Psyllid ID: psy8644

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170---
MYLNLIGKGYEYNHWSISKLLESRYLHLRPKSGMYAPAFTFSIAKFIANPTTRLYKNVGTLKRALRTEEHWLKVENTKHKGSNPGPLVGTCNTTIIVEDQNDNNPIFPVSQYSLSIPEDVPVGTVVQVVSASDADLGVNSKLSWNELEPNGLFSSDLRVEWVINRSVDQHTNK
cEEEEEcccEEEEEEEEcccccccEEEEcccccccccEEEEEEEEEEEcccccEEEEEccccccccccEEEEEEEEEcccccccccccEEEEEEEEEEEcccccccccccEEEEEEccccccccEEEEEEEEEccccccEEEEEEEEcccccEEEEccccEEEEccccccccc
ccEEEcccccEEEEEEccHHccccccccccccccEccccEEEEEEEEEccccccEEEEEEEcccccccccEEEEEEEEcccccccccccEEEEEEEEEcccccccEEcccEEEEEEEcccccccEEEEccEEccccccccEEEEEEEccccccccccEEEEEEcccccccccc
MYLNLIgkgyeynhWSISKLLESRylhlrpksgmyapaFTFSIAKFIANPTTRLYKNVGTLKRALRTEEHWLKVEntkhkgsnpgplvgtcnTTIIvedqndnnpifpvsqyslsipedvpvgTVVQVVSAsdadlgvnsklswnelepnglfssdlRVEWVINRsvdqhtnk
MYLNLIGKGYEYNHWSISKLLESRYLHLRPKSGMYAPAFTFSIAKFIANPTTRLYKNVGTLKRALRTEEHWLKventkhkgsnpgplVGTCNTTIIVEDQNDNNPIFPVSQYSLSIPEDVPVGTVVQVVSASDADLgvnsklswnelepnglfssdlrveWVINRSVDQHTNK
MYLNLIGKGYEYNHWSISKLLESRYLHLRPKSGMYAPAFTFSIAKFIANPTTRLYKNVGTLKRALRTEEHWLKVENTKHKGSNPGPLVGTCNTTIIVEDQNDNNPIFPVSQYSLSIPEDVPVGTVVQVVSASDADLGVNSKLSWNELEPNGLFSSDLRVEWVINRSVDQHTNK
*YLNLIGKGYEYNHWSISKLLESRYLHLRPKSGMYAPAFTFSIAKFIANPTTRLYKNVGTLKRALRTEEHWLKVENT*******GPLVGTCNTTIIVEDQNDNNPIFPVSQYSLSIPEDVPVGTVVQVVSASDADLGVNSKLSWNELEPNGLFSSDLRVEWVIN*********
MYLNLI*KGYEYNHWSISKLLESRYLHLRPKSGMYAPAFTFSIAKFIANPTTRLYKNVGTLKRALRTEEHWLKVENTKHKGSNPGPLVGTCNTTIIVEDQNDNNPIFPVSQYSLSIPEDVPVGTVVQVVSASDADLGVNSKLSWNELEPNGLFSSDLRVEWVINRSVDQH***
MYLNLIGKGYEYNHWSISKLLESRYLHLRPKSGMYAPAFTFSIAKFIANPTTRLYKNVGTLKRALRTEEHWLKVENTKHKGSNPGPLVGTCNTTIIVEDQNDNNPIFPVSQYSLSIPEDVPVGTVVQVVSASDADLGVNSKLSWNELEPNGLFSSDLRVEWVINRSVDQHTNK
MYLNLIGKGYEYNHWSISKLLESRYLHLRPKSGMYAPAFTFSIAKFIANPTTRLYKNVGTLKRALRTEEHWLKVENTKHKGSNPGPLVGTCNTTIIVEDQNDNNPIFPVSQYSLSIPEDVPVGTVVQVVSASDADLGVNSKLSWNELEPNGLFSSDLRVEWVINR********
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MYLNLIGKGYEYNHWSISKLLESRYLHLRPKSGMYAPAFTFSIAKFIANPTTRLYKNVGTLKRALRTEEHWLKVENTKHKGSNPGPLVGTCNTTIIVEDQNDNNPIFPVSQYSLSIPEDVPVGTVVQVVSASDADLGVNSKLSWNELEPNGLFSSDLRVEWVINRSVDQHTNK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query173 2.2.26 [Sep-21-2011]
Q24292 3503 Protein dachsous OS=Droso yes N/A 0.468 0.023 0.453 1e-12
Q8BM92 785 Cadherin-7 OS=Mus musculu yes N/A 0.543 0.119 0.353 4e-11
Q9ULB5 785 Cadherin-7 OS=Homo sapien yes N/A 0.618 0.136 0.316 1e-10
Q5DWV2 785 Cadherin-7 OS=Rattus norv yes N/A 0.543 0.119 0.353 3e-10
Q9H159 772 Cadherin-19 OS=Homo sapie no N/A 0.566 0.126 0.34 3e-10
O35161 3034 Cadherin EGF LAG seven-pa no N/A 0.468 0.026 0.414 5e-10
Q9NRJ7 776 Protocadherin beta-16 OS= no N/A 0.612 0.136 0.383 6e-10
Q90763 785 Cadherin-7 OS=Gallus gall no N/A 0.618 0.136 0.316 8e-10
Q3SWX5 790 Cadherin-6 OS=Bos taurus no N/A 0.606 0.132 0.345 1e-09
Q5DRB5 931 Protocadherin gamma-A5 OS no N/A 0.393 0.073 0.434 2e-09
>sp|Q24292|DS_DROME Protein dachsous OS=Drosophila melanogaster GN=ds PE=1 SV=3 Back     alignment and function desciption
 Score = 72.8 bits (177), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 54/86 (62%), Gaps = 5/86 (5%)

Query: 63   RALRTEEH---WLKVENTKHKGSNPGPLVGTCNTTIIVEDQNDNNPIFPVSQYSLSIPED 119
            R L  E+H    L+++ +      P    G CN TI VEDQNDN P F +S+Y+ S+ ED
Sbjct: 1854 RPLDREQHSRYTLQIQASDR--GQPKSRQGHCNITIFVEDQNDNAPRFKLSKYTGSVQED 1911

Query: 120  VPVGTVVQVVSASDADLGVNSKLSWN 145
             P+GT V  +SA DADLGVN++L ++
Sbjct: 1912 APLGTSVVQISAVDADLGVNARLVYS 1937
Involved in morphogenesis. May also be involved in cell adhesion.
Drosophila melanogaster (taxid: 7227)
>sp|Q8BM92|CADH7_MOUSE Cadherin-7 OS=Mus musculus GN=Cdh7 PE=2 SV=1 Back     alignment and function description
>sp|Q9ULB5|CADH7_HUMAN Cadherin-7 OS=Homo sapiens GN=CDH7 PE=2 SV=2 Back     alignment and function description
>sp|Q5DWV2|CADH7_RAT Cadherin-7 OS=Rattus norvegicus GN=Cdh7 PE=2 SV=1 Back     alignment and function description
>sp|Q9H159|CAD19_HUMAN Cadherin-19 OS=Homo sapiens GN=CDH19 PE=2 SV=1 Back     alignment and function description
>sp|O35161|CELR1_MOUSE Cadherin EGF LAG seven-pass G-type receptor 1 OS=Mus musculus GN=Celsr1 PE=2 SV=3 Back     alignment and function description
>sp|Q9NRJ7|PCDBG_HUMAN Protocadherin beta-16 OS=Homo sapiens GN=PCDHB16 PE=1 SV=3 Back     alignment and function description
>sp|Q90763|CADH7_CHICK Cadherin-7 OS=Gallus gallus GN=CDH7 PE=2 SV=1 Back     alignment and function description
>sp|Q3SWX5|CADH6_BOVIN Cadherin-6 OS=Bos taurus GN=CDH6 PE=2 SV=1 Back     alignment and function description
>sp|Q5DRB5|PCDG5_PANTR Protocadherin gamma-A5 OS=Pan troglodytes GN=PCDHGA5 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query173
357623109 2755 cadherin [Danaus plexippus] 0.427 0.026 0.466 4e-11
24580686 3556 dachsous [Drosophila melanogaster] gi|22 0.468 0.022 0.453 5e-11
25090185 3503 RecName: Full=Protein dachsous; AltName: 0.468 0.023 0.453 5e-11
4887715 3503 adherin [Drosophila melanogaster] 0.468 0.023 0.453 5e-11
449676278 919 PREDICTED: cadherin EGF LAG seven-pass G 0.578 0.108 0.372 7e-11
194758613 3563 GF14875 [Drosophila ananassae] gi|190615 0.294 0.014 0.561 7e-11
195388388 3639 GJ19658 [Drosophila virilis] gi|19414931 0.468 0.022 0.430 8e-11
195575605 3038 GD22944 [Drosophila simulans] gi|1941896 0.294 0.016 0.578 1e-10
194853658 3556 GG24633 [Drosophila erecta] gi|190660069 0.468 0.022 0.441 1e-10
195470324 3556 GE15963 [Drosophila yakuba] gi|194173559 0.468 0.022 0.441 1e-10
>gi|357623109|gb|EHJ74393.1| cadherin [Danaus plexippus] Back     alignment and taxonomy information
 Score = 72.8 bits (177), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 35/75 (46%), Positives = 48/75 (64%), Gaps = 1/75 (1%)

Query: 83   NPGPLVGTCNTTIIVEDQNDNNPIFPVSQYSLSIPEDVPVGTVVQVVSASDADLGVNSKL 142
            +P  L G CN T++VEDQNDN+P+F    YS +IPED  + T +  V A+DADLG N ++
Sbjct: 1226 SPVALQGACNLTVMVEDQNDNDPVFDTGHYSATIPEDASIDTSIIKVRATDADLGFNKRI 1285

Query: 143  SWNEL-EPNGLFSSD 156
             ++   E  GLF  D
Sbjct: 1286 VYSLANESQGLFRID 1300

Source: Danaus plexippus

Species: Danaus plexippus

Genus: Danaus

Family: Nymphalidae

Order: Lepidoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|24580686|ref|NP_523446.2| dachsous [Drosophila melanogaster] gi|22945533|gb|AAF51468.3| dachsous [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|25090185|sp|Q24292.3|DS_DROME RecName: Full=Protein dachsous; AltName: Full=Adherin; Flags: Precursor Back     alignment and taxonomy information
>gi|4887715|gb|AAA79329.2| adherin [Drosophila melanogaster] Back     alignment and taxonomy information
>gi|449676278|ref|XP_004208594.1| PREDICTED: cadherin EGF LAG seven-pass G-type receptor 2-like [Hydra magnipapillata] Back     alignment and taxonomy information
>gi|194758613|ref|XP_001961556.1| GF14875 [Drosophila ananassae] gi|190615253|gb|EDV30777.1| GF14875 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|195388388|ref|XP_002052862.1| GJ19658 [Drosophila virilis] gi|194149319|gb|EDW65017.1| GJ19658 [Drosophila virilis] Back     alignment and taxonomy information
>gi|195575605|ref|XP_002077668.1| GD22944 [Drosophila simulans] gi|194189677|gb|EDX03253.1| GD22944 [Drosophila simulans] Back     alignment and taxonomy information
>gi|194853658|ref|XP_001968202.1| GG24633 [Drosophila erecta] gi|190660069|gb|EDV57261.1| GG24633 [Drosophila erecta] Back     alignment and taxonomy information
>gi|195470324|ref|XP_002087458.1| GE15963 [Drosophila yakuba] gi|194173559|gb|EDW87170.1| GE15963 [Drosophila yakuba] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query173
UNIPROTKB|F1MGG7 423 CDH8 "Uncharacterized protein" 0.653 0.267 0.35 1.9e-11
UNIPROTKB|J3KTG8425 CDH8 "Cadherin-8" [Homo sapien 0.653 0.265 0.35 1.9e-11
UNIPROTKB|E1BJ74 466 CDH8 "Uncharacterized protein" 0.653 0.242 0.35 2.2e-11
UNIPROTKB|F1LZ33 535 Cdh8 "Cadherin-8" [Rattus norv 0.728 0.235 0.345 2.3e-11
UNIPROTKB|J3QKW5 476 CDH8 "Cadherin-8" [Homo sapien 0.653 0.237 0.35 2.3e-11
UNIPROTKB|F1LWM9 575 Cdh8 "Cadherin-8" [Rattus norv 0.728 0.219 0.345 2.5e-11
UNIPROTKB|F1LNN3 618 Cdh8 "Cadherin-8" [Rattus norv 0.728 0.203 0.345 2.9e-11
UNIPROTKB|J3QLE6 532 CDH8 "Cadherin-8" [Homo sapien 0.653 0.212 0.35 2.9e-11
FB|FBgn0000497 3503 ds "dachsous" [Drosophila mela 0.468 0.023 0.465 3.4e-11
UNIPROTKB|F8VVI9 434 CDH19 "Cadherin-19" [Homo sapi 0.566 0.225 0.34 4.1e-11
UNIPROTKB|F1MGG7 CDH8 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
 Score = 164 (62.8 bits), Expect = 1.9e-11, P = 1.9e-11
 Identities = 42/120 (35%), Positives = 65/120 (54%)

Query:    46 FIANPTTRLYKN-VGTLKRALRTEEHWLKVENTKHKGSNPGPLVGTCNTTIIVEDQNDNN 104
             F   P T + K  +  + R    +E +L V   K  G + G L GT   T+ + D NDN 
Sbjct:   149 FSIEPETAIIKTALPNMDR--EAKEEYLVVIQAKDMGGHSGGLSGTTTLTVTLTDVNDNP 206

Query:   105 PIFPVSQYSLSIPEDVPVGTVVQVVSASDADLGVNSKLSWNELEPNG--LF--SSDLRVE 160
             P F  S Y  S+PEDV +GT +  V A+D D+G N++ S++ ++ +G  LF  +SD + +
Sbjct:   207 PKFAQSLYHFSVPEDVVLGTAIGRVKANDQDIGENAQSSYDIIDGDGTALFEITSDAQAQ 266
GO:0016021 "integral to membrane" evidence=IEA
GO:0007156 "homophilic cell adhesion" evidence=IEA
GO:0005886 "plasma membrane" evidence=IEA
GO:0005509 "calcium ion binding" evidence=IEA
UNIPROTKB|J3KTG8 CDH8 "Cadherin-8" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E1BJ74 CDH8 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1LZ33 Cdh8 "Cadherin-8" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|J3QKW5 CDH8 "Cadherin-8" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1LWM9 Cdh8 "Cadherin-8" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1LNN3 Cdh8 "Cadherin-8" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|J3QLE6 CDH8 "Cadherin-8" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
FB|FBgn0000497 ds "dachsous" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|F8VVI9 CDH19 "Cadherin-19" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query173
cd1130498 cd11304, Cadherin_repeat, Cadherin tandem repeat d 6e-08
pfam0002892 pfam00028, Cadherin, Cadherin domain 8e-08
>gnl|CDD|206637 cd11304, Cadherin_repeat, Cadherin tandem repeat domain Back     alignment and domain information 
 Score = 48.1 bits (115), Expect = 6e-08
 Identities = 16/33 (48%), Positives = 23/33 (69%)

Query: 111 QYSLSIPEDVPVGTVVQVVSASDADLGVNSKLS 143
            Y +S+PE+ P GTVV  VSA+D D G N +++
Sbjct: 1   SYEVSVPENAPPGTVVLTVSATDPDSGENGEVT 33

Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion. The cadherin repeat domains occur as tandem repeats in the extracellular regions, which are thought to mediate cell-cell contact when bound to calcium. They play numerous roles in cell fate, signalling, proliferation, differentiation, and migration; members include E-, N-, P-, T-, VE-, CNR-, proto-, and FAT-family cadherin, desmocollin, and desmoglein, a large variety of domain architectures with varying repeat copy numbers. Cadherin-repeat containing proteins exist as monomers, homodimers, or heterodimers. Length = 98
>gnl|CDD|215665 pfam00028, Cadherin, Cadherin domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 173
cd00031199 CA Cadherin repeat domain; Cadherins are glycoprot 99.95
KOG4289|consensus 2531 99.94
KOG4289|consensus 2531 99.94
KOG1219|consensus 4289 99.92
KOG1219|consensus 4289 99.91
smart0011279 CA Cadherin repeats. Cadherins are glycoproteins i 99.63
KOG1834|consensus 952 99.55
PF0002893 Cadherin: Cadherin domain; InterPro: IPR002126 Cad 99.52
PF0002893 Cadherin: Cadherin domain; InterPro: IPR002126 Cad 99.37
cd00031 199 CA Cadherin repeat domain; Cadherins are glycoprot 99.03
smart0011279 CA Cadherin repeats. Cadherins are glycoproteins i 98.35
PF0826684 Cadherin_2: Cadherin-like; InterPro: IPR013164 Cad 97.94
KOG1834|consensus 952 96.27
PF0826684 Cadherin_2: Cadherin-like; InterPro: IPR013164 Cad 95.78
PF0875890 Cadherin_pro: Cadherin prodomain like; InterPro: I 95.75
smart0073697 CADG Dystroglycan-type cadherin-like domains. Cadh 93.7
PF0875890 Cadherin_pro: Cadherin prodomain like; InterPro: I 92.86
>cd00031 CA Cadherin repeat domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion; these domains occur as repeats in the extracellular regions which are thought to mediate cell-cell contact when bound to calcium; plays a role in cell fate, signalling, proliferation, differentiation, and migration; members include E-, N-, P-, T-, VE-,CNR-,proto-,and FAT-family cadherin, desmocollin, and desmoglein, exists as monomers or dimers (hetero- and homo-); two copies of the repeat are present here Back     alignment and domain information 
Probab=99.95  E-value=1.8e-26  Score=174.45  Aligned_cols=151  Identities=34%  Similarity=0.502  Sum_probs=132.1

Q ss_pred             eeEEeccCCC--cE---EEEcCCCCCCCCeEEEEE------eeEEEECCCcEEEEecCCCCCCcCccc---EEEEEEEeC
Q psy8644          14 HWSISKLLES--RY---LHLRPKSGMYAPAFTFSI------AKFIANPTTRLYKNVGTLKRALRTEEH---WLKVENTKH   79 (173)
Q Consensus        14 ~~~i~e~~~~--~v---~~~d~d~~~~n~~i~Ysi------~~F~Id~~tG~i~~~~~~~~~LD~E~~---~l~v~a~dd   79 (173)
                      ++.++|+...  .+   .+.|+|.+. ++.+.|+|      .+|+|++.+|.|++.    +.||||..   .|.|+|+ |
T Consensus         3 ~~~i~En~~~g~~v~~~~a~D~D~~~-~~~~~y~i~~~~~~~~F~i~~~tG~l~~~----~~lD~e~~~~~~l~v~a~-D   76 (199)
T cd00031           3 SVSVPENAPPGTVVGTVSATDPDSGE-NGRVTYSILGGNEDGLFSIDPNTGVITTT----KPLDREEQSEYTLTVVAS-D   76 (199)
T ss_pred             EEEEeCCCCCCCEEEEEEEECCCCCC-CceEEEEEeCCCCcccEEEeCCCCEEEEC----CCCCCcCCceEEEEEEEE-E
Confidence            4566665554  33   466888886 78999999      499999999999999    99999997   8999999 6


Q ss_pred             CCCCCCCceeEEEEEEEEeeCCCCCCccCCCceEEEEeCCCCCCcEEEEEEEEeCCCCCCceEEEE-eCCC-CCcEEEEC
Q psy8644          80 KGSNPGPLVGTCNTTIIVEDQNDNNPIFPVSQYSLSIPEDVPVGTVVQVVSASDADLGVNSKLSWN-ELEP-NGLFSSDL  157 (173)
Q Consensus        80 ~g~~p~~~~~~~~v~I~V~d~Ndn~P~f~~~~y~~~v~E~~~~g~~v~~v~A~D~D~g~n~~v~Y~-~~~~-~~~F~Id~  157 (173)
                      .|. | .+++.+.+.|.|.|+|||+|.|....|.+.|.|+.++|+.++++.|+|+|.+.++.++|+ .+.. .++|.|++
T Consensus        77 ~g~-~-~~~~~~~v~I~V~d~Nd~~P~~~~~~~~~~v~e~~~~~~~i~~~~a~D~D~~~~~~~~y~l~~~~~~~~f~i~~  154 (199)
T cd00031          77 GGG-P-PLSSTATVTVTVLDVNDNPPVFEQSSYEASVPENAPPGTVVGTVTATDADSGENAKLTYSILSGNDKELFSIDP  154 (199)
T ss_pred             CCc-C-cceeEEEEEEEEccCCCCCCcccccceEEEEeCCCCCCCEEEEEEEEcCCCCCCccEEEEEeCCCCCCEEEEeC
Confidence            677 6 677999999999999999999999999999999999999999999999999999999999 3333 38999999


Q ss_pred             CCCEEE-ecCCccccc
Q psy8644         158 RVEWVI-NRSVDQHTN  172 (173)
Q Consensus       158 ~tG~i~-~~~LD~E~~  172 (173)
                      .+|.|. .+.||||..
T Consensus       155 ~~G~i~~~~~ld~e~~  170 (199)
T cd00031         155 NTGIITLAKPLDREEK  170 (199)
T ss_pred             CceEEEeCCccCCccC
Confidence            999997 779999975

>KOG4289|consensus Back     alignment and domain information
>KOG4289|consensus Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>smart00112 CA Cadherin repeats Back     alignment and domain information
>KOG1834|consensus Back     alignment and domain information
>PF00028 Cadherin: Cadherin domain; InterPro: IPR002126 Cadherins are a family of adhesion molecules that mediate Ca2+-dependent cell-cell adhesion in all solid tissues of the organism which modulate a wide variety of processes including cell polarisation and migration [, ,] Back     alignment and domain information
>PF00028 Cadherin: Cadherin domain; InterPro: IPR002126 Cadherins are a family of adhesion molecules that mediate Ca2+-dependent cell-cell adhesion in all solid tissues of the organism which modulate a wide variety of processes including cell polarisation and migration [, ,] Back     alignment and domain information
>cd00031 CA Cadherin repeat domain; Cadherins are glycoproteins involved in Ca2+-mediated cell-cell adhesion; these domains occur as repeats in the extracellular regions which are thought to mediate cell-cell contact when bound to calcium; plays a role in cell fate, signalling, proliferation, differentiation, and migration; members include E-, N-, P-, T-, VE-,CNR-,proto-,and FAT-family cadherin, desmocollin, and desmoglein, exists as monomers or dimers (hetero- and homo-); two copies of the repeat are present here Back     alignment and domain information
>smart00112 CA Cadherin repeats Back     alignment and domain information
>PF08266 Cadherin_2: Cadherin-like; InterPro: IPR013164 Cadherins are a family of adhesion molecules that mediate Ca2+-dependent cell-cell adhesion in all solid tissues of the organism which modulate a wide variety of processes including cell polarisation and migration [, ,] Back     alignment and domain information
>KOG1834|consensus Back     alignment and domain information
>PF08266 Cadherin_2: Cadherin-like; InterPro: IPR013164 Cadherins are a family of adhesion molecules that mediate Ca2+-dependent cell-cell adhesion in all solid tissues of the organism which modulate a wide variety of processes including cell polarisation and migration [, ,] Back     alignment and domain information
>PF08758 Cadherin_pro: Cadherin prodomain like; InterPro: IPR014868 Cadherins are a group of proteins that mediate calcium dependent cell-cell adhesion Back     alignment and domain information
>smart00736 CADG Dystroglycan-type cadherin-like domains Back     alignment and domain information
>PF08758 Cadherin_pro: Cadherin prodomain like; InterPro: IPR014868 Cadherins are a group of proteins that mediate calcium dependent cell-cell adhesion Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query173
2a62_A322 Crystal Structure Of Mouse Cadherin-8 Ec1-3 Length 3e-09
4aqe_A214 Crystal Structure Of Deafness Associated Mutant Mou 3e-07
2wcp_A214 Crystal Structure Of Mouse Cadherin-23 Ec1-2 Length 3e-07
3mvs_A210 Structure Of The N-Terminus Of Cadherin 23 Length = 3e-07
2wd0_A214 Crystal Structure Of Nonsyndromic Deafness (Dfnb12) 2e-06
2ee0_A114 Solution Structures Of The Ca Domain Of Human Proto 5e-06
3ubh_A419 Crystal Structure Of Drosophila N-Cadherin Ec1-4 Le 7e-05
3lnd_A207 Crystal Structure Of Cadherin-6 Ec12 W4a Length = 2 9e-05
3k5r_A218 Crystal Structure Of Mouse T-Cadherin Ec1 Ec2 Lengt 9e-05
1q55_A 880 W-Shaped Trans Interactions Of Cadherins Model Base 2e-04
1l3w_A 546 C-Cadherin Ectodomain Length = 546 4e-04
>pdb|2A62|A Chain A, Crystal Structure Of Mouse Cadherin-8 Ec1-3 Length = 322 Back     alignment and structure 
Iteration: 1

 Score = 57.8 bits (138), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 50/86 (58%)
Query: 66  RTEEHWLKVENTKHKGSNPGPLVGTCNTTIIVEDQNDNNPIFPVSQYSLSIPEDVPVGTV 125
             +E +L V   K  G + G L GT   T+ + D NDN P F  S Y  S+PEDV +GT 
Sbjct: 174 EAKEEYLVVIQAKDMGGHSGGLSGTTTLTVTLTDVNDNPPKFAQSLYHFSVPEDVVLGTA 233
Query: 126 VQVVSASDADLGVNSKLSWNELEPNG 151
           +  V A+D D+G N++ S++ ++ +G
Sbjct: 234 IGRVKANDQDIGENAQSSYDIIDGDG 259
>pdb|4AQE|A Chain A, Crystal Structure Of Deafness Associated Mutant Mouse Cadherin-23 Ec1-2s70p And Protocadherin-15 Ec1-2 Form I Length = 214 Back     alignment and structure
>pdb|2WCP|A Chain A, Crystal Structure Of Mouse Cadherin-23 Ec1-2 Length = 214 Back     alignment and structure
>pdb|3MVS|A Chain A, Structure Of The N-Terminus Of Cadherin 23 Length = 210 Back     alignment and structure
>pdb|2WD0|A Chain A, Crystal Structure Of Nonsyndromic Deafness (Dfnb12) Associated Mutant D124g Of Mouse Cadherin-23 Ec1-2 Length = 214 Back     alignment and structure
>pdb|2EE0|A Chain A, Solution Structures Of The Ca Domain Of Human Protocadherin 9 Length = 114 Back     alignment and structure
>pdb|3UBH|A Chain A, Crystal Structure Of Drosophila N-Cadherin Ec1-4 Length = 419 Back     alignment and structure
>pdb|3LND|A Chain A, Crystal Structure Of Cadherin-6 Ec12 W4a Length = 207 Back     alignment and structure
>pdb|3K5R|A Chain A, Crystal Structure Of Mouse T-Cadherin Ec1 Ec2 Length = 218 Back     alignment and structure
>pdb|1Q55|A Chain A, W-Shaped Trans Interactions Of Cadherins Model Based On Fitting C- Cadherin (1l3w) To 3d Map Of Desmosomes Obtained By Electron Tomography Length = 880 Back     alignment and structure
>pdb|1L3W|A Chain A, C-Cadherin Ectodomain Length = 546 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query173
2a62_A322 Cadherin-8; extracellular domain, homodimer, calci 7e-20
2a62_A 322 Cadherin-8; extracellular domain, homodimer, calci 2e-18
3lnd_A207 CDH6 protein, cadherin 6; cell adhesion, cell memb 2e-19
3ppe_A203 Vascular endothelial cadherin; extracellular cadhe 3e-19
2a4e_A215 Cadherin-11; dimer, calcium binding, cell adhesion 3e-19
2a4e_A215 Cadherin-11; dimer, calcium binding, cell adhesion 3e-04
3mvs_A210 Cadherin-23, otocadherin; adhesion, extracellular 4e-19
3mvs_A 210 Cadherin-23, otocadherin; adhesion, extracellular 4e-12
3mvs_A210 Cadherin-23, otocadherin; adhesion, extracellular 8e-04
2qvi_A215 Cadherin-2; beta barrel, strand SWAP, domain SWAP, 3e-17
3qrb_A213 Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus mu 4e-17
3qrb_A 213 Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus mu 5e-05
3ubf_A 316 Neural-cadherin; cell adhesion; 2.50A {Drosophila 1e-16
3ubf_A316 Neural-cadherin; cell adhesion; 2.50A {Drosophila 6e-14
3ubh_A 419 Neural-cadherin; cell adhesion; 2.70A {Drosophila 3e-16
3ubh_A419 Neural-cadherin; cell adhesion; 2.70A {Drosophila 2e-15
3ubh_A 419 Neural-cadherin; cell adhesion; 2.70A {Drosophila 3e-14
3ubh_A 419 Neural-cadherin; cell adhesion; 2.70A {Drosophila 6e-04
3q2w_A 559 Cadherin-2; cell adhesion, calcium binding; HET: M 3e-16
3q2w_A 559 Cadherin-2; cell adhesion, calcium binding; HET: M 2e-15
3q2w_A 559 Cadherin-2; cell adhesion, calcium binding; HET: M 5e-14
3q2w_A559 Cadherin-2; cell adhesion, calcium binding; HET: M 7e-09
3k5r_A218 Cadherin 13; mouse, structural protein; 2.00A {Mus 4e-16
3k5r_A 218 Cadherin 13; mouse, structural protein; 2.00A {Mus 7e-06
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 3e-15
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 5e-15
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 1e-14
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 3e-13
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 1e-08
1l3w_A 546 EP-cadherin, C-cadherin; cell adhesion, calcium bi 6e-15
1l3w_A 546 EP-cadherin, C-cadherin; cell adhesion, calcium bi 2e-14
1l3w_A 546 EP-cadherin, C-cadherin; cell adhesion, calcium bi 6e-14
1l3w_A546 EP-cadherin, C-cadherin; cell adhesion, calcium bi 8e-09
1l3w_A 546 EP-cadherin, C-cadherin; cell adhesion, calcium bi 5e-04
3q2v_A 550 Cadherin-1; cell adhesion, calcium binding; HET: M 7e-15
3q2v_A 550 Cadherin-1; cell adhesion, calcium binding; HET: M 8e-15
3q2v_A 550 Cadherin-1; cell adhesion, calcium binding; HET: M 1e-14
3q2v_A550 Cadherin-1; cell adhesion, calcium binding; HET: M 8e-09
2ee0_A114 Protocadherin-9; Ca domain, structural genomics, N 1e-14
2yst_A119 Protocadherin-7; BH-PCDH, beta-sandwich, structura 1e-14
2x2u_A246 Proto-oncogene tyrosine-protein kinase receptor RE 2e-14
2x2u_A 246 Proto-oncogene tyrosine-protein kinase receptor RE 4e-06
2x2u_A246 Proto-oncogene tyrosine-protein kinase receptor RE 2e-04
3k6d_A99 T-cadherin; cell adhesion; 1.80A {Xenopus laevis} 2e-04
3k6i_A99 T-cadherin; cell adhesion, alternative splicing, c 3e-04
3k6f_A100 T-cadherin; cell adhesion, calcium, cell membrane, 3e-04
2yqg_A123 Desmoglein-2, HDGC; cadherin, structural genomics, 5e-04
1ncg_A110 N-cadherin; cell adhesion protein; 2.10A {Mus musc 7e-04
>2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} Length = 322 Back     alignment and structure
 Score = 83.5 bits (207), Expect = 7e-20
 Identities = 37/116 (31%), Positives = 58/116 (50%), Gaps = 9/116 (7%)

Query: 45  KFIANPTTRLYKNVGTLKRAL---RTEEHWLKVENTKHKGSNPGPLVGTCNTTIIVEDQN 101
            F   P T     + T    +     EE+ + ++  K  G + G L GT   T+ + D N
Sbjct: 154 YFSIEPET---AIIKTALPNMDREAKEEYLVVIQ-AKDMGGHSGGLSGTTTLTVTLTDVN 209

Query: 102 DNNPIFPVSQYSLSIPEDVPVGTVVQVVSASDADLGVNSKLSWNELEPN--GLFSS 155
           DN P F  S Y  S+PEDV +GT +  V A+D D+G N++ S++ ++ +   LF  
Sbjct: 210 DNPPKFAQSLYHFSVPEDVVLGTAIGRVKANDQDIGENAQSSYDIIDGDGTALFEI 265
>2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} Length = 322 Back     alignment and structure
>3lnd_A CDH6 protein, cadherin 6; cell adhesion, cell membrane, membrane, transmembr; 2.82A {Mus musculus} Length = 207 Back     alignment and structure
>3ppe_A Vascular endothelial cadherin; extracellular cadherin (EC) domain, beta barrel, IG-domain L domain swapped dimer interface; 2.10A {Gallus gallus} Length = 203 Back     alignment and structure
>2a4e_A Cadherin-11; dimer, calcium binding, cell adhesion; 3.20A {Mus musculus} Length = 215 Back     alignment and structure
>2a4e_A Cadherin-11; dimer, calcium binding, cell adhesion; 3.20A {Mus musculus} Length = 215 Back     alignment and structure
>3mvs_A Cadherin-23, otocadherin; adhesion, extracellular domain, cell adhesion; 1.10A {Mus musculus} PDB: 2wcp_A 2whv_A 2wd0_A 2wbx_A Length = 210 Back     alignment and structure
>3mvs_A Cadherin-23, otocadherin; adhesion, extracellular domain, cell adhesion; 1.10A {Mus musculus} PDB: 2wcp_A 2whv_A 2wd0_A 2wbx_A Length = 210 Back     alignment and structure
>3mvs_A Cadherin-23, otocadherin; adhesion, extracellular domain, cell adhesion; 1.10A {Mus musculus} PDB: 2wcp_A 2whv_A 2wd0_A 2wbx_A Length = 210 Back     alignment and structure
>2qvi_A Cadherin-2; beta barrel, strand SWAP, domain SWAP, calcium, cell adhesion, cleavage on PAIR of basic residues, glycoprotein, membrane; 3.01A {Mus musculus} SCOP: b.1.6.1 b.1.6.1 PDB: 1ncj_A Length = 215 Back     alignment and structure
>3qrb_A Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus musculus} PDB: 1ff5_A 3lng_A 2qvf_B 1edh_A 3lne_A 1q1p_A 3lni_A 3q2l_A* 3q2n_A* 3lnh_A 3lnf_A 2o72_A 1suh_A Length = 213 Back     alignment and structure
>3qrb_A Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus musculus} PDB: 1ff5_A 3lng_A 2qvf_B 1edh_A 3lne_A 1q1p_A 3lni_A 3q2l_A* 3q2n_A* 3lnh_A 3lnf_A 2o72_A 1suh_A Length = 213 Back     alignment and structure
>3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A Length = 316 Back     alignment and structure
>3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A Length = 316 Back     alignment and structure
>3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Length = 419 Back     alignment and structure
>3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Length = 419 Back     alignment and structure
>3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Length = 419 Back     alignment and structure
>3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Length = 419 Back     alignment and structure
>3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Length = 559 Back     alignment and structure
>3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Length = 559 Back     alignment and structure
>3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Length = 559 Back     alignment and structure
>3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Length = 559 Back     alignment and structure
>3k5r_A Cadherin 13; mouse, structural protein; 2.00A {Mus musculus} PDB: 3k5s_A Length = 218 Back     alignment and structure
>3k5r_A Cadherin 13; mouse, structural protein; 2.00A {Mus musculus} PDB: 3k5s_A Length = 218 Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Length = 880 Back     alignment and structure
>1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Length = 546 Back     alignment and structure
>1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Length = 546 Back     alignment and structure
>1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Length = 546 Back     alignment and structure
>1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Length = 546 Back     alignment and structure
>1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Length = 546 Back     alignment and structure
>3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Length = 550 Back     alignment and structure
>3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Length = 550 Back     alignment and structure
>3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Length = 550 Back     alignment and structure
>3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Length = 550 Back     alignment and structure
>2ee0_A Protocadherin-9; Ca domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2yst_A Protocadherin-7; BH-PCDH, beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 119 Back     alignment and structure
>2x2u_A Proto-oncogene tyrosine-protein kinase receptor RET; hirschsprung disease, extracellular domain, disease mutation, transferase, glycoprotein; HET: NAG SO4; 2.00A {Homo sapiens} Length = 246 Back     alignment and structure
>2x2u_A Proto-oncogene tyrosine-protein kinase receptor RET; hirschsprung disease, extracellular domain, disease mutation, transferase, glycoprotein; HET: NAG SO4; 2.00A {Homo sapiens} Length = 246 Back     alignment and structure
>2x2u_A Proto-oncogene tyrosine-protein kinase receptor RET; hirschsprung disease, extracellular domain, disease mutation, transferase, glycoprotein; HET: NAG SO4; 2.00A {Homo sapiens} Length = 246 Back     alignment and structure
>3k6d_A T-cadherin; cell adhesion; 1.80A {Xenopus laevis} PDB: 2v37_A Length = 99 Back     alignment and structure
>3k6i_A T-cadherin; cell adhesion, alternative splicing, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein; 1.13A {Gallus gallus} Length = 99 Back     alignment and structure
>3k6f_A T-cadherin; cell adhesion, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein, membrane; 1.81A {Mus musculus} Length = 100 Back     alignment and structure
>2yqg_A Desmoglein-2, HDGC; cadherin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>1ncg_A N-cadherin; cell adhesion protein; 2.10A {Mus musculus} SCOP: b.1.6.1 PDB: 1nch_A 1nci_A Length = 110 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query173
2qvi_A215 Cadherin-2; beta barrel, strand SWAP, domain SWAP, 100.0
3qrb_A213 Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus mu 100.0
2a4e_A215 Cadherin-11; dimer, calcium binding, cell adhesion 100.0
3k5r_A218 Cadherin 13; mouse, structural protein; 2.00A {Mus 100.0
3ppe_A203 Vascular endothelial cadherin; extracellular cadhe 100.0
3lnd_A207 CDH6 protein, cadherin 6; cell adhesion, cell memb 99.98
3mvs_A210 Cadherin-23, otocadherin; adhesion, extracellular 99.97
2a62_A322 Cadherin-8; extracellular domain, homodimer, calci 99.97
3q2w_A 559 Cadherin-2; cell adhesion, calcium binding; HET: M 99.97
2a62_A 322 Cadherin-8; extracellular domain, homodimer, calci 99.96
2x2u_A246 Proto-oncogene tyrosine-protein kinase receptor RE 99.96
1l3w_A 546 EP-cadherin, C-cadherin; cell adhesion, calcium bi 99.96
3q2v_A 550 Cadherin-1; cell adhesion, calcium binding; HET: M 99.96
3ubf_A 316 Neural-cadherin; cell adhesion; 2.50A {Drosophila 99.95
4apx_B242 Protocadherin-15, otocadherin; cell adhesion, hear 99.95
3ubf_A316 Neural-cadherin; cell adhesion; 2.50A {Drosophila 99.95
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 99.95
3ubh_A419 Neural-cadherin; cell adhesion; 2.70A {Drosophila 99.95
3ubh_A 419 Neural-cadherin; cell adhesion; 2.70A {Drosophila 99.95
1l3w_A 546 EP-cadherin, C-cadherin; cell adhesion, calcium bi 99.94
3q2v_A 550 Cadherin-1; cell adhesion, calcium binding; HET: M 99.94
3q2w_A 559 Cadherin-2; cell adhesion, calcium binding; HET: M 99.94
1q55_A 880 EP-cadherin, C-cadherin; trans interaction, desmos 99.93
2ee0_A114 Protocadherin-9; Ca domain, structural genomics, N 99.86
2yst_A119 Protocadherin-7; BH-PCDH, beta-sandwich, structura 99.84
1ncg_A110 N-cadherin; cell adhesion protein; 2.10A {Mus musc 99.81
2yqg_A123 Desmoglein-2, HDGC; cadherin, structural genomics, 99.78
2yst_A119 Protocadherin-7; BH-PCDH, beta-sandwich, structura 99.72
2x2u_A246 Proto-oncogene tyrosine-protein kinase receptor RE 99.66
1wyj_A125 Protocadherin beta 14; SS bond, structural genomic 99.62
2omz_B105 Epithelial-cadherin; leucine-rich-repeat, nvasion 99.59
1zvn_A99 Mn-cadherin; strand dimer, ----; 2.16A {Gallus gal 99.58
1zxk_A98 Cadherin-8; strand dimer, cell adhesion; 2.00A {Mu 99.56
3mvs_A210 Cadherin-23, otocadherin; adhesion, extracellular 99.52
2a4e_A215 Cadherin-11; dimer, calcium binding, cell adhesion 99.52
2ee0_A114 Protocadherin-9; Ca domain, structural genomics, N 99.51
3k6f_A100 T-cadherin; cell adhesion, calcium, cell membrane, 99.49
3k6d_A99 T-cadherin; cell adhesion; 1.80A {Xenopus laevis} 99.46
3k6i_A99 T-cadherin; cell adhesion, alternative splicing, c 99.44
1zvn_A99 Mn-cadherin; strand dimer, ----; 2.16A {Gallus gal 99.42
2yqg_A123 Desmoglein-2, HDGC; cadherin, structural genomics, 99.42
1zxk_A98 Cadherin-8; strand dimer, cell adhesion; 2.00A {Mu 99.41
3k6d_A99 T-cadherin; cell adhesion; 1.80A {Xenopus laevis} 99.28
3k6i_A99 T-cadherin; cell adhesion, alternative splicing, c 99.24
3k6f_A100 T-cadherin; cell adhesion, calcium, cell membrane, 99.23
1ncg_A110 N-cadherin; cell adhesion protein; 2.10A {Mus musc 99.18
1wyj_A125 Protocadherin beta 14; SS bond, structural genomic 99.17
3qrb_A213 Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus mu 99.15
2omz_B105 Epithelial-cadherin; leucine-rich-repeat, nvasion 99.15
3ppe_A203 Vascular endothelial cadherin; extracellular cadhe 99.13
1wuz_A103 Pcdha4 protein, CNR-EC1; cadherin, heteronuclear p 99.09
3lnd_A207 CDH6 protein, cadherin 6; cell adhesion, cell memb 99.08
1wuz_A103 Pcdha4 protein, CNR-EC1; cadherin, heteronuclear p 99.07
4apx_B242 Protocadherin-15, otocadherin; cell adhesion, hear 99.04
3k5r_A218 Cadherin 13; mouse, structural protein; 2.00A {Mus 99.0
2qvi_A215 Cadherin-2; beta barrel, strand SWAP, domain SWAP, 98.99
3ead_A137 Na/Ca exchange protein; CBD1, calcium regulation, 83.66
>2qvi_A Cadherin-2; beta barrel, strand SWAP, domain SWAP, calcium, cell adhesion, cleavage on PAIR of basic residues, glycoprotein, membrane; 3.01A {Mus musculus} SCOP: b.1.6.1 b.1.6.1 PDB: 1ncj_A Back     alignment and structure
Probab=100.00  E-value=4.3e-34  Score=219.28  Aligned_cols=155  Identities=21%  Similarity=0.288  Sum_probs=137.7

Q ss_pred             eeeeeeEEeccCC----CcEEEEcCCCCCCCCeEEEEE----------eeEEEECCCcEEEEecCCCCCCcCccc---EE
Q psy8644          10 YEYNHWSISKLLE----SRYLHLRPKSGMYAPAFTFSI----------AKFIANPTTRLYKNVGTLKRALRTEEH---WL   72 (173)
Q Consensus        10 ~~~~~~~i~e~~~----~~v~~~d~d~~~~n~~i~Ysi----------~~F~Id~~tG~i~~~~~~~~~LD~E~~---~l   72 (173)
                      |-...++|+|+..    ..+.++|+|.+. |+.|+|+|          +.|+|++.+|.|++.    ++||||..   .|
T Consensus         2 w~~~~~~V~En~~g~~~~~v~~~~~D~~~-n~~v~Ysi~~~~~~~~~~~~F~Id~~tG~i~~~----~~LDrE~~~~y~l   76 (215)
T 2qvi_A            2 WVIPPINLPENSRGPFPQELVRIRSDRDK-NLSLRYSVTGPGADQPPTGIFIINPISGQLSVT----KPLDRELIARFHL   76 (215)
T ss_dssp             CCCCCEEEESSCCCCSSEEEEECCCGGGG-TSCEEEEEESTTSSSTTCSSEEECTTTCEEEEC----SCCCTTTCSEEEE
T ss_pred             cccCcEEEcCCCCCCCCEEEEEEeCCCCC-CceEEEEEECCCCCCCCCCcEEEeCCccEEEEC----cccCcccCCeEEE
Confidence            5556788898775    346778888875 89999999          279999999999999    99999998   89


Q ss_pred             EEEEEeCCCCCCCCceeEEEEEEEEeeCCCCCCccCCCceEEEEeCCCCCCcEEEEEEEEeCCC--CCCceEEEE--eCC
Q psy8644          73 KVENTKHKGSNPGPLVGTCNTTIIVEDQNDNNPIFPVSQYSLSIPEDVPVGTVVQVVSASDADL--GVNSKLSWN--ELE  148 (173)
Q Consensus        73 ~v~a~dd~g~~p~~~~~~~~v~I~V~d~Ndn~P~f~~~~y~~~v~E~~~~g~~v~~v~A~D~D~--g~n~~v~Y~--~~~  148 (173)
                      .|+|+ |.|. | ++++++.|.|+|.|+|||+|.|.+..|.+.|+|++++|+.|++|.|+|+|.  |.|+.++|+  .++
T Consensus        77 ~v~a~-D~g~-~-~~~~~~~v~I~V~DvNDn~P~F~~~~y~~~v~En~~~gt~v~~v~A~D~D~~~g~n~~i~Y~i~~~~  153 (215)
T 2qvi_A           77 RAHAV-DING-N-QVENPIDIVINVIDMNDNRPEFLHQVWNGSVPEGSKPGTYVMTVTAIDADDPNALNGMLRYRILSQA  153 (215)
T ss_dssp             EEEEE-ETTT-C-CCEEEEEEEEEEECCCCCCCBCSSSEEEEEECSSCCTTCEEEECCCBCSSCTTSTTTCCCCEEEECS
T ss_pred             EEEEE-ECCC-C-ceeeeEEEEEEEeECCCCCCcccCceeEEEEeCCCCCCCEEEEEEEEeCCCCCCCCcEEEEEEecCC
Confidence            99999 6776 6 789999999999999999999999999999999999999999999999999  789999999  333


Q ss_pred             ----CCCcEEEECCCCEEE-e-cCCccccc
Q psy8644         149 ----PNGLFSSDLRVEWVI-N-RSVDQHTN  172 (173)
Q Consensus       149 ----~~~~F~Id~~tG~i~-~-~~LD~E~~  172 (173)
                          ..+.|.|++.+|.|+ . ++||||+.
T Consensus       154 ~~~~~~~~F~Id~~tG~i~~~~~~LD~E~~  183 (215)
T 2qvi_A          154 PSTPSPNMFTINNETGDIITVAAGLDREKV  183 (215)
T ss_dssp             SCCSSTTCEEECTTTCEEEECSCCCCTTTC
T ss_pred             CCCCcCCeEEEcCCCcEEEEecCCCCcccC
Confidence                468999999999997 3 78999975
>3qrb_A Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus musculus} PDB: 1ff5_A 3lng_A 2qvf_B 1edh_A 3lne_A 1q1p_A 3lni_A 3q2l_A* 3q2n_A* 3lnh_A 3lnf_A 2o72_A 1suh_A Back     alignment and structure
>2a4e_A Cadherin-11; dimer, calcium binding, cell adhesion; 3.20A {Mus musculus} Back     alignment and structure
>3k5r_A Cadherin 13; mouse, structural protein; 2.00A {Mus musculus} PDB: 3k5s_A Back     alignment and structure
>3ppe_A Vascular endothelial cadherin; extracellular cadherin (EC) domain, beta barrel, IG-domain L domain swapped dimer interface; 2.10A {Gallus gallus} Back     alignment and structure
>3lnd_A CDH6 protein, cadherin 6; cell adhesion, cell membrane, membrane, transmembr; 2.82A {Mus musculus} Back     alignment and structure
>3mvs_A Cadherin-23, otocadherin; adhesion, extracellular domain, cell adhesion; 1.10A {Mus musculus} PDB: 4apx_A* 2whv_A 2wcp_A* 4aq8_A 4axw_A* 4aqe_A* 4aqa_A* 2wd0_A* 2wbx_A Back     alignment and structure
>2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} Back     alignment and structure
>3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Back     alignment and structure
>2a62_A Cadherin-8; extracellular domain, homodimer, calcium binding, adhesion; 4.50A {Mus musculus} Back     alignment and structure
>2x2u_A Proto-oncogene tyrosine-protein kinase receptor RET; hirschsprung disease, extracellular domain, disease mutation, transferase, glycoprotein; HET: NAG SO4; 2.00A {Homo sapiens} Back     alignment and structure
>1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Back     alignment and structure
>3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Back     alignment and structure
>3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A Back     alignment and structure
>4apx_B Protocadherin-15, otocadherin; cell adhesion, hearing, deafness, CDH23, PCDH15; HET: MES; 1.65A {Mus musculus} PDB: 4aq8_C 4aqa_B* 4aqe_B* 4axw_B* Back     alignment and structure
>3ubf_A Neural-cadherin; cell adhesion; 2.50A {Drosophila melanogaster} PDB: 3ubg_A Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Back     alignment and structure
>3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Back     alignment and structure
>3ubh_A Neural-cadherin; cell adhesion; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1l3w_A EP-cadherin, C-cadherin; cell adhesion, calcium binding, extracellular, ECT metal binding protein; HET: NAG NDG; 3.08A {Xenopus laevis} SCOP: b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 b.1.6.1 Back     alignment and structure
>3q2v_A Cadherin-1; cell adhesion, calcium binding; HET: MAN; 3.40A {Mus musculus} Back     alignment and structure
>3q2w_A Cadherin-2; cell adhesion, calcium binding; HET: MAN NAG; 3.20A {Mus musculus} Back     alignment and structure
>1q55_A EP-cadherin, C-cadherin; trans interaction, desmosome, junction, adhesion, structural protein; HET: NAG NDG; 30.00A {Mus musculus} SCOP: i.20.1.1 PDB: 1q5a_A* 1q5b_A* 1q5c_A* Back     alignment and structure
>2ee0_A Protocadherin-9; Ca domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yst_A Protocadherin-7; BH-PCDH, beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1ncg_A N-cadherin; cell adhesion protein; 2.10A {Mus musculus} SCOP: b.1.6.1 PDB: 1nch_A 1nci_A Back     alignment and structure
>2yqg_A Desmoglein-2, HDGC; cadherin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yst_A Protocadherin-7; BH-PCDH, beta-sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2x2u_A Proto-oncogene tyrosine-protein kinase receptor RET; hirschsprung disease, extracellular domain, disease mutation, transferase, glycoprotein; HET: NAG SO4; 2.00A {Homo sapiens} Back     alignment and structure
>1wyj_A Protocadherin beta 14; SS bond, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2omz_B Epithelial-cadherin; leucine-rich-repeat, nvasion protein, IG-like domain, adhesi protein, cell invasion-cell adhesion complex; 1.60A {Homo sapiens} SCOP: b.1.6.1 PDB: 2omt_B 2omu_B 2omv_B 1o6s_B 2omy_B 2omx_B 3ff8_A 3ff7_A 2omw_B Back     alignment and structure
>1zvn_A Mn-cadherin; strand dimer, ----; 2.16A {Gallus gallus} Back     alignment and structure
>1zxk_A Cadherin-8; strand dimer, cell adhesion; 2.00A {Mus musculus} PDB: 2a4c_A Back     alignment and structure
>3mvs_A Cadherin-23, otocadherin; adhesion, extracellular domain, cell adhesion; 1.10A {Mus musculus} PDB: 4apx_A* 2whv_A 2wcp_A* 4aq8_A 4axw_A* 4aqe_A* 4aqa_A* 2wd0_A* 2wbx_A Back     alignment and structure
>2a4e_A Cadherin-11; dimer, calcium binding, cell adhesion; 3.20A {Mus musculus} Back     alignment and structure
>2ee0_A Protocadherin-9; Ca domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3k6f_A T-cadherin; cell adhesion, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein, membrane; 1.81A {Mus musculus} Back     alignment and structure
>3k6d_A T-cadherin; cell adhesion; 1.80A {Xenopus laevis} PDB: 2v37_A Back     alignment and structure
>3k6i_A T-cadherin; cell adhesion, alternative splicing, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein; 1.13A {Gallus gallus} Back     alignment and structure
>1zvn_A Mn-cadherin; strand dimer, ----; 2.16A {Gallus gallus} Back     alignment and structure
>2yqg_A Desmoglein-2, HDGC; cadherin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1zxk_A Cadherin-8; strand dimer, cell adhesion; 2.00A {Mus musculus} PDB: 2a4c_A Back     alignment and structure
>3k6d_A T-cadherin; cell adhesion; 1.80A {Xenopus laevis} PDB: 2v37_A Back     alignment and structure
>3k6i_A T-cadherin; cell adhesion, alternative splicing, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein; 1.13A {Gallus gallus} Back     alignment and structure
>3k6f_A T-cadherin; cell adhesion, calcium, cell membrane, cleavage on PAIR of basic residues, glycoprotein, GPI-anchor, lipoprotein, membrane; 1.81A {Mus musculus} Back     alignment and structure
>1ncg_A N-cadherin; cell adhesion protein; 2.10A {Mus musculus} SCOP: b.1.6.1 PDB: 1nch_A 1nci_A Back     alignment and structure
>1wyj_A Protocadherin beta 14; SS bond, structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3qrb_A Cadherin-1; cell adhesion; HET: PGE; 1.80A {Mus musculus} PDB: 1ff5_A 3lng_A 2qvf_B 1edh_A 3lne_A 1q1p_A 3lni_A 3q2l_A* 3q2n_A* 3lnh_A 3lnf_A 2o72_A 1suh_A Back     alignment and structure
>2omz_B Epithelial-cadherin; leucine-rich-repeat, nvasion protein, IG-like domain, adhesi protein, cell invasion-cell adhesion complex; 1.60A {Homo sapiens} SCOP: b.1.6.1 PDB: 2omt_B 2omu_B 2omv_B 1o6s_B 2omy_B 2omx_B 3ff8_A 3ff7_A 2omw_B Back     alignment and structure
>3ppe_A Vascular endothelial cadherin; extracellular cadherin (EC) domain, beta barrel, IG-domain L domain swapped dimer interface; 2.10A {Gallus gallus} Back     alignment and structure
>1wuz_A Pcdha4 protein, CNR-EC1; cadherin, heteronuclear protocadherin, cell adhesion; NMR {Mus musculus} Back     alignment and structure
>3lnd_A CDH6 protein, cadherin 6; cell adhesion, cell membrane, membrane, transmembr; 2.82A {Mus musculus} Back     alignment and structure
>1wuz_A Pcdha4 protein, CNR-EC1; cadherin, heteronuclear protocadherin, cell adhesion; NMR {Mus musculus} Back     alignment and structure
>4apx_B Protocadherin-15, otocadherin; cell adhesion, hearing, deafness, CDH23, PCDH15; HET: MES; 1.65A {Mus musculus} PDB: 4aq8_C 4aqa_B* 4aqe_B* 4axw_B* Back     alignment and structure
>3k5r_A Cadherin 13; mouse, structural protein; 2.00A {Mus musculus} PDB: 3k5s_A Back     alignment and structure
>2qvi_A Cadherin-2; beta barrel, strand SWAP, domain SWAP, calcium, cell adhesion, cleavage on PAIR of basic residues, glycoprotein, membrane; 3.01A {Mus musculus} SCOP: b.1.6.1 b.1.6.1 PDB: 1ncj_A Back     alignment and structure
>3ead_A Na/Ca exchange protein; CBD1, calcium regulation, membrane, transmembrane, membrane; 2.25A {Drosophila melanogaster} SCOP: b.1.27.0 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 173
d1l3wa4107 b.1.6.1 (A:327-433) C-cadherin ectodomain {African 6e-08
d1ncja2114 b.1.6.1 (A:102-215) N-cadherin (neural) {Mouse (Mu 3e-07
d1l3wa2113 b.1.6.1 (A:101-213) C-cadherin ectodomain {African 6e-07
d1l3wa3113 b.1.6.1 (A:214-326) C-cadherin ectodomain {African 1e-06
d1edha2112 b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse 1e-06
d1op4a_136 b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus muscu 2e-06
d2omzb1104 b.1.6.1 (B:-2-101) E-cadherin (epithelial) {Human 0.001
d1ncia_102 b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus muscu 0.003
>d1l3wa4 b.1.6.1 (A:327-433) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 107 Back     information, alignment and structure

class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Cadherin-like
family: Cadherin
domain: C-cadherin ectodomain
species: African clawed frog (Xenopus laevis) [TaxId: 8355]

 Score = 46.5 bits (109), Expect = 6e-08
 Identities = 12/54 (22%), Positives = 22/54 (40%), Gaps = 1/54 (1%)

Query: 102 DNNPIFPVSQYSLSIPEDVPVGTVVQVVSASDADLGVNSKLSWNEL-EPNGLFS 154
           +  P F  +   + + ED+  G  +  + A D D     KLS+    +P    +
Sbjct: 1   NEAPFFVPAVSRVDVSEDLSRGEKIISLVAQDPDKQQIQKLSYFIGNDPARWLT 54
>d1ncja2 b.1.6.1 (A:102-215) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 Back     information, alignment and structure
>d1l3wa2 b.1.6.1 (A:101-213) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 113 Back     information, alignment and structure
>d1l3wa3 b.1.6.1 (A:214-326) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Length = 113 Back     information, alignment and structure
>d1edha2 b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]} Length = 112 Back     information, alignment and structure
>d1op4a_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Length = 136 Back     information, alignment and structure
>d2omzb1 b.1.6.1 (B:-2-101) E-cadherin (epithelial) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1ncia_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Length = 102 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query173
d1l3wa2113 C-cadherin ectodomain {African clawed frog (Xenopu 99.72
d1ncja2114 N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 99.71
d1edha2112 E-cadherin (epithelial) {Mouse (Mus musculus) [Tax 99.7
d1l3wa4107 C-cadherin ectodomain {African clawed frog (Xenopu 99.7
d1l3wa3113 C-cadherin ectodomain {African clawed frog (Xenopu 99.53
d1ncia_102 N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 99.49
d1l3wa1100 C-cadherin ectodomain {African clawed frog (Xenopu 99.48
d2omzb1104 E-cadherin (epithelial) {Human (Homo sapiens) [Tax 99.44
d1op4a_136 N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 99.42
d1op4a_136 N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 99.39
d1l3wa4107 C-cadherin ectodomain {African clawed frog (Xenopu 99.34
d1edha2112 E-cadherin (epithelial) {Mouse (Mus musculus) [Tax 99.28
d1l3wa2113 C-cadherin ectodomain {African clawed frog (Xenopu 99.26
d1l3wa5107 C-cadherin ectodomain {African clawed frog (Xenopu 99.15
d1ncja2114 N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 99.02
d1ncia_102 N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 98.95
d1l3wa5107 C-cadherin ectodomain {African clawed frog (Xenopu 98.93
d1l3wa1100 C-cadherin ectodomain {African clawed frog (Xenopu 98.91
d2omzb1104 E-cadherin (epithelial) {Human (Homo sapiens) [Tax 98.89
d1l3wa3113 C-cadherin ectodomain {African clawed frog (Xenopu 98.72
d1u2ca1103 Dystroglycan, N-terminal domain {Mouse (Mus muscul 88.21
>d1l3wa2 b.1.6.1 (A:101-213) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
class: All beta proteins
fold: Immunoglobulin-like beta-sandwich
superfamily: Cadherin-like
family: Cadherin
domain: C-cadherin ectodomain
species: African clawed frog (Xenopus laevis) [TaxId: 8355]

Probab=99.72  E-value=7.7e-18  Score=114.51  Aligned_cols=73  Identities=32%  Similarity=0.385  Sum_probs=64.2

Q ss_pred             CCCCCCccCCCceEEEEeCCCCCCcEEEEEEEEeCCCC---CCceEEEE--eC----CCCCcEEEECCCCEEE-e-cCCc
Q psy8644         100 QNDNNPIFPVSQYSLSIPEDVPVGTVVQVVSASDADLG---VNSKLSWN--EL----EPNGLFSSDLRVEWVI-N-RSVD  168 (173)
Q Consensus       100 ~Ndn~P~f~~~~y~~~v~E~~~~g~~v~~v~A~D~D~g---~n~~v~Y~--~~----~~~~~F~Id~~tG~i~-~-~~LD  168 (173)
                      .|||+|+|.+..|.+.|+|++++|+.|+++.|+|+|.|   .|+.+.|+  .+    ...++|.|++.||.|+ . +.||
T Consensus         1 eNDn~P~F~~~~y~~~V~En~~~gt~v~~v~A~D~D~~~~~~n~~i~y~i~~~~~~~~~~~~F~i~~~tG~i~~~~~~LD   80 (113)
T d1l3wa2           1 QNDNRPKFTQDVFRGSVREGVQPGTQVMAVSATDEDDNIDSLNGVLSYSILKQDPEEPIPNLFTINRETGVISLIGTGLD   80 (113)
T ss_dssp             CSCCCCEESSSCEEEEEETTCCSSEEEEECCEECCSCCSSSSTTCCEEEEEEESSCCSCSCSEEECTTTCEEEECSCCCC
T ss_pred             CCCCCCccCCCeEEEEEECCCCCCCEEEEEEeecccccccccceEEEEEEecCCCCccccceeeeeecceeEEEeccccC
Confidence            49999999999999999999999999999999999986   57889999  22    2347899999999996 3 5799


Q ss_pred             cccc
Q psy8644         169 QHTN  172 (173)
Q Consensus       169 ~E~~  172 (173)
                      ||+.
T Consensus        81 ~E~~   84 (113)
T d1l3wa2          81 REKF   84 (113)
T ss_dssp             TTTC
T ss_pred             cccC
Confidence            9975
>d1ncja2 b.1.6.1 (A:102-215) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1edha2 b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3wa4 b.1.6.1 (A:327-433) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1l3wa3 b.1.6.1 (A:214-326) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1ncia_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3wa1 b.1.6.1 (A:1-100) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1op4a_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1op4a_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3wa4 b.1.6.1 (A:327-433) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1edha2 b.1.6.1 (A:102-213) E-cadherin (epithelial) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3wa2 b.1.6.1 (A:101-213) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1l3wa5 b.1.6.1 (A:434-540) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1ncja2 b.1.6.1 (A:102-215) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ncia_ b.1.6.1 (A:) N-cadherin (neural) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3wa5 b.1.6.1 (A:434-540) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1l3wa1 b.1.6.1 (A:1-100) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1l3wa3 b.1.6.1 (A:214-326) C-cadherin ectodomain {African clawed frog (Xenopus laevis) [TaxId: 8355]} Back     information, alignment and structure
>d1u2ca1 b.1.6.2 (A:58-160) Dystroglycan, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure