTV   77 (184)
Q Consensus         1 a~i~~YLLEKSRVv~q~~gErNfHIFYqLl~g~~~~~~~~l~L~-~~~~y~yl~~~~-~~~~~~dd~~-f~~l~~al~~l   77 (184)
                      |+|++|||||||||+|++||||||||||||+|+++++++.|+|. ++++|+||++++ ..++++||++ |+.+++||+++
T Consensus       177 a~I~~yLLEKSRVv~q~~gERnfHIFYqllaG~~~~~~~~l~L~~~~~~y~yL~~~~~~~~~~~dD~~~f~~~~~Am~~l  256 (697)
T 1lkx_A          177 GKITNYLLEKSRVVGRTQGERSFHIFYQMLKGLSQSKLDELGLTPNAPAYEYLKKSGCFDVSTIDDSGEFKIIVKAMETL  256 (697)
T ss_dssp             EEEEEECCCGGGGTCCCTTCCCBHHHHHHHTTSCHHHHHHHTCCSCGGGSHHHHHTTCCCCTTCCHHHHHHHHHHHHHHT
T ss_pred             eeeeeeeccCceeeeecCCCCceeehhHHhcCCCHHHHHHhcCCCChhhCccccCCCCcccCCCchHHHHHHHHHHHHhC
Confidence            68999999999999999999999999999999999999999998 899999999887 6788999998 99999999999


Q ss_pred             hcCCCCCccccccceeeeeeccCcceeeeccceecCCCccccceeeecCCCCCCCCceeeecCHHHHHHHHHhcCCCHHH
Q psy8603          78 HRDNPFYEIPQRRENAFIVKHYAGKVKYQSGPYTLDNGGPERNVEFVPRKSAYHHDESVTVRNTEVVVLISELLRVKKET  157 (184)
Q Consensus        78 ~~~~gf~~~e~~~i~~il~~h~ag~V~y~aaIL~~~~~~~lGni~f~~~~~~~~~~~~~~~~~~~~l~~~a~LLgv~~~~  157 (184)
                          ||+++++..||++|           ||||      |||||+|.+........+.+.+.|.+.++.+|.||||++++
T Consensus       257 ----G~~~~e~~~i~~il-----------aaIL------hLGNi~F~~~~~~~~~~~~~~v~~~~~l~~~a~LLgv~~~~  315 (697)
T 1lkx_A          257 ----GLKESDQNSIWRIL-----------AAIL------HIGNITFAEAAEQRTGTTTVKVSDTKSLAAAASCLKTDQQS  315 (697)
T ss_dssp             ----TCCHHHHHHHHHHH-----------HHHH------HHTTCCEEEETTC----CEEEESSHHHHHHHHHHHTSCHHH
T ss_pred             ----CCCHHHHHHHHHHH-----------HHHH------hcccceEeecccccCCCCcceeCCHHHHHHHHHhhCCCHHH
Confidence                99999999999999           9999      99999998732111123678999999999999999999999


Q ss_pred             HHHhHhhceEEec----CeEEEEeCCcccc
Q psy8603         158 LLAALTAKHARAS----DETLVINYRLPEV  183 (184)
Q Consensus       158 L~~aLt~~~~~~~----ge~i~~~~~~~ea  183 (184)
                      |.++||++++.++    ||.+++|++++||
T Consensus       316 L~~~L~~r~~~~~~g~~~e~i~~~l~~~qA  345 (697)
T 1lkx_A          316 LSIALCYRSISTGVGKRCSVISVPMDCNQA  345 (697)
T ss_dssp             HHHHHHBCC----------CCCCBCCHHHH
T ss_pred             HHHHHhccEEeeccCCCCCeEEecCCHHHH
Confidence            9999999999999    9999999999997
>1kk8_A Myosin heavy chain, striated muscle; actin-detached, mechanics of motor, contractIle PROT; HET: ADP; 2.30A {Argopecten irradians} SCOP: b.34.3.1 c.37.1.9 PDB: 1kk7_A* 1qvi_A* 1s5g_A* 1sr6_A 1b7t_A* 1kqm_A* 1kwo_A* 1l2o_A* 1dfl_A* 2w4t_C 2w4v_C 2w4w_C 1dfk_A 2ec6_A 2otg_A* 2os8_A* 2ovk_A 2ekv_A 2ekw_A 2oy6_A* ... Back     alignment and structure
>1w7j_A Myosin VA; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Gallus gallus} SCOP: b.34.3.1 c.37.1.9 PDB: 1w7i_A* 1oe9_A* 1w8j_A Back     alignment and structure
>4db1_A Myosin-7; S1DC, cardiac, beta isoform, MYH7, myhcb, MYHC-beta, contractIle protein; HET: ANP; 2.60A {Homo sapiens} PDB: 2w4a_M 2w4g_M 2w4h_M 2mys_A* 1m8q_A* 1mvw_A* 1o18_A* 1o19_A* 1o1a_A* 1o1b_A* 1o1c_A* 1o1d_A* 1o1e_A* 1o1f_A* 1o1g_A* Back     alignment and structure
>1w9i_A Myosin II heavy chain; molecular motor, ATPase, motor domain, mutant, muscle contraction; HET: ADP; 1.75A {Dictyostelium discoideum} PDB: 1w9j_A* 1w9l_A* 1w9k_A* 1mma_A* 2aka_A 1d0x_A* 1d0y_A* 1d0z_A* 1d1a_A* 1d1b_A* 1d1c_A* 2xel_A* 1yv3_A* 3bz7_A* 3bz8_A* 3bz9_A* 1jwy_A* 1jx2_A* 3mjx_A* 2jhr_A* ... Back     alignment and structure
>2ycu_A Non muscle myosin 2C, alpha-actinin; motor protein; HET: AOV; 2.25A {Homo sapiens} PDB: 1br1_A* 1br4_A* 1br2_A* Back     alignment and structure
>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Back     alignment and structure
>2v26_A Myosin VI; calmodulin-binding, nucleotide-binding, membrane, vanadate, transport, PRE- powerstroke, transition state, protein transport; HET: ADP; 1.75A {Sus scrofa} PDB: 2bki_A 2bkh_A 3l9i_A 2x51_A 2vb6_A* 2vas_A* Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Back     alignment and structure
>4anj_A Unconventional myosin-VI, green fluorescent prote; motor protein-metal-bindng protein complex, molecular motor, metal-binding protein, transition state; HET: CR2 ADP; 2.60A {Sus scrofa} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 184
d1w7ja2 730 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chick 6e-11
d1w7ja2 730 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chick 6e-06
d1br2a2 710 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chick 2e-10
d1br2a2 710 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chick 8e-06
d1kk8a2 789 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain 3e-10
d1kk8a2 789 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain 0.001
d1lkxa_ 684 c.37.1.9 (A:) Myosin S1, motor domain {Dictyosteli 2e-09
d1lkxa_684 c.37.1.9 (A:) Myosin S1, motor domain {Dictyosteli 6e-05
d2mysa2 794 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain 2e-09
d2mysa2 794 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain 0.004
d1d0xa2 712 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain 6e-09
d1d0xa2 712 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain 2e-05
>d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} Length = 730 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Motor proteins
domain: Myosin S1, motor domain
species: Chicken (Gallus gallus), Va isoform [TaxId: 9031]

 Score = 58.2 bits (140), Expect = 6e-11
 Identities = 23/54 (42%), Positives = 32/54 (59%)

Query: 1   AVVQKYLLEKSRICSQGRGERNYHVFYYLLAGASDQDRHSLHLKKIESYHYLNR 54
           A ++ YLLEKSR+  Q   ERNYH+FY L A A+  +  +L L     +HY  +
Sbjct: 175 ANMRTYLLEKSRVVFQAEEERNYHIFYQLCASAALPEFKTLRLGNANYFHYTKQ 228
>d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} Length = 730 Back     information, alignment and structure
>d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Length = 710 Back     information, alignment and structure
>d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Length = 710 Back     information, alignment and structure
>d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Length = 789 Back     information, alignment and structure
>d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Length = 789 Back     information, alignment and structure
>d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} Length = 684 Back     information, alignment and structure
>d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} Length = 684 Back     information, alignment and structure
>d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Length = 794 Back     information, alignment and structure
>d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Length = 794 Back     information, alignment and structure
>d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]} Length = 712 Back     information, alignment and structure
>d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]} Length = 712 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query184
d1d0xa2 712 Myosin S1, motor domain {Dictyostelium discoideum 100.0
d1br2a2 710 Myosin S1, motor domain {Chicken (Gallus gallus), 100.0
d2mysa2 794 Myosin S1, motor domain {Chicken (Gallus gallus), 100.0
d1w7ja2 730 Myosin S1, motor domain {Chicken (Gallus gallus), 100.0
d1kk8a2 789 Myosin S1, motor domain {Bay scallop (Aequipecten 100.0
d1lkxa_ 684 Myosin S1, motor domain {Dictyostelium discoideum, 100.0
>d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Motor proteins
domain: Myosin S1, motor domain
species: Dictyostelium discoideum [TaxId: 44689]

Probab=100.00  E-value=1.3e-39  Score=302.80  Aligned_cols=157  Identities=29%  Similarity=0.426  Sum_probs=149.4

Q ss_pred             CeeeeeecccceecccCCCCCchhhHHHHHhCCCHHHHhhcCCCCccccccccccc-ccCCCCCccc-hHHHHHHHHhhh
Q psy8603           1 AVVQKYLLEKSRICSQGRGERNYHVFYYLLAGASDQDRHSLHLKKIESYHYLNRIE-LELPSFPGAS-NETLLQKFNTVH   78 (184)
Q Consensus         1 a~i~~YLLEKSRVv~q~~gErNfHIFYqLl~g~~~~~~~~l~L~~~~~y~yl~~~~-~~~~~~dd~~-f~~l~~al~~l~   78 (184)
                      |+|++||||||||++|++|||||||||||++|+++++++.|+|.++.+|+||++++ ..+++++|++ |+.+++||+.+ 
T Consensus       209 a~i~~yLLEksRvv~~~~gErnfHIFYqll~g~~~~~~~~~~l~~~~~~~yL~~~~~~~~~~~dd~~~f~~~~~al~~l-  287 (712)
T d1d0xa2         209 ASIQSYLLEKSRVVFQSETERNYHIFYQLLAGATAEEKKALHLAGPESFNYLNQSGCVDIKGVSDSEEFKITRQAMDIV-  287 (712)
T ss_dssp             EEEEEECCCGGGGTCCCTTCCSBHHHHHHHHHSCHHHHHHHTCCCGGGCTTTSSSSCCCCTTCCHHHHHHHHHHHHHHH-
T ss_pred             ceeEEeccCCceEEeeccccccHHHHHHHHhCCCHHHHHHhCCCCchhcccccCCCCcccCCcChHHHHHHHHHHHHHc-
Confidence            68999999999999999999999999999999999999999999999999999887 5788999998 99999999999 


Q ss_pred             cCCCCCccccccceeeeeeccCcceeeeccceecCCCccccceeeecCCCCCCCCceeeecCHHHHHHHHHhcCCCHHHH
Q psy8603          79 RDNPFYEIPQRRENAFIVKHYAGKVKYQSGPYTLDNGGPERNVEFVPRKSAYHHDESVTVRNTEVVVLISELLRVKKETL  158 (184)
Q Consensus        79 ~~~gf~~~e~~~i~~il~~h~ag~V~y~aaIL~~~~~~~lGni~f~~~~~~~~~~~~~~~~~~~~l~~~a~LLgv~~~~L  158 (184)
                         ||+++++..||++|           ||||      |||||+|.+.+     .+.+.+.|.+.+..+|.||||++++|
T Consensus       288 ---gfs~~e~~~i~~iL-----------aaIL------hLGNi~F~~~~-----~~~~~i~~~~~l~~~a~LLgv~~~~L  342 (712)
T d1d0xa2         288 ---GFSQEEQMSIFKII-----------AGIL------HLGNIKFEKGA-----GEGAVLKDKTALNAASTVFGVNPSVL  342 (712)
T ss_dssp             ---TCCHHHHHHHHHHH-----------HHHH------HHHTCCCBCCS-----SSSCBCSCCHHHHHHHHHHTCCHHHH
T ss_pred             ---CCCHHHHHHHHHHH-----------HHHH------hhccceEeecC-----CcceecCCHHHHHHHHHHhCCChhHh
Confidence               99999999999999           9999      99999997754     46678899999999999999999999


Q ss_pred             HHhHhhceEEecCeEEEEeCCcccc
Q psy8603         159 LAALTAKHARASDETLVINYRLPEV  183 (184)
Q Consensus       159 ~~aLt~~~~~~~ge~i~~~~~~~ea  183 (184)
                      .++|+.+.+.++||.+++|++++||
T Consensus       343 ~~~L~~~~~~~~~e~i~~~l~~~~A  367 (712)
T d1d0xa2         343 EKALMEPRILAGRDLVAQHLNVEKS  367 (712)
T ss_dssp             HHHHHSCEEEETTEEEECCCCHHHH
T ss_pred             hhhhcceeeccCCceEEecCCHHHH
Confidence            9999999999999999999999987
>d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d1w7ja2 c.37.1.9 (A:63-792) Myosin S1, motor domain {Chicken (Gallus gallus), Va isoform [TaxId: 9031]} Back     information, alignment and structure
>d1kk8a2 c.37.1.9 (A:1-28,A:77-837) Myosin S1, motor domain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} Back     information, alignment and structure