Psyllid ID: psy8640

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300---
MKTRSLVWLQPMQCLIMRRGVVHRENIQVYLVWYGSTSRLCRRTCGTIPLSQQQRLAIQAVDPLTGVLSVQQPLDYDTGSSEHLLILKVEDGGKPPLDSPLSSITHLKITLQDENDNAPKFPITEYLEFVGENEPIGSSVFTARATDMDKGDYGKLNYSIISAAASGYTDVDDSWKLFRVDALTGLVTTNAVFDYEARSRYAFTLLSTYSVWTRSLVWSRPMQCLIMRRGVVFDYEARSRYAFTLLSTDSGGRTCKVKVRVEIESRDEFHPQFTERTFKFILSGTDLPVGYVVGHLRLVRFRS
cccccccccccccEEEEEEEEEEccccEEEEccccccccEEEEEccccccccccccccEEEcccccEEEEcccccccccccEEEEEEEEEEcccccccccccEEEEEEEEEEEcccccccccccEEEEEEEcccccccEEEEEEcEEccccccEEEEEEEEEcccccccccccccccEEEEccccEEEEccccccccccEEEEEEEEEEcccccccccccccEEEEEEEcccccHHccccEEEEEEEccccccEEEEEEEEEEEEEcccccEEEEEEEEEEccccccccccEEEEEEEEEccc
cccEEEEEEcccccccccccccccEEEEEEccccccccEEEEEEcccccccccccccEEEEcccccEEEEEccccHHHccccEEEEEEEEcccccccccccccEEEEEEEEEEcccccccEccccEEEEEccccccccEEEEEEEEccccccccEEEEEEEcccccccccccccccEEEEEccccEEEEEccccHHHcccEEEEEEEEccccccccccEEEEEEEEEccccccccccccccccccccccccccEEEEEEEEEEEcccccccccccEEEEEEEcccccccccEEEEEEEEEccc
mktrslvwlqpmqclimrrgvvhRENIQVYLVWYGstsrlcrrtcgtiplsqQQRLAIqavdpltgvlsvqqpldydtgsseHLLILKvedggkppldsplssithlkitlqdendnapkfpiteylefvgenepigssvftaratdmdkgdygklNYSIISAAAsgytdvddswklFRVDALTGLvttnavfdYEARSRYAFTLLSTYSVWTRSlvwsrpmqclimrrgvvfdyeARSRYAFTLLstdsggrtckvKVRVEIesrdefhpqftERTFKFilsgtdlpvgyvvghlrlVRFRS
mktrslvwlqpmqCLIMRRGVVHRENIQVYLVWYGSTSRLCRRTCGTIPLSQQQRLAIQAVDPLTGVLSVQQPLDYDTGSSEHLLILKVEDGGKPPLDSPLSSITHLKITLQDENDNAPKFPITEYLEFVGENEPIGSSVFTARATDMDKGDYGKLNYSIISAAASGYTDVDDSWKLFRVDALTGlvttnavfdyeARSRYAFTLLSTYSVWTrslvwsrpmqcLIMRRGVVFDYEARSRYAFtllstdsggrtcKVKVRVeiesrdefhpqfteRTFKfilsgtdlpvgyvVGHLRLVRFRS
MKTRSLVWLQPMQCLIMRRGVVHRENIQVYLVWYGSTSRLCRRTCGTIPLSQQQRLAIQAVDPLTGVLSVQQPLDYDTGSSEHLLILKVEDGGKPPLDSPLSSITHLKITLQDENDNAPKFPITEYLEFVGENEPIGSSVFTARATDMDKGDYGKLNYSIISAAASGYTDVDDSWKLFRVDALTGLVTTNAVFDYEARSRYAFTLLSTYSVWTRSLVWSRPMQCLIMRRGVVFDYEARSRYAFTLLSTDSGGRTCKVKVRVEIESRDEFHPQFTERTFKFILSGTDLPVGYVVGHLRLVRFRS
*****LVWLQPMQCLIMRRGVVHRENIQVYLVWYGSTSRLCRRTCGTIPLSQQQRLAIQAVDPLTGVLSVQQPLDYDTGSSEHLLILKV***************THLKITL*******PKFPITEYLEFVGENEPIGSSVFTARATDMDKGDYGKLNYSIISAAASGYTDVDDSWKLFRVDALTGLVTTNAVFDYEARSRYAFTLLSTYSVWTRSLVWSRPMQCLIMRRGVVFDYEARSRYAFTLLSTDSGGRTCKVKVRVEIESRDEFHPQFTERTFKFILSGTDLPVGYVVGHLRLVRF**
MKTRSLVWLQPMQCLIMRRGVVHRENIQVYLVWYGSTSRLCRRTCGT***********QAVDPLTGVLSVQQPLDYDTGSSEHLLILKVEDGGKPPLDSPLSSITHLKITLQDENDNAPKFPITEYLEFVGENEPIGSSVFTARATDMDKGDYGKLNYSIISAAAS**TDVDDSWKLFRVDALTGLVTTNAVFDYEARSRYAFTLLSTYSVWTRSLVWSRPMQCLIMRRGVVFDYEARSRYAFTLLSTDSGGRTCKVKVRVEIESRDEFHPQFTERTFKFILSGTDLPVGYVVGHLRLVRFRS
MKTRSLVWLQPMQCLIMRRGVVHRENIQVYLVWYGSTSRLCRRTCGTIPLSQQQRLAIQAVDPLTGVLSVQQPLDYDTGSSEHLLILKVEDGGKPPLDSPLSSITHLKITLQDENDNAPKFPITEYLEFVGENEPIGSSVFTARATDMDKGDYGKLNYSIISAAASGYTDVDDSWKLFRVDALTGLVTTNAVFDYEARSRYAFTLLSTYSVWTRSLVWSRPMQCLIMRRGVVFDYEARSRYAFTLLSTDSGGRTCKVKVRVEIESRDEFHPQFTERTFKFILSGTDLPVGYVVGHLRLVRFRS
**TRSLVWLQPMQCLIMRRGVVHRENIQVYLVWYGSTSRLCRRTCGTIPLSQQQRLAIQAVDPLTGVLSVQQPLDYDTGSSEHLLILKVEDGGKPPLDSPLSSITHLKITLQDENDNAPKFPITEYLEFVGENEPIGSSVFTARATDMDKGDYGKLNYSIISAAASGYTDVDDSWKLFRVDALTGLVTTNAVFDYEARSRYAFTLLSTYSVWTRSLVWSRPMQCLIMRRGVVFDYEARSRYAFTLLSTDSGGRTCKVKVRVEIESRDEFHPQFTERTFKFILSGTDLPVGYVVGHLRLVRFRS
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKTRSLVWLQPMQCLIMRRGVVHRENIQVYLVWYGSTSRLCRRTCGTIPLSQQQRLAIQAVDPLTGVLSVQQPLDYDTGSSEHLLILKVEDGGKPPLDSPLSSITHLKITLQDENDNAPKFPITEYLEFVGENEPIGSSVFTARATDMDKGDYGKLNYSIISAAASGYTDVDDSWKLFRVDALTGLVTTNAVFDYEARSRYAFTLLSTYSVWTRSLVWSRPMQCLIMRRGVVFDYEARSRYAFTLLSTDSGGRTCKVKVRVEIESRDEFHPQFTERTFKFILSGTDLPVGYVVGHLRLVRFRS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query303 2.2.26 [Sep-21-2011]
Q24292 3503 Protein dachsous OS=Droso yes N/A 0.620 0.053 0.451 1e-47
Q9Y5G3 927 Protocadherin gamma-B1 OS no N/A 0.415 0.135 0.388 6e-16
Q5DRB0 927 Protocadherin gamma-B1 OS yes N/A 0.412 0.134 0.384 2e-15
Q9V5N8 3579 Protocadherin-like wing p no N/A 0.442 0.037 0.337 2e-15
Q9Y5F9 930 Protocadherin gamma-B6 OS no N/A 0.415 0.135 0.369 1e-14
Q5DRA6 930 Protocadherin gamma-B6 OS no N/A 0.415 0.135 0.369 1e-14
Q6V1P9 2916 Protocadherin-23 OS=Homo no N/A 0.564 0.058 0.293 2e-14
Q9NYQ6 3014 Cadherin EGF LAG seven-pa no N/A 0.445 0.044 0.331 1e-13
P33450 5147 Cadherin-related tumor su no N/A 0.438 0.025 0.342 3e-13
O35161 3034 Cadherin EGF LAG seven-pa no N/A 0.448 0.044 0.331 4e-13
>sp|Q24292|DS_DROME Protein dachsous OS=Drosophila melanogaster GN=ds PE=1 SV=3 Back     alignment and function desciption
 Score =  190 bits (482), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 107/237 (45%), Positives = 139/237 (58%), Gaps = 49/237 (20%)

Query: 61   VDPLTGVLSVQQPLDYDTGSSEHLLILKVEDGGKPPLDSPLSSITHLKITLQDENDNAPK 120
            +D +TGVL V   LDYD+G+  + LI++  D        PL S+   ++ L DENDN PK
Sbjct: 2752 IDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHH---QRPLCSLQPFRLELHDENDNEPK 2808

Query: 121  FPITEYLEFVGENEPIGSSVFTARATDMDKGDYGKLNYSIISAAASGYTDVDDSWKLFRV 180
            FP+TEY+ F+ ENEP+GSSVF A A+D+DKG +G+LNYSI  A +      + SWK+FRV
Sbjct: 2809 FPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSD-----ESSWKMFRV 2863

Query: 181  DALTGLVTTNAVFDYEARSRYAFTLLSTYSVWTRSLVWSRPMQCLIMRRGVVFDYEARSR 240
            D+ +GLVT+  VFDYE R RY                                D E    
Sbjct: 2864 DSESGLVTSAFVFDYEQRQRY--------------------------------DME---- 2887

Query: 241  YAFTLLSTDSGGRTCKVKVRVEIESRDEFHPQFTERTFKFIL-SGTDLPVGYVVGHL 296
                LL++D GG+   V VRVEIESRDEF PQFTERT++F+L +   LP GYVVG +
Sbjct: 2888 ----LLASDMGGKKASVAVRVEIESRDEFTPQFTERTYRFVLPAAVALPQGYVVGQV 2940
Involved in morphogenesis. May also be involved in cell adhesion.
Drosophila melanogaster (taxid: 7227)
>sp|Q9Y5G3|PCDGD_HUMAN Protocadherin gamma-B1 OS=Homo sapiens GN=PCDHGB1 PE=2 SV=1 Back     alignment and function description
>sp|Q5DRB0|PCDGD_PANTR Protocadherin gamma-B1 OS=Pan troglodytes GN=PCDHGB1 PE=3 SV=1 Back     alignment and function description
>sp|Q9V5N8|STAN_DROME Protocadherin-like wing polarity protein stan OS=Drosophila melanogaster GN=stan PE=1 SV=4 Back     alignment and function description
>sp|Q9Y5F9|PCDGI_HUMAN Protocadherin gamma-B6 OS=Homo sapiens GN=PCDHGB6 PE=2 SV=1 Back     alignment and function description
>sp|Q5DRA6|PCDGI_PANTR Protocadherin gamma-B6 OS=Pan troglodytes GN=PCDHGB6 PE=3 SV=1 Back     alignment and function description
>sp|Q6V1P9|PCD23_HUMAN Protocadherin-23 OS=Homo sapiens GN=DCHS2 PE=2 SV=1 Back     alignment and function description
>sp|Q9NYQ6|CELR1_HUMAN Cadherin EGF LAG seven-pass G-type receptor 1 OS=Homo sapiens GN=CELSR1 PE=1 SV=1 Back     alignment and function description
>sp|P33450|FAT_DROME Cadherin-related tumor suppressor OS=Drosophila melanogaster GN=ft PE=1 SV=3 Back     alignment and function description
>sp|O35161|CELR1_MOUSE Cadherin EGF LAG seven-pass G-type receptor 1 OS=Mus musculus GN=Celsr1 PE=2 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query303
270006362 3474 dachsous [Tribolium castaneum] 0.633 0.055 0.497 4e-56
157108477 3131 cadherin [Aedes aegypti] gi|108884003|gb 0.636 0.061 0.475 1e-55
170031843 2888 cadherin [Culex quinquefasciatus] gi|167 0.636 0.066 0.470 1e-54
350403194 3229 PREDICTED: protein dachsous-like [Bombus 0.831 0.078 0.422 3e-54
340728239 3327 PREDICTED: protein dachsous-like [Bombus 0.636 0.058 0.493 6e-54
380011903 2820 PREDICTED: LOW QUALITY PROTEIN: protein 0.636 0.068 0.485 7e-54
242024858 2799 Cadherin-23 precursor, putative [Pedicul 0.630 0.068 0.481 9e-54
328701666 3383 PREDICTED: protein dachsous-like [Acyrth 0.636 0.057 0.487 5e-53
383861450 2659 PREDICTED: protein dachsous-like [Megach 0.636 0.072 0.485 8e-53
328790020 3415 PREDICTED: protein dachsous-like [Apis m 0.636 0.056 0.472 2e-52
>gi|270006362|gb|EFA02810.1| dachsous [Tribolium castaneum] Back     alignment and taxonomy information
 Score =  224 bits (570), Expect = 4e-56,   Method: Compositional matrix adjust.
 Identities = 118/237 (49%), Positives = 152/237 (64%), Gaps = 45/237 (18%)

Query: 61   VDPLTGVLSVQQPLDYDTGSSEHLLILKVEDGGKPPLDSPLSSITHLKITLQDENDNAPK 120
            +D ++GVL V   LDYD G +E+ L+++  D        PL ++    I LQDENDN PK
Sbjct: 2729 LDVISGVLFVNGTLDYDDGVTEYNLVVRACDRAA----IPLCTLNTFSIELQDENDNEPK 2784

Query: 121  FPITEYLEFVGENEPIGSSVFTARATDMDKGDYGKLNYSIISAAASGYTDVDDSWKLFRV 180
            FP++EYLEFVGENE IG+SVFTA ATD+DKG +G LNYSI+SA++  Y   DDSW+LF +
Sbjct: 2785 FPVSEYLEFVGENESIGTSVFTAHATDLDKGAFGSLNYSIVSASSVNYPGTDDSWRLFNI 2844

Query: 181  DALTGLVTTNAVFDYEARSRYAFTLLSTYSVWTRSLVWSRPMQCLIMRRGVVFDYEARSR 240
            D+ TG+VTTN +FDYE +SRY F                      I+R            
Sbjct: 2845 DSSTGMVTTNVIFDYEQQSRYVF----------------------IVR------------ 2870

Query: 241  YAFTLLSTDSGGRTCKVKVRVEIESRDEFHPQFTERTFKFILSGT-DLPVGYVVGHL 296
                  +TD GG++  VKVRVEIES+DEFHPQFTERT+KF+L+ +  LPVGYVVGH+
Sbjct: 2871 ------ATDVGGKSSNVKVRVEIESKDEFHPQFTERTYKFVLATSVVLPVGYVVGHV 2921

Source: Tribolium castaneum

Species: Tribolium castaneum

Genus: Tribolium

Family: Tenebrionidae

Order: Coleoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|157108477|ref|XP_001650243.1| cadherin [Aedes aegypti] gi|108884003|gb|EAT48228.1| AAEL000700-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|170031843|ref|XP_001843793.1| cadherin [Culex quinquefasciatus] gi|167871192|gb|EDS34575.1| cadherin [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|350403194|ref|XP_003486727.1| PREDICTED: protein dachsous-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340728239|ref|XP_003402435.1| PREDICTED: protein dachsous-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|380011903|ref|XP_003690033.1| PREDICTED: LOW QUALITY PROTEIN: protein dachsous-like, partial [Apis florea] Back     alignment and taxonomy information
>gi|242024858|ref|XP_002432843.1| Cadherin-23 precursor, putative [Pediculus humanus corporis] gi|212518352|gb|EEB20105.1| Cadherin-23 precursor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|328701666|ref|XP_003241675.1| PREDICTED: protein dachsous-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|383861450|ref|XP_003706199.1| PREDICTED: protein dachsous-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|328790020|ref|XP_392300.4| PREDICTED: protein dachsous-like [Apis mellifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query303
FB|FBgn0000497 3503 ds "dachsous" [Drosophila mela 0.462 0.039 0.5 2e-49
UNIPROTKB|F1MCA2 681 F1MCA2 "Uncharacterized protei 0.511 0.227 0.348 8.5e-18
UNIPROTKB|F1LY95 3251 F1LY95 "Uncharacterized protei 0.419 0.039 0.315 2.2e-17
RGD|1309878 3278 Dchs1 "dachsous 1 (Drosophila) 0.468 0.043 0.341 4.5e-17
UNIPROTKB|F1PAT8 1288 DCHS2 "Uncharacterized protein 0.442 0.104 0.333 9.5e-17
ZFIN|ZDB-GENE-050208-41 3286 dchs1b "dachsous 1b (Drosophil 0.471 0.043 0.333 1.3e-12
UNIPROTKB|F1NB81 2475 F1NB81 "Uncharacterized protei 0.656 0.080 0.322 3.1e-13
UNIPROTKB|Q6V1P9 2916 DCHS2 "Protocadherin-23" [Homo 0.442 0.045 0.333 1.4e-16
UNIPROTKB|J9NZ92 2836 DCHS2 "Uncharacterized protein 0.442 0.047 0.333 5.7e-16
UNIPROTKB|E2R8V4 812 PCDHGB1 "Uncharacterized prote 0.402 0.150 0.402 7.2e-16
FB|FBgn0000497 ds "dachsous" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 363 (132.8 bits), Expect = 2.0e-49, Sum P(2) = 2.0e-49
 Identities = 74/148 (50%), Positives = 100/148 (67%)

Query:    61 VDPLTGVLSVQQPLDYDTGSSEHLLILKVEDGGKPPLDSPLSSITHLKITLQDENDNAPK 120
             +D +TGVL V   LDYD+G+  + LI++  D        PL S+   ++ L DENDN PK
Sbjct:  2752 IDLVTGVLFVNNRLDYDSGAKSYELIIRACDSHH---QRPLCSLQPFRLELHDENDNEPK 2808

Query:   121 FPITEYLEFVGENEPIGSSVFTARATDMDKGDYGKLNYSIISAAASGYTDVDDSWKLFRV 180
             FP+TEY+ F+ ENEP+GSSVF A A+D+DKG +G+LNYSI  A +      + SWK+FRV
Sbjct:  2809 FPLTEYVHFLAENEPVGSSVFRAHASDLDKGPFGQLNYSIGPAPSD-----ESSWKMFRV 2863

Query:   181 DALTGLVTTNAVFDYEARSRYAFTLLST 208
             D+ +GLVT+  VFDYE R RY   LL++
Sbjct:  2864 DSESGLVTSAFVFDYEQRQRYDMELLAS 2891
GO:0000904 "cell morphogenesis involved in differentiation" evidence=IMP
GO:0008283 "cell proliferation" evidence=IMP
GO:0005886 "plasma membrane" evidence=ISS
GO:0018149 "peptide cross-linking" evidence=IPI
GO:0016021 "integral to membrane" evidence=TAS
GO:0004872 "receptor activity" evidence=ISS
GO:0007156 "homophilic cell adhesion" evidence=IEA;ISS
GO:0050839 "cell adhesion molecule binding" evidence=ISS;IDA
GO:0016339 "calcium-dependent cell-cell adhesion" evidence=ISS
GO:0005887 "integral to plasma membrane" evidence=ISS
GO:0004871 "signal transducer activity" evidence=NAS
GO:0042067 "establishment of ommatidial planar polarity" evidence=IMP;TAS
GO:0016318 "ommatidial rotation" evidence=TAS
GO:0001737 "establishment of imaginal disc-derived wing hair orientation" evidence=IMP;TAS
GO:0045317 "equator specification" evidence=IMP
GO:0045198 "establishment of epithelial cell apical/basal polarity" evidence=IMP
GO:0007164 "establishment of tissue polarity" evidence=NAS
GO:0001736 "establishment of planar polarity" evidence=IGI;IMP;TAS
GO:0005509 "calcium ion binding" evidence=IEA
GO:0035222 "wing disc pattern formation" evidence=IMP
GO:0030010 "establishment of cell polarity" evidence=IMP
GO:0007480 "imaginal disc-derived leg morphogenesis" evidence=IMP
GO:0007476 "imaginal disc-derived wing morphogenesis" evidence=IMP
GO:0048592 "eye morphogenesis" evidence=IMP
GO:0016337 "cell-cell adhesion" evidence=IMP
GO:0035159 "regulation of tube length, open tracheal system" evidence=IMP
GO:0090176 "microtubule cytoskeleton organization involved in establishment of planar polarity" evidence=IMP
GO:0090175 "regulation of establishment of planar polarity" evidence=IGI
UNIPROTKB|F1MCA2 F1MCA2 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1LY95 F1LY95 "Uncharacterized protein" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
RGD|1309878 Dchs1 "dachsous 1 (Drosophila)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1PAT8 DCHS2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050208-41 dchs1b "dachsous 1b (Drosophila)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NB81 F1NB81 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q6V1P9 DCHS2 "Protocadherin-23" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|J9NZ92 DCHS2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E2R8V4 PCDHGB1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query303
cd1130498 cd11304, Cadherin_repeat, Cadherin tandem repeat d 2e-15
smart0011281 smart00112, CA, Cadherin repeats 3e-12
cd1130498 cd11304, Cadherin_repeat, Cadherin tandem repeat d 3e-11
pfam0002892 pfam00028, Cadherin, Cadherin domain 2e-10
smart0011281 smart00112, CA, Cadherin repeats 3e-09
pfam0002892 pfam00028, Cadherin, Cadherin domain 1e-04
>gnl|CDD|206637 cd11304, Cadherin_repeat, Cadherin tandem repeat domain Back     alignment and domain information 
 Score = 70.4 bits (173), Expect = 2e-15
 Identities = 30/82 (36%), Positives = 40/82 (48%), Gaps = 9/82 (10%)

Query: 125 EYLEFVGENEPIGSSVFTARATDMDKGDYGKLNYSIISAAASGYTDVDDSWKLFRVDALT 184
            Y   V EN P G+ V T  ATD D G+ G++ YSI+S          +   LF +D  T
Sbjct: 1   SYEVSVPENAPPGTVVLTVSATDPDSGENGEVTYSIVS---------GNEDGLFSIDPST 51

Query: 185 GLVTTNAVFDYEARSRYAFTLL 206
           G +TT    D E +S Y  T+ 
Sbjct: 52  GEITTAKPLDREEQSSYTLTVT 73

Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. The cadherin repeat domains occur as tandem repeats in the extracellular regions, which are thought to mediate cell-cell contact when bound to calcium. They play numerous roles in cell fate, signalling, proliferation, differentiation, and migration; members include E-, N-, P-, T-, VE-, CNR-, proto-, and FAT-family cadherin, desmocollin, and desmoglein, a large variety of domain architectures with varying repeat copy numbers. Cadherin-repeat containing proteins exist as monomers, homodimers, or heterodimers. Length = 98
>gnl|CDD|214520 smart00112, CA, Cadherin repeats Back     alignment and domain information
>gnl|CDD|206637 cd11304, Cadherin_repeat, Cadherin tandem repeat domain Back     alignment and domain information
>gnl|CDD|215665 pfam00028, Cadherin, Cadherin domain Back     alignment and domain information
>gnl|CDD|214520 smart00112, CA, Cadherin repeats Back     alignment and domain information
>gnl|CDD|215665 pfam00028, Cadherin, Cadherin domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 303
KOG4289|consensus 2531 100.0
KOG4289|consensus 2531 100.0
KOG1219|consensus 4289 100.0
KOG1219|consensus 4289 100.0
cd00031199 CA Cadherin repeat domain; Cadherins are glycoprot 99.97
cd00031199 CA Cadherin repeat domain; Cadherins are glycoprot 99.88
PF0002893 Cadherin: Cadherin domain; InterPro: IPR002126 Cad 99.75
KOG1834|consensus 952 99.71
smart0011279 CA Cadherin repeats. Cadherins are glycoproteins i 99.64
smart0011279 CA Cadherin repeats. Cadherins are glycoproteins i 99.49
PF0002893 Cadherin: Cadherin domain; InterPro: IPR002126 Cad 99.29
KOG1834|consensus 952 99.18
PF0875890 Cadherin_pro: Cadherin prodomain like; InterPro: I 97.63
PF0826684 Cadherin_2: Cadherin-like; InterPro: IPR013164 Cad 97.32
smart0073697 CADG Dystroglycan-type cadherin-like domains. Cadh 95.86
PF0826684 Cadherin_2: Cadherin-like; InterPro: IPR013164 Cad 95.42
TIGR0196599 VCBS_repeat VCBS repeat. This domain of about 100 95.11
PF13750158 Big_3_3: Bacterial Ig-like domain (group 3) 93.25
smart0073697 CADG Dystroglycan-type cadherin-like domains. Cadh 92.46
>KOG4289|consensus Back     alignment and domain information 
Probab=100.00  E-value=2.3e-40  Score=331.29  Aligned_cols=266  Identities=24%  Similarity=0.354  Sum_probs=228.2

Q ss_pred             EeeccccccccceEEEEEEe--cccCceeeeecccccccCCCCcccEEEeCCccEEEEcccCCCCCCCceEEEEEEEEEC
Q psy8640          15 LIMRRGVVHRENIQVYLVWY--GSTSRLCRRTCGTIPLSQQQRLAIQAVDPLTGVLSVQQPLDYDTGSSEHLLILKVEDG   92 (303)
Q Consensus        15 ~i~e~~~~~~~~~~~~~i~~--~~~~~~~~~~~~~~~~~~~~~~~~F~Id~~tG~l~~~~~LD~E~~~~~~~l~i~a~D~   92 (303)
                      .+-||..+|.++.+..+-.-  ..++.+.|+.      ..++..+.|.||+++|.|.+..+||||+.+. |.|.+.|+|.
T Consensus       277 ~lREn~evGy~vLtvrAtD~Dsp~Nani~Yrl------~eg~~~~~f~in~rSGvI~T~a~lDRE~~~~-y~L~VeAsDq  349 (2531)
T KOG4289|consen  277 ELRENLEVGYEVLTVRATDGDSPPNANIRYRL------LEGNAKNVFEINPRSGVISTRAPLDREELES-YQLDVEASDQ  349 (2531)
T ss_pred             HHhhccccCceEEEEEeccCCCCCCCceEEEe------cCCCccceeEEcCccceeeccCccCHHhhhh-eEEEEEeccC
Confidence            45677778888777766443  5677777754      3446778999999999999999999999999 9999999999


Q ss_pred             CCCCCCCCCeeEEEEEEEEEcCCCCCCcCCCCceEEEEeCCCCCCeEEEEEEEEeCCCCCCceEEEEEeeCCCCCCcccC
Q psy8640          93 GKPPLDSPLSSITHLKITLQDENDNAPKFPITEYLEFVGENEPIGSSVFTARATDMDKGDYGKLNYSIISAAASGYTDVD  172 (303)
Q Consensus        93 g~~~~~~~~s~~~~v~I~V~DvNDn~P~f~~~~~~~~V~E~~~~gt~v~~v~A~D~D~g~n~~i~Y~i~~~~~~~~~~~~  172 (303)
                      |.    ++...++.|.|.|.|+|||+|+|....|.+.|+|+..+++.|++|+|+|.|.|.|+++.|+|.+++..      
T Consensus       350 G~----~pgp~Ta~V~itV~D~NDNaPqFse~~Yvvqv~Edvt~~avvlrV~AtDrD~g~Ng~VHYsi~Sgn~~------  419 (2531)
T KOG4289|consen  350 GR----PPGPRTAMVEITVEDENDNAPQFSEKRYVVQVREDVTPPAVVLRVTATDRDKGTNGKVHYSIASGNGR------  419 (2531)
T ss_pred             CC----CCCCceEEEEEEEEecCCCCccccccceEEEecccCCCCceEEEEEecccCCCcCceEEEEeeccCcc------
Confidence            98    44455999999999999999999999999999999999999999999999999999999999998754      


Q ss_pred             CCcCcEEEECCCcEEEEcccCcccccceEEEEEEEEE------------EEeecccccCCC----------------ceE
Q psy8640         173 DSWKLFRVDALTGLVTTNAVFDYEARSRYAFTLLSTY------------SVWTRSLVWSRP----------------MQC  224 (303)
Q Consensus       173 ~~~~~F~Id~~tG~I~~~~~LD~e~~~~~~l~v~a~~------------~~~~~~~~~~~~----------------~~~  224 (303)
                         +.|.||..||+|.+..+||||.. .|++.|+|.+            .+..-.++.+.|                ...
T Consensus       420 ---G~f~id~~tGel~vv~plD~e~~-~ytl~IrAqDggrPpLsn~sgl~iqVlDINDhaPifvstpfq~tvlEnv~lg~  495 (2531)
T KOG4289|consen  420 ---GQFYIDSLTGELDVVEPLDFENS-EYTLRIRAQDGGRPPLSNTSGLVIQVLDINDHAPIFVSTPFQATVLENVPLGY  495 (2531)
T ss_pred             ---ccEEEecccceEEEeccccccCC-eeEEEEEcccCCCCCccCCCceEEEEEecCCCCceeEechhhhhhhhcccccc
Confidence               88999999999999999999998 8999999862            123333333333                222


Q ss_pred             EE----------------------------------eecCceeeeeeecEEEEEEEEEECCCC--eEEEEEEEEEeecCC
Q psy8640         225 LI----------------------------------MRRGVVFDYEARSRYAFTLLSTDSGGR--TCKVKVRVEIESRDE  268 (303)
Q Consensus       225 ~i----------------------------------~~~~~~lD~E~~~~y~l~V~a~D~g~~--s~~~~v~I~V~DvNd  268 (303)
                      .+                                  +...+.||||+.+.|.|.|.|+|.|.+  ++++.|.|.|+|+||
T Consensus       496 ~v~~vqaidadsg~na~l~y~laG~~pf~I~~~SG~Itvtk~ldrEt~~~ysl~V~ard~gtp~l~tstsI~Vtv~dvnd  575 (2531)
T KOG4289|consen  496 LVCHVQAIDADSGENARLHYSLAGVGPFQINNGSGWITVTKELDRETVEHYSLGVEARDHGTPPLSTSTSISVTVLDVND  575 (2531)
T ss_pred             eEEEEecccCCCCcccceeeeeccCCCeeEecCCceEEEeecccccccceEEEEEEEcCCCCCcccccceEEEEecccCC
Confidence            11                                  122367999999999999999999986  778899999999999


Q ss_pred             CCCeeCCCeeEEE-ecCCCCCCCcEEEEEEEEeCCC
Q psy8640         269 FHPQFTERTFKFI-LSGTDLPVGYVVGHLRLVRFRS  303 (303)
Q Consensus       269 n~P~F~~~~y~~~-~e~~~~p~gt~v~~v~A~D~D~  303 (303)
                      |.|+|+++.|++. .|++  |.|+.|.+|+|+|.|.
T Consensus       576 ndP~Ft~~eytl~inED~--pvgsSI~tvtAvD~d~  609 (2531)
T KOG4289|consen  576 NDPTFTQKEYTLRINEDA--PVGSSIVTVTAVDRDA  609 (2531)
T ss_pred             CCCccccCceEEEecCCc--cccceEEEEEEecccc
Confidence            9999999999999 9999  7999999999999983

>KOG4289|consensus Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>cd00031 CA Cadherin repeat domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion; these domains occur as repeats in the extracellular regions which are thought to mediate cell-cell contact when bound to calcium; plays a role in cell fate, signalling, proliferation, differentiation, and migration; members include E-, N-, P-, T-, VE-,CNR-,proto-,and FAT-family cadherin, desmocollin, and desmoglein, exists as monomers or dimers (hetero- and homo-); two copies of the repeat are present here Back     alignment and domain information
>cd00031 CA Cadherin repeat domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion; these domains occur as repeats in the extracellular regions which are thought to mediate cell-cell contact when bound to calcium; plays a role in cell fate, signalling, proliferation, differentiation, and migration; members include E-, N-, P-, T-, VE-,CNR-,proto-,and FAT-family cadherin, desmocollin, and desmoglein, exists as monomers or dimers (hetero- and homo-); two copies of the repeat are present here Back     alignment and domain information
>PF00028 Cadherin: Cadherin domain; InterPro: IPR002126 Cadherins are a family of adhesion molecules that mediate Ca2+-dependent cell-cell adhesion in all solid tissues of the organism which modulate a wide variety of processes including cell polarisation and migration [, ,] Back     alignment and domain information
>KOG1834|consensus Back     alignment and domain information
>smart00112 CA Cadherin repeats Back     alignment and domain information
>smart00112 CA Cadherin repeats Back     alignment and domain information
>PF00028 Cadherin: Cadherin domain; InterPro: IPR002126 Cadherins are a family of adhesion molecules that mediate Ca2+-dependent cell-cell adhesion in all solid tissues of the organism which modulate a wide variety of processes including cell polarisation and migration [, ,] Back     alignment and domain information
>KOG1834|consensus Back     alignment and domain information
>PF08758 Cadherin_pro: Cadherin prodomain like; InterPro: IPR014868 Cadherins are a group of proteins that mediate calcium dependent cell-cell adhesion Back     alignment and domain information
>PF08266 Cadherin_2: Cadherin-like; InterPro: IPR013164 Cadherins are a family of adhesion molecules that mediate Ca2+-dependent cell-cell adhesion in all solid tissues of the organism which modulate a wide variety of processes including cell polarisation and migration [, ,] Back     alignment and domain information
>smart00736 CADG Dystroglycan-type cadherin-like domains Back     alignment and domain information
>PF08266 Cadherin_2: Cadherin-like; InterPro: IPR013164 Cadherins are a family of adhesion molecules that mediate Ca2+-dependent cell-cell adhesion in all solid tissues of the organism which modulate a wide variety of processes including cell polarisation and migration [, ,] Back     alignment and domain information
>TIGR01965 VCBS_repeat VCBS repeat Back     alignment and domain information
>PF13750 Big_3_3: Bacterial Ig-like domain (group 3) Back     alignment and domain information
>smart00736 CADG Dystroglycan-type cadherin-like domains Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query303
2wcp_A214 Crystal Structure Of Mouse Cadherin-23 Ec1-2 Length 1e-11
3mvs_A210 Structure Of The N-Terminus Of Cadherin 23 Length = 1e-11
4aqe_A214 Crystal Structure Of Deafness Associated Mutant Mou 3e-11
2wd0_A214 Crystal Structure Of Nonsyndromic Deafness (Dfnb12) 9e-11
3ubh_A419 Crystal Structure Of Drosophila N-Cadherin Ec1-4 Le 8e-08
1ncj_A215 N-Cadherin, Two-Domain Fragment Length = 215 2e-07
2qvi_A215 Crystal Structure Of N-Cadherin Domains Ec12 Length 3e-07
3q2w_A 559 Crystal Structure Of Mouse N-Cadherin Ectodomain Le 6e-07
4apx_B242 Crystal Structure Of Mouse Cadherin-23 Ec1-2 And Pr 5e-06
2a4e_A215 Crystal Structure Of Mouse Cadherin-11 Ec1-2 Length 8e-06
2ee0_A114 Solution Structures Of The Ca Domain Of Human Proto 3e-05
3k5s_A217 Crystal Structure Of Chicken T-Cadherin Ec1 Ec2 Len 2e-04
2yst_A119 Solution Structure Of The Third Cadherin Domain Fro 2e-04
2a62_A322 Crystal Structure Of Mouse Cadherin-8 Ec1-3 Length 3e-04
>pdb|2WCP|A Chain A, Crystal Structure Of Mouse Cadherin-23 Ec1-2 Length = 214 Back     alignment and structure 
Iteration: 1

 Score = 67.0 bits (162), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 58/187 (31%), Positives = 82/187 (43%), Gaps = 27/187 (14%)
Query: 36  STSRLCRRTCGTIPL----SQQQRLAIQAVDPLTGVLSVQQPLDYDTGSSEHLLILKVED 91
           S ++L  R     PL    S ++     AV+P TGV+ ++QPLD +T  SE  +   V D
Sbjct: 29  SVTQLLARDMDNDPLVFGVSGEEASRFFAVEPDTGVVWLRQPLDRET-KSEFTVEFSVSD 87
Query: 92  GGKPPLDSPLSSITHLKITLQ--DENDNAPKFPITEYLEFVGENEPIGSSVFTARATDMD 149
                       +   K+ +Q  D NDNAP F    Y   + EN P+G+ +F   ATD D
Sbjct: 88  H---------QGVITRKVNIQVGDVNDNAPTFHNQPYSVRIPENTPVGTPIFIVNATDPD 138
Query: 150 KGDYGKLNYSIISAAASGYTDVDDSWKLFRVDALTGLVTTNAVFDYEARSRYAFTLLSTY 209
            G  G + YS    +             F +D+  G+VT     DYE    Y  T+ +T 
Sbjct: 139 LGAGGSVLYSFQPPS-----------PFFAIDSARGIVTVIQELDYEVTQAYQLTVNATD 187
Query: 210 SVWTRSL 216
              TR L
Sbjct: 188 QDKTRPL 194
>pdb|3MVS|A Chain A, Structure Of The N-Terminus Of Cadherin 23 Length = 210 Back     alignment and structure
>pdb|4AQE|A Chain A, Crystal Structure Of Deafness Associated Mutant Mouse Cadherin-23 Ec1-2s70p And Protocadherin-15 Ec1-2 Form I Length = 214 Back     alignment and structure
>pdb|2WD0|A Chain A, Crystal Structure Of Nonsyndromic Deafness (Dfnb12) Associated Mutant D124g Of Mouse Cadherin-23 Ec1-2 Length = 214 Back     alignment and structure
>pdb|3UBH|A Chain A, Crystal Structure Of Drosophila N-Cadherin Ec1-4 Length = 419 Back     alignment and structure
>pdb|1NCJ|A Chain A, N-Cadherin, Two-Domain Fragment Length = 215 Back     alignment and structure
>pdb|2QVI|A Chain A, Crystal Structure Of N-Cadherin Domains Ec12 Length = 215 Back     alignment and structure
>pdb|3Q2W|A Chain A, Crystal Structure Of Mouse N-Cadherin Ectodomain Length = 559 Back     alignment and structure
>pdb|4APX|B Chain B, Crystal Structure Of Mouse Cadherin-23 Ec1-2 And Protocadherin-15 Ec1-2 Form I Length = 242 Back     alignment and structure
>pdb|2A4E|A Chain A, Crystal Structure Of Mouse Cadherin-11 Ec1-2 Length = 215 Back     alignment and structure
>pdb|2EE0|A Chain A, Solution Structures Of The Ca Domain Of Human Protocadherin 9 Length = 114 Back     alignment and structure
>pdb|3K5S|A Chain A, Crystal Structure Of Chicken T-Cadherin Ec1 Ec2 Length = 217 Back     alignment and structure
>pdb|2YST|A Chain A, Solution Structure Of The Third Cadherin Domain From Human Protocadherin 7 Length = 119 Back     alignment and structure
>pdb|2A62|A Chain A, Crystal Structure Of Mouse Cadherin-8 Ec1-3 Length = 322 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query303
3mvs_A210 Cadherin-23, otocadherin; adhesion, extracellular 1e-35
3mvs_A210 Cadherin-23, otocadherin; adhesion, extracellular 5e-17
3mvs_A210 Cadherin-23, otocadherin; adhesion, extracellular 3e-11
3qrb_A213 Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus mu 2e-34
3qrb_A213 Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus mu 1e-09
3qrb_A213 Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus mu 2e-04
2qvi_A215 Cadherin-2; beta barrel, strand SWAP, domain SWAP, 2e-34
2qvi_A215 Cadherin-2; beta barrel, strand SWAP, domain SWAP, 1e-10
3ppe_A203 Vascular endothelial cadherin; extracellular cadhe 3e-33
3ppe_A203 Vascular endothelial cadherin; extracellular cadhe 9e-07
3ppe_A203 Vascular endothelial cadherin; extracellular cadhe 1e-04
3q2v_A 550 Cadherin-1; cell adhesion, calcium binding; HET: M 4e-33
3q2v_A550 Cadherin-1; cell adhesion, calcium binding; HET: M 9e-28
3q2v_A 550 Cadherin-1; cell adhesion, calcium binding; HET: M 4e-21
3q2v_A550 Cadherin-1; cell adhesion, calcium binding; HET: M 2e-17
3q2v_A 550 Cadherin-1; cell adhesion, calcium binding; HET: M 2e-06
3q2v_A550 Cadherin-1; cell adhesion, calcium binding; HET: M 3e-04
3k5r_A218 Cadherin 13; mouse, structural protein; 2.00A {Mus 4e-33
3k5r_A218 Cadherin 13; mouse, structural protein; 2.00A {Mus 3e-09
2a4e_A215 Cadherin-11; dimer, calcium binding, cell adhesion 9e-33
2a4e_A215 Cadherin-11; dimer, calcium binding, cell adhesion 4e-10
2a4e_A215 Cadherin-11; dimer, calcium binding, cell adhesion 2e-09
3q2w_A 559 Cadherin-2; cell adhesion, calcium binding; HET: M 1e-32
3q2w_A559 Cadherin-2; cell adhesion, calcium binding; HET: M 6e-27
3q2w_A 559 Cadherin-2; cell adhesion, calcium binding; HET: M 5e-22
3q2w_A559 Cadherin-2; cell adhesion, calcium binding; HET: M 5e-18
3q2w_A559 Cadherin-2; cell adhesion, calcium binding; HET: M 5e-08
3q2w_A 559 Cadherin-2; cell adhesion, calcium binding; HET: M 4e-06
1l3w_A 546 EP-cadherin, C-cadherin; cell adhesion, calcium bi 1e-32
1l3w_A546 EP-cadherin, C-cadherin; cell adhesion, calcium bi 4e-26
1l3w_A 546 EP-cadherin, C-cadherin; cell adhesion, calcium bi 2e-20
1l3w_A546 EP-cadherin, C-cadherin; cell adhesion, calcium bi 3e-17
1l3w_A 546 EP-cadherin, C-cadherin; cell adhesion, calcium bi 5e-06
3ubf_A316 Neural-cadherin; cell adhesion; 2.50A {Drosophila 2e-32
3ubf_A316 Neural-cadherin; cell adhesion; 2.50A {Drosophila 4e-29
3ubf_A316 Neural-cadherin; cell adhesion; 2.50A {Drosophila 5e-09
3ubf_A 316 Neural-cadherin; cell adhesion; 2.50A {Drosophila 3e-07
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 6e-32
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 8e-26
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 4e-21
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 6e-17
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 3e-12
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 2e-10
3lnd_A207 CDH6 protein, cadherin 6; cell adhesion, cell memb 6e-32
3lnd_A207 CDH6 protein, cadherin 6; cell adhesion, cell memb 1e-09
3ubh_A 419 Neural-cadherin; cell adhesion; 2.70A {Drosophila 6e-30
3ubh_A419 Neural-cadherin; cell adhesion; 2.70A {Drosophila 2e-27
3ubh_A419 Neural-cadherin; cell adhesion; 2.70A {Drosophila 5e-24
3ubh_A419 Neural-cadherin; cell adhesion; 2.70A {Drosophila 4e-06
3ubh_A 419 Neural-cadherin; cell adhesion; 2.70A {Drosophila 4e-05
2x2u_A246 Proto-oncogene tyrosine-protein kinase receptor RE 3e-29
2x2u_A246 Proto-oncogene tyrosine-protein kinase receptor RE 2e-13
2x2u_A246 Proto-oncogene tyrosine-protein kinase receptor RE 5e-13
2a62_A322 Cadherin-8; extracellular domain, homodimer, calci 3e-28
2a62_A322 Cadherin-8; extracellular domain, homodimer, calci 2e-25
2a62_A 322 Cadherin-8; extracellular domain, homodimer, calci 2e-09
2yst_A119 Protocadherin-7; BH-PCDH, beta-sandwich, structura 4e-22
2yst_A119 Protocadherin-7; BH-PCDH, beta-sandwich, structura 4e-09
2ee0_A114 Protocadherin-9; Ca domain, structural genomics, N 5e-21
1ncg_A110 N-cadherin; cell adhesion protein; 2.10A {Mus musc 3e-13
1ncg_A110 N-cadherin; cell adhesion protein; 2.10A {Mus musc 3e-11
2yqg_A123 Desmoglein-2, HDGC; cadherin, structural genomics, 5e-13
2yqg_A123 Desmoglein-2, HDGC; cadherin, structural genomics, 1e-09
3k6f_A100 T-cadherin; cell adhesion, calcium, cell membrane, 5e-11
3k6f_A100 T-cadherin; cell adhesion, calcium, cell membrane, 8e-05
3k6d_A99 T-cadherin; cell adhesion; 1.80A {Xenopus laevis} 1e-10
3k6d_A99 T-cadherin; cell adhesion; 1.80A {Xenopus laevis} 7e-05
2omz_B105 Epithelial-cadherin; leucine-rich-repeat, nvasion 3e-10
2omz_B105 Epithelial-cadherin; leucine-rich-repeat, nvasion 9e-07
1zvn_A99 Mn-cadherin; strand dimer, ----; 2.16A {Gallus gal 1e-09
1zvn_A99 Mn-cadherin; strand dimer, ----; 2.16A {Gallus gal 3e-05
3k6i_A99 T-cadherin; cell adhesion, alternative splicing, c 2e-09
3k6i_A99 T-cadherin; cell adhesion, alternative splicing, c 4e-05
1zxk_A98 Cadherin-8; strand dimer, cell adhesion; 2.00A {Mu 9e-08
1zxk_A98 Cadherin-8; strand dimer, cell adhesion; 2.00A {Mu 4e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 9e-07
1wyj_A125 Protocadherin beta 14; SS bond, structural genomic 4e-04
>3mvs_A Cadherin-23, otocadherin; adhesion, extracellular domain, cell adhesion; 1.10A {Mus musculus} PDB: 2wcp_A 2whv_A 2wd0_A 2wbx_A Length = 210 Back     alignment and structure
 Score =  126 bits (320), Expect = 1e-35
 Identities = 47/146 (32%), Positives = 65/146 (44%), Gaps = 19/146 (13%)

Query: 60  AVDPLTGVLSVQQPLDYDTGSSEHLLILKVEDGGKPPLDSPLSSITHLKITLQDENDNAP 119
           AV+P TGV+ ++QPLD +T  SE  +   V D               + I + D NDNAP
Sbjct: 56  AVEPDTGVVWLRQPLDRET-KSEFTVEFSVSDHQGVIT-------RKVNIQVGDVNDNAP 107

Query: 120 KFPITEYLEFVGENEPIGSSVFTARATDMDKGDYGKLNYSIISAAASGYTDVDDSWKLFR 179
            F    Y   + EN P+G+ +F   ATD D G  G + YS    +             F 
Sbjct: 108 TFHNQPYSVRIPENTPVGTPIFIVNATDPDLGAGGSVLYSFQPPS-----------PFFA 156

Query: 180 VDALTGLVTTNAVFDYEARSRYAFTL 205
           +D+  G+VT     DYE    Y  T+
Sbjct: 157 IDSARGIVTVIQELDYEVTQAYQLTV 182
>3mvs_A Cadherin-23, otocadherin; adhesion, extracellular domain, cell adhesion; 1.10A {Mus musculus} PDB: 2wcp_A 2whv_A 2wd0_A 2wbx_A Length = 210 Back     alignment and structure
>3mvs_A Cadherin-23, otocadherin; adhesion, extracellular domain, cell adhesion; 1.10A {Mus musculus} PDB: 2wcp_A 2whv_A 2wd0_A 2wbx_A Length = 210 Back     alignment and structure
>3qrb_A Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus musculus} PDB: 1ff5_A 3lng_A 2qvf_B 1edh_A 3lne_A 1q1p_A 3lni_A 3q2l_A* 3q2n_A* 3lnh_A 3lnf_A 2o72_A 1suh_A Length = 213 Back     alignment and structure
>3qrb_A Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus musculus} PDB: 1ff5_A 3lng_A 2qvf_B 1edh_A 3lne_A 1q1p_A 3lni_A 3q2l_A* 3q2n_A* 3lnh_A 3lnf_A 2o72_A 1suh_A Length = 213 Back     alignment and structure
>3qrb_A Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus musculus} PDB: 1ff5_A 3lng_A 2qvf_B 1edh_A 3lne_A 1q1p_A 3lni_A 3q2l_A* 3q2n_A* 3lnh_A 3lnf_A 2o72_A 1suh_A Length = 213 Back     alignment and structure
>2qvi_A Cadherin-2; beta barrel, strand SWAP, domain SWAP, calcium, cell adhesion, cleavage on PAIR of basic residues, glycoprotein, membrane; 3.01A {Mus musculus} SCOP: b.1.6.1 b.1.6.1 PDB: 1ncj_A Length = 215 Back     alignment and structure
>2qvi_A Cadherin-2; beta barrel, strand SWAP, domain SWAP, calcium, cell adhesion, cleavage on PAIR of basic residues, glycoprotein, membrane; 3.01A {Mus musculus} SCOP: b.1.6.1 b.1.6.1 PDB: 1ncj_A Length = 215 Back     alignment and structure
>3ppe_A Vascular endothelial cadherin; extracellular cadherin (EC) domain, beta barrel, IG-domain L domain swapped dimer interface; 2.10A {Gallus gallus} Length = 203 Back     alignment and structure
>3ppe_A Vascular endothelial cadherin; extracellular cadherin (EC) domain, beta barrel, IG-domain L domain swapped dimer interface; 2.10A {Gallus gallus} Length = 203 Back     alignment and structure
>3ppe_A Vascular endothelial cadherin; extracellular cadherin (EC) domain, beta barrel, IG-domain L domain swapped dimer interface; 2.10A {Gallus gallus} Length = 203 Back     alignment and structure
>3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Length = 550 Back     alignment and structure
>3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Length = 550 Back     alignment and structure
>3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Length = 550 Back     alignment and structure
>3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Length = 550 Back     alignment and structure
>3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Length = 550 Back     alignment and structure
>3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Length = 550 Back     alignment and structure
>3k5r_A Cadherin 13; mouse, structural protein; 2.00A {Mus musculus} PDB: 3k5s_A Length = 218 Back     alignment and structure
>3k5r_A Cadherin 13; mouse, structural protein; 2.00A {Mus musculus} PDB: 3k5s_A Length = 218 Back     alignment and structure
>2a4e_A Cadherin-11; dimer, calcium binding, cell adhesion; 3.20A {Mus musculus} Length = 215 Back     alignment and structure
>2a4e_A Cadherin-11; dimer, calcium binding, cell adhesion; 3.20A {Mus musculus} Length = 215 Back     alignment and structure
>2a4e_A Cadherin-11; dimer, calcium binding, cell adhesion; 3.20A {Mus musculus} Length = 215 Back     alignment and structure
>3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Length = 559 Back     alignment and structure
>3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Length = 559 Back     alignment and structure
>3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Length = 559 Back     alignment and structure
>3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Length = 559 Back     alignment and structure
>3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Length = 559 Back     alignment and structure
>3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Length = 559 Back     alignment and structure
>1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Length = 546 Back     alignment and structure
>1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Length = 546 Back     alignment and structure
>1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Length = 546 Back     alignment and structure
>1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Length = 546 Back     alignment and structure
>1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Length = 546 Back     alignment and structure
>3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A Length = 316 Back     alignment and structure
>3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A Length = 316 Back     alignment and structure
>3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A Length = 316 Back     alignment and structure
>3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A Length = 316 Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 Back     alignment and structure
>3lnd_A CDH6 protein, cadherin 6; cell adhesion, cell membrane, membrane, transmembr; 2.82A {Mus musculus} Length = 207 Back     alignment and structure
>3lnd_A CDH6 protein, cadherin 6; cell adhesion, cell membrane, membrane, transmembr; 2.82A {Mus musculus} Length = 207 Back     alignment and structure
>3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Length = 419 Back     alignment and structure
>3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Length = 419 Back     alignment and structure
>3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Length = 419 Back     alignment and structure
>3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Length = 419 Back     alignment and structure
>3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Length = 419 Back     alignment and structure
>2x2u_A Proto-oncogene tyrosine-protein kinase receptor RET; hirschsprung disease, extracellular domain, disease mutation, transferase, glycoprotein; HET: NAG SO4; 2.00A {Homo sapiens} Length = 246 Back     alignment and structure
>2x2u_A Proto-oncogene tyrosine-protein kinase receptor RET; hirschsprung disease, extracellular domain, disease mutation, transferase, glycoprotein; HET: NAG SO4; 2.00A {Homo sapiens} Length = 246 Back     alignment and structure
>2x2u_A Proto-oncogene tyrosine-protein kinase receptor RET; hirschsprung disease, extracellular domain, disease mutation, transferase, glycoprotein; HET: NAG SO4; 2.00A {Homo sapiens} Length = 246 Back     alignment and structure
>2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} Length = 322 Back     alignment and structure
>2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} Length = 322 Back     alignment and structure
>2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} Length = 322 Back     alignment and structure
>2yst_A Protocadherin-7; BH-PCDH, beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2yst_A Protocadherin-7; BH-PCDH, beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2ee0_A Protocadherin-9; Ca domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>1ncg_A N-cadherin; cell adhesion protein; 2.10A {Mus musculus} SCOP: b.1.6.1 PDB: 1nch_A 1nci_A Length = 110 Back     alignment and structure
>1ncg_A N-cadherin; cell adhesion protein; 2.10A {Mus musculus} SCOP: b.1.6.1 PDB: 1nch_A 1nci_A Length = 110 Back     alignment and structure
>2yqg_A Desmoglein-2, HDGC; cadherin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2yqg_A Desmoglein-2, HDGC; cadherin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>3k6f_A T-cadherin; cell adhesion, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein, membrane; 1.81A {Mus musculus} Length = 100 Back     alignment and structure
>3k6f_A T-cadherin; cell adhesion, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein, membrane; 1.81A {Mus musculus} Length = 100 Back     alignment and structure
>3k6d_A T-cadherin; cell adhesion; 1.80A {Xenopus laevis} PDB: 2v37_A Length = 99 Back     alignment and structure
>3k6d_A T-cadherin; cell adhesion; 1.80A {Xenopus laevis} PDB: 2v37_A Length = 99 Back     alignment and structure
>2omz_B Epithelial-cadherin; leucine-rich-repeat, nvasion protein, IG-like domain, adhesi protein, cell invasion-cell adhesion complex; 1.60A {Homo sapiens} SCOP: b.1.6.1 PDB: 2omt_B 2omu_B 2omv_B 1o6s_B 2omy_B 2omx_B 3ff8_A 3ff7_A 2omw_B Length = 105 Back     alignment and structure
>2omz_B Epithelial-cadherin; leucine-rich-repeat, nvasion protein, IG-like domain, adhesi protein, cell invasion-cell adhesion complex; 1.60A {Homo sapiens} SCOP: b.1.6.1 PDB: 2omt_B 2omu_B 2omv_B 1o6s_B 2omy_B 2omx_B 3ff8_A 3ff7_A 2omw_B Length = 105 Back     alignment and structure
>1zvn_A Mn-cadherin; strand dimer, ----; 2.16A {Gallus gallus} Length = 99 Back     alignment and structure
>1zvn_A Mn-cadherin; strand dimer, ----; 2.16A {Gallus gallus} Length = 99 Back     alignment and structure
>3k6i_A T-cadherin; cell adhesion, alternative splicing, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein; 1.13A {Gallus gallus} Length = 99 Back     alignment and structure
>3k6i_A T-cadherin; cell adhesion, alternative splicing, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein; 1.13A {Gallus gallus} Length = 99 Back     alignment and structure
>1zxk_A Cadherin-8; strand dimer, cell adhesion; 2.00A {Mus musculus} PDB: 2a4c_A Length = 98 Back     alignment and structure
>1zxk_A Cadherin-8; strand dimer, cell adhesion; 2.00A {Mus musculus} PDB: 2a4c_A Length = 98 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1wyj_A Protocadherin beta 14; SS bond, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Mus musculus} Length = 125 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query303
3q2w_A 559 Cadherin-2; cell adhesion, calcium binding; HET: M 100.0
3q2v_A 550 Cadherin-1; cell adhesion, calcium binding; HET: M 100.0
2a62_A322 Cadherin-8; extracellular domain, homodimer, calci 100.0
1l3w_A 546 EP-cadherin, C-cadherin; cell adhesion, calcium bi 100.0
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 100.0
3ubh_A419 Neural-cadherin; cell adhesion; 2.70A {Drosophila 100.0
2a4e_A215 Cadherin-11; dimer, calcium binding, cell adhesion 100.0
3ubf_A316 Neural-cadherin; cell adhesion; 2.50A {Drosophila 100.0
3q2v_A550 Cadherin-1; cell adhesion, calcium binding; HET: M 100.0
3q2w_A559 Cadherin-2; cell adhesion, calcium binding; HET: M 100.0
2x2u_A246 Proto-oncogene tyrosine-protein kinase receptor RE 100.0
1l3w_A546 EP-cadherin, C-cadherin; cell adhesion, calcium bi 100.0
2qvi_A215 Cadherin-2; beta barrel, strand SWAP, domain SWAP, 100.0
3qrb_A213 Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus mu 100.0
3mvs_A210 Cadherin-23, otocadherin; adhesion, extracellular 100.0
3k5r_A218 Cadherin 13; mouse, structural protein; 2.00A {Mus 100.0
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 100.0
3ppe_A203 Vascular endothelial cadherin; extracellular cadhe 100.0
3lnd_A207 CDH6 protein, cadherin 6; cell adhesion, cell memb 100.0
3ubf_A316 Neural-cadherin; cell adhesion; 2.50A {Drosophila 100.0
2a62_A322 Cadherin-8; extracellular domain, homodimer, calci 99.97
3ubh_A419 Neural-cadherin; cell adhesion; 2.70A {Drosophila 99.97
4apx_B242 Protocadherin-15, otocadherin; cell adhesion, hear 99.96
2yst_A119 Protocadherin-7; BH-PCDH, beta-sandwich, structura 99.96
2ee0_A114 Protocadherin-9; Ca domain, structural genomics, N 99.94
3mvs_A210 Cadherin-23, otocadherin; adhesion, extracellular 99.94
2a4e_A215 Cadherin-11; dimer, calcium binding, cell adhesion 99.92
2qvi_A215 Cadherin-2; beta barrel, strand SWAP, domain SWAP, 99.92
3qrb_A213 Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus mu 99.91
3ppe_A203 Vascular endothelial cadherin; extracellular cadhe 99.9
3k5r_A218 Cadherin 13; mouse, structural protein; 2.00A {Mus 99.9
2x2u_A246 Proto-oncogene tyrosine-protein kinase receptor RE 99.9
3lnd_A207 CDH6 protein, cadherin 6; cell adhesion, cell memb 99.9
2yqg_A123 Desmoglein-2, HDGC; cadherin, structural genomics, 99.89
1ncg_A110 N-cadherin; cell adhesion protein; 2.10A {Mus musc 99.84
1wyj_A125 Protocadherin beta 14; SS bond, structural genomic 99.82
4apx_B242 Protocadherin-15, otocadherin; cell adhesion, hear 99.79
1ncg_A110 N-cadherin; cell adhesion protein; 2.10A {Mus musc 99.76
2yqg_A123 Desmoglein-2, HDGC; cadherin, structural genomics, 99.75
1zxk_A98 Cadherin-8; strand dimer, cell adhesion; 2.00A {Mu 99.74
1zvn_A99 Mn-cadherin; strand dimer, ----; 2.16A {Gallus gal 99.74
3k6d_A99 T-cadherin; cell adhesion; 1.80A {Xenopus laevis} 99.7
3k6f_A100 T-cadherin; cell adhesion, calcium, cell membrane, 99.68
3k6i_A99 T-cadherin; cell adhesion, alternative splicing, c 99.68
2omz_B105 Epithelial-cadherin; leucine-rich-repeat, nvasion 99.67
2yst_A119 Protocadherin-7; BH-PCDH, beta-sandwich, structura 99.62
2omz_B105 Epithelial-cadherin; leucine-rich-repeat, nvasion 99.61
1wyj_A125 Protocadherin beta 14; SS bond, structural genomic 99.57
3k6i_A99 T-cadherin; cell adhesion, alternative splicing, c 99.55
1wuz_A103 Pcdha4 protein, CNR-EC1; cadherin, heteronuclear p 99.55
3k6f_A100 T-cadherin; cell adhesion, calcium, cell membrane, 99.53
3k6d_A99 T-cadherin; cell adhesion; 1.80A {Xenopus laevis} 99.49
1zvn_A99 Mn-cadherin; strand dimer, ----; 2.16A {Gallus gal 99.49
1zxk_A98 Cadherin-8; strand dimer, cell adhesion; 2.00A {Mu 99.48
2ee0_A114 Protocadherin-9; Ca domain, structural genomics, N 99.38
1wuz_A103 Pcdha4 protein, CNR-EC1; cadherin, heteronuclear p 99.08
1op4_A159 Neural-cadherin; beta sandwich, cadherin-like doma 93.36
3pdd_A190 Glycoside hydrolase, family 9; CBHA, beta-sandwich 92.3
2yrl_A102 KIAA1837 protein; PKD domain, NPPSFA, national pro 88.79
2y72_A85 Collagenase, collagenase G; polycystic kidney dise 80.44
>3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Back     alignment and structure
Probab=100.00  E-value=3.2e-42  Score=339.80  Aligned_cols=280  Identities=22%  Similarity=0.244  Sum_probs=225.6

Q ss_pred             eeEecceeEeeccccccccceEEEEEEe--cccCceeeeecccccccCCCCcccEEEeCCccEEEEcccCCCCCCCceEE
Q psy8640           7 VWLQPMQCLIMRRGVVHRENIQVYLVWY--GSTSRLCRRTCGTIPLSQQQRLAIQAVDPLTGVLSVQQPLDYDTGSSEHL   84 (303)
Q Consensus         7 ~~~~p~~~~i~e~~~~~~~~~~~~~i~~--~~~~~~~~~~~~~~~~~~~~~~~~F~Id~~tG~l~~~~~LD~E~~~~~~~   84 (303)
                      .|+.| |+.|+||.. ++......++..  +.++++.|+..|.-  ....+.++|.|++.||+|++.++||||.... |.
T Consensus         1 ~W~~~-~~~v~En~~-g~~~~~i~~~~~D~~~n~~i~Ysi~~~~--~~~~~~~~F~id~~tG~l~~~~~LDrE~~~~-y~   75 (559)
T 3q2w_A            1 DWVIP-PINLPENSR-GPFPQELVRIRSDRDKNLSLRYSVTGPG--ADQPPTGIFIINPISGQLSVTKPLDRELIAR-FH   75 (559)
T ss_dssp             CCCCC-CEEEESSCC-CCSSEEEEECCCGGGGTSCEEEEEESBT--TTBSSTTSEEECTTTCEEEECSCCCTTTCSE-EE
T ss_pred             CccCC-cEEeeCCCC-CCCCeEEEEEeeCCCCCcEEEEEEECCC--CCCCCCceEEEeCCceEEEECCccCCCCCce-EE
Confidence            38876 999999997 554444444432  34456667543311  1122357999999999999999999999999 99


Q ss_pred             EEEEEEECCCCCCCCCCeeEEEEEEEEEcCCCCCCcCCCCceEEEEeCCCCCCeEEEEEEEEeCCCC--CCceEEEEEee
Q psy8640          85 LILKVEDGGKPPLDSPLSSITHLKITLQDENDNAPKFPITEYLEFVGENEPIGSSVFTARATDMDKG--DYGKLNYSIIS  162 (303)
Q Consensus        85 l~i~a~D~g~~~~~~~~s~~~~v~I~V~DvNDn~P~f~~~~~~~~V~E~~~~gt~v~~v~A~D~D~g--~n~~i~Y~i~~  162 (303)
                      |.+.|.|+|.    +.+++++.+.|.|.|+|||+|.|.+..|.+.|+|++++|+.|+++.|+|+|.|  .|+.++|+|..
T Consensus        76 l~v~a~D~g~----~~~~~~~~v~I~V~DvNDn~P~F~~~~y~~~V~En~~~Gt~v~~v~A~D~D~g~~~n~~v~Ysi~~  151 (559)
T 3q2w_A           76 LRAHAVDING----NQVENPIDIVINVIDMNDNRPEFLHQVWNGSVPEGSKPGTYVMTVTAIDADDPNALNGMLRYRILS  151 (559)
T ss_dssp             EEEEEEETTS----CEEEEEEEEEEEEECCCCCCCEESCSEEEEEEETTCCTTCEEEECCEECSSCTTSGGGCCEEEEEE
T ss_pred             EEEEEEECCC----CccceeEEEEEEEEeCCCCCCccCCCeeEEEEeCCCCCCcEEEEEEEEcCCCCCCCceEEEEEEec
Confidence            9999999987    67889999999999999999999999999999999999999999999999997  59999999988


Q ss_pred             CCCCCCcccCCCcCcEEEECCCcEEEEcc-cCcccccceEEEEEEEEEE---------------EeecccccCCCc----
Q psy8640         163 AAASGYTDVDDSWKLFRVDALTGLVTTNA-VFDYEARSRYAFTLLSTYS---------------VWTRSLVWSRPM----  222 (303)
Q Consensus       163 ~~~~~~~~~~~~~~~F~Id~~tG~I~~~~-~LD~e~~~~~~l~v~a~~~---------------~~~~~~~~~~~~----  222 (303)
                      +.+.     ....+.|.|++.+|.|++.+ .||||....|.|+|.|.+.               +....++.|.|.    
T Consensus       152 ~~~~-----~~~~~~F~Id~~tG~i~~~~~~LD~E~~~~y~l~V~A~D~~g~p~~~~s~t~~v~I~V~DvNDn~P~f~~~  226 (559)
T 3q2w_A          152 QAPS-----TPSPNMFTINNETGDIITVAAGLDREKVQQYTLIIQATDMEGNPTYGLSNTATAVITVTDVNDNPPEFTAM  226 (559)
T ss_dssp             EESC-----CSCTTCEEECTTTCEEEECCSCCCTTTCCEEEEEEEEEHHHHCTTTCCEEEEEEEEEEECCSCSCCEESSS
T ss_pred             CCCC-----CCCcceEEEeCCceEEEEEeccCCcccCCEEEEEEEEEECCCCCCCCccceEEEEEEEEeCCCCCCccccc
Confidence            6532     12226799999999999987 9999999999999998621               222222222221    


Q ss_pred             ---------------------------------eEEE----------e-----------ecCceeeeeeecEEEEEEEEE
Q psy8640         223 ---------------------------------QCLI----------M-----------RRGVVFDYEARSRYAFTLLST  248 (303)
Q Consensus       223 ---------------------------------~~~i----------~-----------~~~~~lD~E~~~~y~l~V~a~  248 (303)
                                                       .+.|          +           ...+.||||....|.|+|.|+
T Consensus       227 ~y~~~V~En~~g~~v~~v~a~D~D~~~~~n~~~~y~i~~g~~~~~F~I~~~~~~~~G~i~~~~~LD~E~~~~y~l~V~A~  306 (559)
T 3q2w_A          227 TFYGEVPENRVDVIVANLTVTDKDQPHTPAWNAAYRISGGDPTGRFAILTDPNSNDGLVTVVKPIDFETNRMFVLTVAAE  306 (559)
T ss_dssp             EEEEEEESSCSSEEEEEEEEECCSCTTSTTTSBCCEEEESCTTCCEEEEECTTTCEEEEEECSCCCTTTCSEEEEEEECC
T ss_pred             cceeEecCCCCCcEEEEEEEEcCCCCCCCceeEEEEEecCCCCCceEEEecCCCCcEEEEeCCCCCCccCceEEEEEEEE
Confidence                                             1111          1           112569999999999999999


Q ss_pred             ECCC--------CeEEEEEEEEEeecCCCCCeeCCCeeEEE-ecCCCCCCCcEEEEEEEEeCCC
Q psy8640         249 DSGG--------RTCKVKVRVEIESRDEFHPQFTERTFKFI-LSGTDLPVGYVVGHLRLVRFRS  303 (303)
Q Consensus       249 D~g~--------~s~~~~v~I~V~DvNdn~P~F~~~~y~~~-~e~~~~p~gt~v~~v~A~D~D~  303 (303)
                      |.+.        ++++++|+|.|.|+|| +|.|.+..|.+. .|++  |.|+.|++|+|+|+|+
T Consensus       307 D~~~~~~g~~~~~~s~~~v~I~V~DvND-~P~f~~~~~~~~v~En~--~~g~~v~~v~A~D~D~  367 (559)
T 3q2w_A          307 NQVPLAKGIQHPPQSTATVSVTVIDVNE-NPYFAPNPKIIRQEEGL--HAGTMLTTLTAQDPDR  367 (559)
T ss_dssp             BSSCCCTTCCCCGGGEEEEEEEEECCCC-CCEESSSEEEEEEESCC--CTTCEEEECCEECSCS
T ss_pred             cCCccccCCCCCCceEEEEEEEEEeCCC-CCcccccceEEEEeCCC--CCCCEEEEEEEECCCC
Confidence            9642        4789999999999999 699999999999 9999  5999999999999995
>3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Back     alignment and structure
>2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} Back     alignment and structure
>1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Back     alignment and structure
>3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Back     alignment and structure
>2a4e_A Cadherin-11; dimer, calcium binding, cell adhesion; 3.20A {Mus musculus} Back     alignment and structure
>3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A Back     alignment and structure
>3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Back     alignment and structure
>3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Back     alignment and structure
>2x2u_A Proto-oncogene tyrosine-protein kinase receptor RET; hirschsprung disease, extracellular domain, disease mutation, transferase, glycoprotein; HET: NAG SO4; 2.00A {Homo sapiens} Back     alignment and structure
>1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Back     alignment and structure
>2qvi_A Cadherin-2; beta barrel, strand SWAP, domain SWAP, calcium, cell adhesion, cleavage on PAIR of basic residues, glycoprotein, membrane; 3.01A {Mus musculus} SCOP: b.1.6.1 b.1.6.1 PDB: 1ncj_A Back     alignment and structure
>3qrb_A Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus musculus} PDB: 1ff5_A 3lng_A 2qvf_B 1edh_A 3lne_A 1q1p_A 3lni_A 3q2l_A* 3q2n_A* 3lnh_A 3lnf_A 2o72_A 1suh_A Back     alignment and structure
>3mvs_A Cadherin-23, otocadherin; adhesion, extracellular domain, cell adhesion; 1.10A {Mus musculus} PDB: 4apx_A* 2whv_A 2wcp_A* 4aq8_A 4axw_A* 4aqe_A* 4aqa_A* 2wd0_A* 2wbx_A Back     alignment and structure
>3k5r_A Cadherin 13; mouse, structural protein; 2.00A {Mus musculus} PDB: 3k5s_A Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Back     alignment and structure
>3ppe_A Vascular endothelial cadherin; extracellular cadherin (EC) domain, beta barrel, IG-domain L domain swapped dimer interface; 2.10A {Gallus gallus} Back     alignment and structure
>3lnd_A CDH6 protein, cadherin 6; cell adhesion, cell membrane, membrane, transmembr; 2.82A {Mus musculus} Back     alignment and structure
>3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A Back     alignment and structure
>2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} Back     alignment and structure
>3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Back     alignment and structure
>4apx_B Protocadherin-15, otocadherin; cell adhesion, hearing, deafness, CDH23, PCDH15; HET: MES; 1.65A {Mus musculus} PDB: 4aq8_C 4aqa_B* 4aqe_B* 4axw_B* Back     alignment and structure
>2yst_A Protocadherin-7; BH-PCDH, beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ee0_A Protocadherin-9; Ca domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3mvs_A Cadherin-23, otocadherin; adhesion, extracellular domain, cell adhesion; 1.10A {Mus musculus} PDB: 4apx_A* 2whv_A 2wcp_A* 4aq8_A 4axw_A* 4aqe_A* 4aqa_A* 2wd0_A* 2wbx_A Back     alignment and structure
>2a4e_A Cadherin-11; dimer, calcium binding, cell adhesion; 3.20A {Mus musculus} Back     alignment and structure
>2qvi_A Cadherin-2; beta barrel, strand SWAP, domain SWAP, calcium, cell adhesion, cleavage on PAIR of basic residues, glycoprotein, membrane; 3.01A {Mus musculus} SCOP: b.1.6.1 b.1.6.1 PDB: 1ncj_A Back     alignment and structure
>3qrb_A Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus musculus} PDB: 1ff5_A 3lng_A 2qvf_B 1edh_A 3lne_A 1q1p_A 3lni_A 3q2l_A* 3q2n_A* 3lnh_A 3lnf_A 2o72_A 1suh_A Back     alignment and structure
>3ppe_A Vascular endothelial cadherin; extracellular cadherin (EC) domain, beta barrel, IG-domain L domain swapped dimer interface; 2.10A {Gallus gallus} Back     alignment and structure
>3k5r_A Cadherin 13; mouse, structural protein; 2.00A {Mus musculus} PDB: 3k5s_A Back     alignment and structure
>2x2u_A Proto-oncogene tyrosine-protein kinase receptor RET; hirschsprung disease, extracellular domain, disease mutation, transferase, glycoprotein; HET: NAG SO4; 2.00A {Homo sapiens} Back     alignment and structure
>3lnd_A CDH6 protein, cadherin 6; cell adhesion, cell membrane, membrane, transmembr; 2.82A {Mus musculus} Back     alignment and structure
>2yqg_A Desmoglein-2, HDGC; cadherin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ncg_A N-cadherin; cell adhesion protein; 2.10A {Mus musculus} SCOP: b.1.6.1 PDB: 1nch_A 1nci_A Back     alignment and structure
>1wyj_A Protocadherin beta 14; SS bond, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>4apx_B Protocadherin-15, otocadherin; cell adhesion, hearing, deafness, CDH23, PCDH15; HET: MES; 1.65A {Mus musculus} PDB: 4aq8_C 4aqa_B* 4aqe_B* 4axw_B* Back     alignment and structure
>1ncg_A N-cadherin; cell adhesion protein; 2.10A {Mus musculus} SCOP: b.1.6.1 PDB: 1nch_A 1nci_A Back     alignment and structure
>2yqg_A Desmoglein-2, HDGC; cadherin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1zxk_A Cadherin-8; strand dimer, cell adhesion; 2.00A {Mus musculus} PDB: 2a4c_A Back     alignment and structure
>1zvn_A Mn-cadherin; strand dimer, ----; 2.16A {Gallus gallus} Back     alignment and structure
>3k6d_A T-cadherin; cell adhesion; 1.80A {Xenopus laevis} PDB: 2v37_A Back     alignment and structure
>3k6f_A T-cadherin; cell adhesion, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein, membrane; 1.81A {Mus musculus} Back     alignment and structure
>3k6i_A T-cadherin; cell adhesion, alternative splicing, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein; 1.13A {Gallus gallus} Back     alignment and structure
>2omz_B Epithelial-cadherin; leucine-rich-repeat, nvasion protein, IG-like domain, adhesi protein, cell invasion-cell adhesion complex; 1.60A {Homo sapiens} SCOP: b.1.6.1 PDB: 2omt_B 2omu_B 2omv_B 1o6s_B 2omy_B 2omx_B 3ff8_A 3ff7_A 2omw_B Back     alignment and structure
>2yst_A Protocadherin-7; BH-PCDH, beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2omz_B Epithelial-cadherin; leucine-rich-repeat, nvasion protein, IG-like domain, adhesi protein, cell invasion-cell adhesion complex; 1.60A {Homo sapiens} SCOP: b.1.6.1 PDB: 2omt_B 2omu_B 2omv_B 1o6s_B 2omy_B 2omx_B 3ff8_A 3ff7_A 2omw_B Back     alignment and structure
>1wyj_A Protocadherin beta 14; SS bond, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3k6i_A T-cadherin; cell adhesion, alternative splicing, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein; 1.13A {Gallus gallus} Back     alignment and structure
>1wuz_A Pcdha4 protein, CNR-EC1; cadherin, heteronuclear protocadherin, cell adhesion; NMR {Mus musculus} Back     alignment and structure
>3k6f_A T-cadherin; cell adhesion, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein, membrane; 1.81A {Mus musculus} Back     alignment and structure
>3k6d_A T-cadherin; cell adhesion; 1.80A {Xenopus laevis} PDB: 2v37_A Back     alignment and structure
>1zvn_A Mn-cadherin; strand dimer, ----; 2.16A {Gallus gallus} Back     alignment and structure
>1zxk_A Cadherin-8; strand dimer, cell adhesion; 2.00A {Mus musculus} PDB: 2a4c_A Back     alignment and structure
>2ee0_A Protocadherin-9; Ca domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wuz_A Pcdha4 protein, CNR-EC1; cadherin, heteronuclear protocadherin, cell adhesion; NMR {Mus musculus} Back     alignment and structure
>1op4_A Neural-cadherin; beta sandwich, cadherin-like domain, cell adhesion; NMR {Mus musculus} SCOP: b.1.6.1 Back     alignment and structure
>3pdd_A Glycoside hydrolase, family 9; CBHA, beta-sandwich, cellulosome, unknown function; 1.72A {Clostridium thermocellum} PDB: 3pdg_A Back     alignment and structure
>2yrl_A KIAA1837 protein; PKD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2y72_A Collagenase, collagenase G; polycystic kidney disease domain, beta barrel, collagen RECO domain, hydrolase; 1.18A {Clostridium histolyticum} PDB: 3jqu_A 3js7_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 303
d1ncja2114 b.1.6.1 (A:102-215) N-cadherin (neural) {Mouse (Mu 4e-10
d1l3wa2113 b.1.6.1 (A:101-213) C-cadherin ectodomain {African 6e-09
d1l3wa4107 b.1.6.1 (A:327-433) C-cadherin ectodomain {African 4e-08
d2omzb1104 b.1.6.1 (B:-2-101) E-cadherin (epithelial) {Human 5e-07
d1edha2112 b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse 8e-07
d1l3wa3113 b.1.6.1 (A:214-326) C-cadherin ectodomain {African 3e-06
d1l3wa1100 b.1.6.1 (A:1-100) C-cadherin ectodomain {African c 3e-06
d1ncia_102 b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus muscu 1e-05
d1op4a_136 b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus muscu 2e-05
d1l3wa5107 b.1.6.1 (A:434-540) C-cadherin ectodomain {African 0.002
>d1ncja2 b.1.6.1 (A:102-215) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 Back     information, alignment and structure

class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Cadherin-like
family: Cadherin
domain: N-cadherin (neural)
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 54.3 bits (129), Expect = 4e-10
 Identities = 21/95 (22%), Positives = 35/95 (36%), Gaps = 4/95 (4%)

Query: 115 NDNAPKFPITEYLEFVGENEPIGSSVFTARATDMDKGDYGKLNYSIISAAASGYTDVDDS 174
           NDN P+F    +   V E    G+ V T  A D D  +       ++            S
Sbjct: 1   NDNRPEFLHQVWNGSVPEGSKPGTYVMTVTAIDADDPNAL---NGMLRYRIVSQAPSTPS 57

Query: 175 WKLFRVDA-LTGLVTTNAVFDYEARSRYAFTLLST 208
             +F ++     ++T  A  D E   +Y   + +T
Sbjct: 58  PNMFTINNETGDIITVAAGLDREKVQQYTLIIQAT 92
>d1l3wa2 b.1.6.1 (A:101-213) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 113 Back     information, alignment and structure
>d1l3wa4 b.1.6.1 (A:327-433) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 107 Back     information, alignment and structure
>d2omzb1 b.1.6.1 (B:-2-101) E-cadherin (epithelial) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1edha2 b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]} Length = 112 Back     information, alignment and structure
>d1l3wa3 b.1.6.1 (A:214-326) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 113 Back     information, alignment and structure
>d1l3wa1 b.1.6.1 (A:1-100) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 100 Back     information, alignment and structure
>d1ncia_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Length = 102 Back     information, alignment and structure
>d1op4a_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Length = 136 Back     information, alignment and structure
>d1l3wa5 b.1.6.1 (A:434-540) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 107 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query303
d1l3wa2113 C-cadherin ectodomain {African clawed frog (Xenopu 99.86
d1edha2112 E-cadherin (epithelial) {Mouse (Mus musculus) [Tax 99.85
d1ncja2114 N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 99.84
d1l3wa4107 C-cadherin ectodomain {African clawed frog (Xenopu 99.82
d1op4a_136 N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 99.81
d1l3wa3113 C-cadherin ectodomain {African clawed frog (Xenopu 99.72
d1l3wa5107 C-cadherin ectodomain {African clawed frog (Xenopu 99.71
d2omzb1104 E-cadherin (epithelial) {Human (Homo sapiens) [Tax 99.58
d1ncia_102 N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 99.57
d1l3wa1100 C-cadherin ectodomain {African clawed frog (Xenopu 99.57
d1ncia_102 N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 99.46
d2omzb1104 E-cadherin (epithelial) {Human (Homo sapiens) [Tax 99.42
d1l3wa1100 C-cadherin ectodomain {African clawed frog (Xenopu 99.41
d1op4a_136 N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 99.25
d1edha2112 E-cadherin (epithelial) {Mouse (Mus musculus) [Tax 99.13
d1l3wa4107 C-cadherin ectodomain {African clawed frog (Xenopu 99.12
d1l3wa2113 C-cadherin ectodomain {African clawed frog (Xenopu 99.12
d1ncja2114 N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 98.96
d1l3wa3113 C-cadherin ectodomain {African clawed frog (Xenopu 98.76
d1l3wa5107 C-cadherin ectodomain {African clawed frog (Xenopu 98.33
d1u2ca1103 Dystroglycan, N-terminal domain {Mouse (Mus muscul 83.73
>d1l3wa2 b.1.6.1 (A:101-213) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Cadherin-like
family: Cadherin
domain: C-cadherin ectodomain
species: African clawed frog (Xenopus laevis) [TaxId: 8355]

Probab=99.86  E-value=7.7e-22  Score=152.45  Aligned_cols=107  Identities=30%  Similarity=0.413  Sum_probs=94.6

Q ss_pred             CCCCCCcCCCCceEEEEeCCCCCCeEEEEEEEEeCCCC---CCceEEEEEeeCCCCCCcccCCCcCcEEEECCCcEEEEc
Q psy8640         114 ENDNAPKFPITEYLEFVGENEPIGSSVFTARATDMDKG---DYGKLNYSIISAAASGYTDVDDSWKLFRVDALTGLVTTN  190 (303)
Q Consensus       114 vNDn~P~f~~~~~~~~V~E~~~~gt~v~~v~A~D~D~g---~n~~i~Y~i~~~~~~~~~~~~~~~~~F~Id~~tG~I~~~  190 (303)
                      .|||+|.|.+..|.+.|+|++++|+.|+++.|+|+|.+   .|+++.|+|..+.+.     ....++|.|++.||.|++.
T Consensus         1 eNDn~P~F~~~~y~~~V~En~~~gt~v~~v~A~D~D~~~~~~n~~i~y~i~~~~~~-----~~~~~~F~i~~~tG~i~~~   75 (113)
T d1l3wa2           1 QNDNRPKFTQDVFRGSVREGVQPGTQVMAVSATDEDDNIDSLNGVLSYSILKQDPE-----EPIPNLFTINRETGVISLI   75 (113)
T ss_dssp             CSCCCCEESSSCEEEEEETTCCSSEEEEECCEECCSCCSSSSTTCCEEEEEEESSC-----CSCSCSEEECTTTCEEEEC
T ss_pred             CCCCCCccCCCeEEEEEECCCCCCCEEEEEEeecccccccccceEEEEEEecCCCC-----ccccceeeeeecceeEEEe
Confidence            59999999999999999999999999999999999987   478999999887643     3344789999999999985


Q ss_pred             -ccCcccccceEEEEEEEEEEEeecccccCCCceEEEeecCceeeeeeecEEEEEEEEEECCC--CeEEEEEEEEEee
Q psy8640         191 -AVFDYEARSRYAFTLLSTYSVWTRSLVWSRPMQCLIMRRGVVFDYEARSRYAFTLLSTDSGG--RTCKVKVRVEIES  265 (303)
Q Consensus       191 -~~LD~e~~~~~~l~v~a~~~~~~~~~~~~~~~~~~i~~~~~~lD~E~~~~y~l~V~a~D~g~--~s~~~~v~I~V~D  265 (303)
                       +.||||....                                        |.|.|.|+|.|+  .+++++|.|+|+|
T Consensus        76 ~~~LD~E~~~~----------------------------------------y~l~V~a~D~~~~~~~~~~~v~I~V~D  113 (113)
T d1l3wa2          76 GTGLDREKFPE----------------------------------------YTLTVQATDLEGAGLSVEGKAIIQITD  113 (113)
T ss_dssp             SCCCCTTTCCE----------------------------------------EEEEEEEEHHHHTSCEEECCEEEEEEC
T ss_pred             ccccCcccCCE----------------------------------------EEEEEEEEECCCCCcEEEEEEEEEEEC
Confidence             5799999888                                        999999999765  4888899999987
>d1edha2 b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ncja2 b.1.6.1 (A:102-215) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3wa4 b.1.6.1 (A:327-433) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1op4a_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3wa3 b.1.6.1 (A:214-326) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1l3wa5 b.1.6.1 (A:434-540) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1ncia_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3wa1 b.1.6.1 (A:1-100) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1ncia_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3wa1 b.1.6.1 (A:1-100) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1op4a_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1edha2 b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3wa4 b.1.6.1 (A:327-433) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1l3wa2 b.1.6.1 (A:101-213) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1ncja2 b.1.6.1 (A:102-215) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3wa3 b.1.6.1 (A:214-326) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1l3wa5 b.1.6.1 (A:434-540) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1u2ca1 b.1.6.2 (A:58-160) Dystroglycan, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure