Psyllid ID: psy8728

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------38
MSRKHNSSDTNYVTSRTYNNSDKTKVHAEKSLYITYLLWLVGGIFGVHHFYLGRDIQGFLWWCTLGGYFGFGWLRDIFHIQNYVADANKDRDYLDKFNHNLRSYKYPPFSTIRFTGMTVVAYLWSTVVSMAIPEEDIGGLPWKYLHFLLPIACALGVWSVGNIGHETGTIWWCLAAAYACYPVYWYVDESTACTVMVLASALAFDTLSKRWQTKPKPRKRFLRRCLTIGACALLYSSLWGSYLYFNAKITDGEGEEIPLNEAIHHFFKSPWWVDLKQSLVDTWEFAQQHGWYETWSQIVELGDPFGEQNAFKVLGLAHTARQSEINSACRHLSVKYHPDKAKSDEEKQHNQSKFYEIQQACELLSNKHAKRRQKNQRSQ
cccccccccccccccccccccccccccccHHHHHHHHHHHHHccccccEEEcccccHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcEEcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHcccccccccEEEEcccccccHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHccc
cccccccccccccccccccccHHccccHHHHHHHHHHHHHHccccccHHEEcccccHEEEEEEHHccHHHHHHHHHHHHcHHHHHHHHccHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHcHHHHHccccHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcEEccccccEEEHHHHHHHHHccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHccccccccHHEEEcccccccHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHccc
msrkhnssdtnyvtsrtynnsdktkvhAEKSLYITYLLWLVGGIFGVHHFYLGRDIQGFLWWCtlggyfgfgwLRDIFHIQNYvadankdrDYLDKFnhnlrsykyppfstirfTGMTVVAYLWSTVVSmaipeedigglpwkyLHFLLPIACALGvwsvgnigheTGTIWWCLAAAYacypvywyvdesTACTVMVLASALAFDTLskrwqtkpkprkrfLRRCLTIGACALLYSSLWGSYlyfnakitdgegeeiplneaihhffkspwwvdLKQSLVDTWEFAQQHGWYETWSQIVElgdpfgeqnaFKVLGLAHTARQSEINSACrhlsvkyhpdkaksdeekqhNQSKFYEIQQACELLSNKHAKRRQKNQRSQ
msrkhnssdtnyvtsrtynnsdktkvHAEKSLYITYLLWLVGGIFGVHHFYLGRDIQGFLWWCTLGGYFGFGWLRDIFHIQNYVADANKDRDYLDKFNHnlrsykyppfstiRFTGMTVVAYLWSTVVSMAIPEEDIGGLPWKYLHFLLPIACALGVWSVGNIGHETGTIWWCLAAAYACYPVYWYVDESTACTVMVLASALAFdtlskrwqtkpkprkrflrRCLTIGACALLYSSLWGSYLYFNAKITDGEGEEIPLNEAIHHFFKSPWWVDLKQSLVDTWEFAQQHGWYETWSQIVELGDPFGEQNAFKVLGLAHTARQSEINSACRHLSVKYHPDKAKSDEEKQHNQSKFYEIQQACELlsnkhakrrqknqrsq
MSRKHNSSDTNYVTSRTYNNSDKTKVHAEKSLYITYLLWLVGGIFGVHHFYLGRDIQGFLWWCTLGGYFGFGWLRDIFHIQNYVADANKDRDYLDKFNHNLRSYKYPPFSTIRFTGMTVVAYLWSTVVSMAIPEEDIGGLPWKYLHFLLPIACALGVWSVGNIGHETGTIWWCLAAAYACYPVYWYVDESTACTVMVLASALAFDTLSKRWQTKPKPRKRFLRRCLTIGACAllysslwgsylyFNAKITDGEGEEIPLNEAIHHFFKSPWWVDLKQSLVDTWEFAQQHGWYETWSQIVELGDPFGEQNAFKVLGLAHTARQSEINSACRHLSVKYHPDKAKSDEEKQHNQSKFYEIQQACELLSNKHAKRRQKNQRSQ
*************************VHAEKSLYITYLLWLVGGIFGVHHFYLGRDIQGFLWWCTLGGYFGFGWLRDIFHIQNYVADANKDRDYLDKFNHNLRSYKYPPFSTIRFTGMTVVAYLWSTVVSMAIPEEDIGGLPWKYLHFLLPIACALGVWSVGNIGHETGTIWWCLAAAYACYPVYWYVDESTACTVMVLASALAFDTLSKRWQTKPKPRKRFLRRCLTIGACALLYSSLWGSYLYFNAKITDGEGEEIPLNEAIHHFFKSPWWVDLKQSLVDTWEFAQQHGWYETWSQIVELGDPFGEQNAFKVLGLAHTARQSEINSACRHL***********************************************
*******************************LYITYLLWLVGGIFGVHHFYLGRDIQGFLWWCTLGGYFGFGWLRDIFHIQNYVADANKDR*******************TIRFTGMTVVAYLWSTVVSMAIPEEDIGGLPWKYLHFLLPIACALGVWSVGNIGHETGTIWWCLAAAYACYPVYWYVDESTACTVMVLASALAFDTLS**************RRCLTIGACALLYSSLWGSYLYFNAKITDGEGEEIPLNEAIHHFFKSPWWVDLKQSLVDTWEFAQQHGWYETWSQIVELGDPFGEQNAFKVLGLAHTARQSEINSACRHLSVKYHPDKAKSD****HNQSKFYEIQQACELL***************
***********YVTSRTYNNSDKTKVHAEKSLYITYLLWLVGGIFGVHHFYLGRDIQGFLWWCTLGGYFGFGWLRDIFHIQNYVADANKDRDYLDKFNHNLRSYKYPPFSTIRFTGMTVVAYLWSTVVSMAIPEEDIGGLPWKYLHFLLPIACALGVWSVGNIGHETGTIWWCLAAAYACYPVYWYVDESTACTVMVLASALAFDTLSKRWQTKPKPRKRFLRRCLTIGACALLYSSLWGSYLYFNAKITDGEGEEIPLNEAIHHFFKSPWWVDLKQSLVDTWEFAQQHGWYETWSQIVELGDPFGEQNAFKVLGLAHTARQSEINSACRHLSVKY***************SKFYEIQQACELLSN*************
***********************TKVHAEKSLYITYLLWLVGGIFGVHHFYLGRDIQGFLWWCTLGGYFGFGWLRDIFHIQNYVADANKDRDYLDKFNHNLRSYKYPPFSTIRFTGMTVVAYLWSTVVSMAIPEEDIGGLPWKYLHFLLPIACALGVWSVGNIGHETGTIWWCLAAAYACYPVYWYVDESTACTVMVLASALAFDTLSKRWQTKPKPRKRFLRRCLTIGACALLYSSLWGSYLYFNAKITDGEGEEIPLNEAIHHFFKSPWWVDLKQSLVDTWEFAQQHGWYETWSQIVELGDPFGEQNAFKVLGLAHTARQSEINSACRHLSVKYHPDKAKSDEEKQHNQSKFYEIQQACELLSNKHAKR********
oooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiHHHHHHHHHHHHHHHHooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSRKHNSSDTNYVTSRTYNNSDKTKVHAEKSLYITYLLWLVGGIFGVHHFYLGRDIQGFLWWCTLGGYFGFGWLRDIFHIQNYVADANKDRDYLDKFNHNLRSYKYPPFSTIRFTGMTVVAYLWSTVVSMAIPEEDIGGLPWKYLHFLLPIACALGVWSVGNIGHETGTIWWCLAAAYACYPVYWYVDESTACTVMVLASALAFDTLSKRWQTKPKPRKRFLRRCLTIGACALLYSSLWGSYLYFNAKITDGEGEEIPLNEAIHHFFKSPWWVDLKQSLVDTWEFAQQHGWYETWSQIVELGDPFGEQNAFKVLGLAHTARQSEINSACRHLSVKYHPDKAKSDEEKQHNQSKFYEIQQACELLSNKHAKRRQKNQRSQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query379 2.2.26 [Sep-21-2011]
A9ULE9340 DnaJ homolog subfamily C yes N/A 0.825 0.920 0.282 3e-21
Q8CHS2339 DnaJ homolog subfamily C yes N/A 0.846 0.946 0.280 2e-16
Q5PR00341 DnaJ homolog subfamily C yes N/A 0.846 0.941 0.280 4e-15
Q17QW0347 DnaJ homolog subfamily C yes N/A 0.846 0.925 0.280 8e-15
Q5RBD7341 DnaJ homolog subfamily C yes N/A 0.862 0.958 0.256 5e-14
Q8N4W6341 DnaJ homolog subfamily C yes N/A 0.820 0.912 0.266 6e-12
Q9GPR3153 TM2 domain-containing pro yes N/A 0.179 0.444 0.449 5e-09
Q8KCD8 403 Chaperone protein DnaJ OS yes N/A 0.155 0.146 0.419 8e-07
Q601X8 368 Chaperone protein DnaJ OS yes N/A 0.179 0.184 0.436 9e-07
Q54KZ0137 TM2 domain-containing pro no N/A 0.163 0.452 0.412 2e-06
>sp|A9ULE9|DJC22_XENTR DnaJ homolog subfamily C member 22 OS=Xenopus tropicalis GN=dnajc22 PE=2 SV=1 Back     alignment and function desciption
 Score =  103 bits (256), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 99/351 (28%), Positives = 150/351 (42%), Gaps = 38/351 (10%)

Query: 30  KSLYITYLLWLVGGIFGVHHFYLGRDIQGFLWWCTLGGYFGFGWLRDIFHIQNYVADANK 89
           KSL   Y LW +GG  G++H YLGRD    LW  TLGG FG GW+ D + I  +V   N+
Sbjct: 3   KSLLAAYGLWALGGPLGLYHIYLGRDSHALLWMLTLGG-FGMGWMWDFWKIPIHVYKYNR 61

Query: 90  DRDYLDKFNHNLRSYKYPPFSTIRFTGMTVVAYLWSTVVSMAIPEEDIGGLPWKYLHFLL 149
                ++ N  ++  + PP S IRF G       +  V ++ +           +   +L
Sbjct: 62  Q----ERKNIEVKEGE-PPASPIRFIGQVATGIYFGIVAAIGL------SFLSSFHMVVL 110

Query: 150 PIACALGVWSVGNIGHETGTIWWCLAAAYACYPVYWYVDESTACTVMVLASALAFDTLSK 209
           P+A ALGV  V  +G +T  +   L AA+   P+++          M+  S  A  T  K
Sbjct: 111 PLAVALGVHLVATVGEQTSDLKNTLIAAFLTSPIFY-----GRAVSMIPISLTASITSQK 165

Query: 210 --RWQTKPKPRKRFLRRCLTIGACALLYSSLWGSYLYFNAKITDG--EGEEIPLNEAIHH 265
             R++ + + +++   R   IG   L ++         N  +T     G    + E +  
Sbjct: 166 HMRYRLQQEKQEKLSLRLYRIGLVYLAFTGPLAYSALLNTSLTVSYVAGSIGSMLEWLSI 225

Query: 266 FFKSPWWVDLKQSLV----DTWEFAQQHG-----WYETWSQIVELGDPF---GEQNAFKV 313
           F   P    L + L+      W      G     +++ W +I E    F    E+ A KV
Sbjct: 226 F---PSISALVERLLLLPYRVWAVFSGGGVFRDHYFKEWEKIYEFVATFQSEKEEMACKV 282

Query: 314 LGLAHTARQSEINSACRHLSVKYHPDKAKSDEEKQHNQSKFYEIQQACELL 364
           LG+   +   EIN   R L   +HPD  +   E+   Q  F EIQ A E L
Sbjct: 283 LGVNFKSTMEEINRKYRELVKIWHPDHNRHRLEEA--QEHFLEIQAAYETL 331
May function as a co-chaperone.
Xenopus tropicalis (taxid: 8364)
>sp|Q8CHS2|DJC22_MOUSE DnaJ homolog subfamily C member 22 OS=Mus musculus GN=Dnajc22 PE=2 SV=1 Back     alignment and function description
>sp|Q5PR00|DJC22_RAT DnaJ homolog subfamily C member 22 OS=Rattus norvegicus GN=Dnajc22 PE=2 SV=1 Back     alignment and function description
>sp|Q17QW0|DJC22_BOVIN DnaJ homolog subfamily C member 22 OS=Bos taurus GN=DNAJC22 PE=2 SV=2 Back     alignment and function description
>sp|Q5RBD7|DJC22_PONAB DnaJ homolog subfamily C member 22 OS=Pongo abelii GN=DNAJC22 PE=2 SV=1 Back     alignment and function description
>sp|Q8N4W6|DJC22_HUMAN DnaJ homolog subfamily C member 22 OS=Homo sapiens GN=DNAJC22 PE=2 SV=1 Back     alignment and function description
>sp|Q9GPR3|TM2D1_DICDI TM2 domain-containing protein DDB_G0277895 OS=Dictyostelium discoideum GN=DDB_G0277895 PE=3 SV=1 Back     alignment and function description
>sp|Q8KCD8|DNAJ_CHLTE Chaperone protein DnaJ OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / TLS) GN=dnaJ PE=3 SV=1 Back     alignment and function description
>sp|Q601X8|DNAJ_MYCH2 Chaperone protein DnaJ OS=Mycoplasma hyopneumoniae (strain 232) GN=dnaJ PE=3 SV=2 Back     alignment and function description
>sp|Q54KZ0|TM2D3_DICDI TM2 domain-containing protein DDB_G0287015 OS=Dictyostelium discoideum GN=DDB_G0287015 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query379
328713027403 PREDICTED: dnaJ homolog subfamily C memb 0.907 0.853 0.589 1e-125
378466220358 DnaJ-18 [Bombyx mori] 0.920 0.974 0.525 1e-110
157124775421 hypothetical protein AaeL_AAEL009967 [Ae 0.997 0.897 0.480 1e-105
157129111421 hypothetical protein AaeL_AAEL011345 [Ae 0.997 0.897 0.480 1e-105
91079244360 PREDICTED: similar to wurst CG9089-PA [T 0.889 0.936 0.539 1e-104
170067993412 wurst [Culex quinquefasciatus] gi|167864 0.957 0.881 0.464 1e-100
383865204377 PREDICTED: dnaJ homolog subfamily C memb 0.905 0.909 0.501 1e-99
312376537408 hypothetical protein AND_12622 [Anophele 0.889 0.825 0.507 5e-99
158286207440 AGAP007138-PA [Anopheles gambiae str. PE 0.957 0.825 0.465 1e-98
156537787371 PREDICTED: dnaJ homolog subfamily C memb 0.947 0.967 0.5 1e-98
>gi|328713027|ref|XP_001945892.2| PREDICTED: dnaJ homolog subfamily C member 22-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  455 bits (1171), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 210/356 (58%), Positives = 269/356 (75%), Gaps = 12/356 (3%)

Query: 34  ITYLLWLVGGIFGVHHFYLGRDIQGFLWWCTLGGYFGFGWLRDIFHIQNYVADANKDRDY 93
           +TYLLWLVGG+ G+HHFYLGRD+QG LWWCT GGYFGFGWLRD+F+I  YVADANKD  Y
Sbjct: 43  LTYLLWLVGGVCGLHHFYLGRDLQGVLWWCTFGGYFGFGWLRDLFYIGEYVADANKDEKY 102

Query: 94  LDKFNHNLRSYKYPPFSTIRFTGMTVVAYLWSTVVSMAIPEEDIGGLPWKYLHFLLPIAC 153
           + K ++ +R Y+ PPFST+RFTGM VVAYL+STVVS+AIPE+++ GL W++L    P+A 
Sbjct: 103 MKKVDYMVRVYEKPPFSTVRFTGMVVVAYLFSTVVSLAIPEDNVAGLSWQWLQIFTPLAA 162

Query: 154 ALGVWSVGNIGHETGTIWWCLAAAYACYPVY------------WYVDESTACTVMVLASA 201
           ALGVW+VGNIGHETG+I W L  AY    V             + +DEST+  +M+L++A
Sbjct: 163 ALGVWAVGNIGHETGSIKWPLICAYLVPMVGNPLKSFIFDKWGYDIDESTSFAIMILSAA 222

Query: 202 LAFDTLSKRWQTKPKPRKRFLRRCLTIGACALLYSSLWGSYLYFNAKITDGEGEEIPLNE 261
            +FD L KRW+ K +     L+R + I  C LLY +LW SYLYFNAK+TD +G+E+P +E
Sbjct: 223 WSFDHLEKRWRPKNQKTPGTLKRIVVISMCCLLYMALWSSYLYFNAKVTDEDGDEVPFHE 282

Query: 262 AIHHFFKSPWWVDLKQSLVDTWEFAQQHGWYETWSQIVELGDPFGEQNAFKVLGLAHTAR 321
           A+ HFF SPWW+D+KQS +D W+FAQ+HGW ETW QIV L DP GEQNAFKVL L   A 
Sbjct: 283 ALGHFFSSPWWLDVKQSFIDVWQFAQEHGWMETWRQIVSLSDPSGEQNAFKVLELRSGAT 342

Query: 322 QSEINSACRHLSVKYHPDKAKSDEEKQHNQSKFYEIQQACELLSNKHAKRRQKNQR 377
           Q+EI + CR L+VKYHPDKAK D  ++  Q++F+E+QQACELLSN  AKRR++N++
Sbjct: 343 QTEIKNQCRTLAVKYHPDKAKDDITRKDVQNRFFEVQQACELLSNSRAKRRRRNKQ 398

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|378466220|gb|AFC01232.1| DnaJ-18 [Bombyx mori] Back     alignment and taxonomy information
>gi|157124775|ref|XP_001660518.1| hypothetical protein AaeL_AAEL009967 [Aedes aegypti] gi|108873889|gb|EAT38114.1| AAEL009967-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|157129111|ref|XP_001661613.1| hypothetical protein AaeL_AAEL011345 [Aedes aegypti] gi|94468422|gb|ABF18060.1| predicted membrane protein [Aedes aegypti] gi|108872361|gb|EAT36586.1| AAEL011345-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|91079244|ref|XP_971138.1| PREDICTED: similar to wurst CG9089-PA [Tribolium castaneum] gi|270003554|gb|EFA00002.1| hypothetical protein TcasGA2_TC002805 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|170067993|ref|XP_001868697.1| wurst [Culex quinquefasciatus] gi|167864124|gb|EDS27507.1| wurst [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|383865204|ref|XP_003708065.1| PREDICTED: dnaJ homolog subfamily C member 22-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|312376537|gb|EFR23592.1| hypothetical protein AND_12622 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|158286207|ref|XP_308621.4| AGAP007138-PA [Anopheles gambiae str. PEST] gi|157020358|gb|EAA04160.5| AGAP007138-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|156537787|ref|XP_001608046.1| PREDICTED: dnaJ homolog subfamily C member 22-like [Nasonia vitripennis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query379
FB|FBgn0030805406 wus "wurst" [Drosophila melano 0.923 0.862 0.461 2.9e-87
MGI|MGI:1920028339 Dnajc22 "DnaJ (Hsp40) homolog, 0.849 0.949 0.278 2.9e-25
RGD|1311098341 Dnajc22 "DnaJ (Hsp40) homolog, 0.849 0.944 0.276 6.8e-24
UNIPROTKB|Q8N4W6341 DNAJC22 "DnaJ homolog subfamil 0.379 0.422 0.339 9e-23
UNIPROTKB|Q17QW0347 DNAJC22 "DnaJ homolog subfamil 0.379 0.414 0.333 2e-22
DICTYBASE|DDB_G0277895153 DDB_G0277895 "TM2 domain conta 0.179 0.444 0.449 2.8e-10
DICTYBASE|DDB_G0287015137 DDB_G0287015 "TM2 domain-conta 0.174 0.481 0.426 1.6e-08
DICTYBASE|DDB_G0278163161 DDB_G0278163 "TM2 domain-conta 0.174 0.409 0.388 1.5e-07
UNIPROTKB|Q8EFW594 SO_1850 "DnaJ domain protein" 0.153 0.617 0.433 5.2e-07
TIGR_CMR|SO_185094 SO_1850 "DnaJ domain protein" 0.153 0.617 0.433 5.2e-07
FB|FBgn0030805 wus "wurst" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 872 (312.0 bits), Expect = 2.9e-87, P = 2.9e-87
 Identities = 163/353 (46%), Positives = 223/353 (63%)

Query:    29 EKSLYITYLLWLVGGIFGVHHFYLGRDIQGFLWWCTLGGYFGFGWLRDIFHIQNYVADAN 88
             +KS+ I YL WL GGIFG+HH YL RD   F+WWCTLGGY G GW+ ++F I  YV DAN
Sbjct:    48 QKSVVIAYLCWLFGGIFGLHHLYLHRDRHAFIWWCTLGGYMGIGWMGELFLIPEYVRDAN 107

Query:    89 KDRDYLDKFNHNLRSYKYPPFSTIRFTGMTVVAYLWSTVVSMAIPEEDIGGLPWKYLHFL 148
             +D  ++  F   L++Y  PP+S+ RF G  ++ +L+  V SMAIPE  +GG    +LH+ 
Sbjct:   108 EDPKFVKMFVAKLQAYPKPPYSSKRFVGQVMIGHLFGQVCSMAIPETLVGGWDLSFLHWT 167

Query:   149 LPIACALGVWSVGNIGHETGTIWW-CLAAAYACYPV-YWYVDESTACTVMVLASALAFDT 206
             +P+  +LGVW VGNIG E G +WW CL AAY  YP  Y   DE+ +  +  L +AL FD 
Sbjct:   168 IPLFVSLGVWLVGNIGREQG-VWWHCLVAAYLAYPARYLIYDETYSLLLTGLVAALTFDG 226

Query:   207 LSKRWQTKPKPRKRFLRRCLTIGACAXXXXXXXXXXXXFNAKITDGEGEEIPLNEAIHHF 266
             LSK+W+  P  R     R   +                FN  I+D +G E+P++EAIH+F
Sbjct:   227 LSKQWRRTPPRRGSPGERTFKLTTAVIIYCAFWGSFLYFNGTISDEDGGEVPIHEAIHNF 286

Query:   267 FKSPWWVDLKQSLVDTWEFAQQHGWYETWSQIVELGDPFGEQNAFKVLGLAHTARQSEIN 326
               S WW DLKQ+L+DT+ +AQ HGWYETW ++ E  D  GE+N++KVLG++ TA Q+EI 
Sbjct:   287 LASAWWTDLKQALLDTYNYAQHHGWYETWKEVFESMDVDGERNSYKVLGVSATASQAEIT 346

Query:   327 SACRHLSVKYHPDKAKSDEEKQHNQSKFYEIQQACELLSNKHAKRRQKNQRSQ 379
             +A R LS +YHPDK K +  +     +F EIQQA  +LS   + RR+KN++ Q
Sbjct:   347 AAYRKLSKEYHPDKVKDEGLRAQAHQRFIEIQQAYSVLSKIKSNRRRKNKQYQ 399
GO:0007424 "open tracheal system development" evidence=IMP
GO:0035002 "liquid clearance, open tracheal system" evidence=IMP
GO:0006897 "endocytosis" evidence=IMP
GO:0005886 "plasma membrane" evidence=IDA
GO:0035159 "regulation of tube length, open tracheal system" evidence=IMP
GO:0030198 "extracellular matrix organization" evidence=IMP
GO:0031410 "cytoplasmic vesicle" evidence=IDA
GO:0005769 "early endosome" evidence=IDA
MGI|MGI:1920028 Dnajc22 "DnaJ (Hsp40) homolog, subfamily C, member 22" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1311098 Dnajc22 "DnaJ (Hsp40) homolog, subfamily C, member 22" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|Q8N4W6 DNAJC22 "DnaJ homolog subfamily C member 22" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q17QW0 DNAJC22 "DnaJ homolog subfamily C member 22" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0277895 DDB_G0277895 "TM2 domain containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0287015 DDB_G0287015 "TM2 domain-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0278163 DDB_G0278163 "TM2 domain-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|Q8EFW5 SO_1850 "DnaJ domain protein" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
TIGR_CMR|SO_1850 SO_1850 "DnaJ domain protein" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q17QW0DJC22_BOVINNo assigned EC number0.28080.84690.9250yesN/A
Q5PR00DJC22_RATNo assigned EC number0.28080.84690.9413yesN/A
Q8N4W6DJC22_HUMANNo assigned EC number0.26680.82050.9120yesN/A
A9ULE9DJC22_XENTRNo assigned EC number0.28200.82580.9205yesN/A
Q5RBD7DJC22_PONABNo assigned EC number0.25690.86270.9589yesN/A
Q8CHS2DJC22_MOUSENo assigned EC number0.28080.84690.9469yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query379
pfam0515451 pfam05154, TM2, TM2 domain 2e-15
pfam0022663 pfam00226, DnaJ, DnaJ domain 7e-12
COG0484 371 COG0484, DnaJ, DnaJ-class molecular chaperone with 1e-11
cd0625755 cd06257, DnaJ, DnaJ domain or J-domain 6e-11
smart0027160 smart00271, DnaJ, DnaJ molecular chaperone homolog 5e-10
PRK14281 397 PRK14281, PRK14281, chaperone protein DnaJ; Provis 1e-09
TIGR02349 354 TIGR02349, DnaJ_bact, chaperone protein DnaJ 3e-09
PRK14284 391 PRK14284, PRK14284, chaperone protein DnaJ; Provis 5e-09
PRK14286 372 PRK14286, PRK14286, chaperone protein DnaJ; Provis 1e-08
PRK14276 380 PRK14276, PRK14276, chaperone protein DnaJ; Provis 2e-08
PHA0188678 PHA01886, PHA01886, TM2 domain-containing protein 2e-08
PRK14297 380 PRK14297, PRK14297, chaperone protein DnaJ; Provis 3e-08
PRK14295 389 PRK14295, PRK14295, chaperone protein DnaJ; Provis 5e-08
PRK14277 386 PRK14277, PRK14277, chaperone protein DnaJ; Provis 6e-08
PRK14290 365 PRK14290, PRK14290, chaperone protein DnaJ; Provis 1e-07
PRK14280 376 PRK14280, PRK14280, chaperone protein DnaJ; Provis 1e-07
PRK14285 365 PRK14285, PRK14285, chaperone protein DnaJ; Provis 2e-07
PRK14291 382 PRK14291, PRK14291, chaperone protein DnaJ; Provis 2e-07
PRK14278 378 PRK14278, PRK14278, chaperone protein DnaJ; Provis 6e-07
PTZ00037 421 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Prov 7e-07
PRK14296 372 PRK14296, PRK14296, chaperone protein DnaJ; Provis 8e-07
PRK10767 371 PRK10767, PRK10767, chaperone protein DnaJ; Provis 1e-06
COG2214 237 COG2214, CbpA, DnaJ-class molecular chaperone [Pos 1e-06
COG5407 610 COG5407, SEC63, Preprotein translocase subunit Sec 1e-06
TIGR03835 871 TIGR03835, termin_org_DnaJ, terminal organelle ass 2e-06
PRK14298 377 PRK14298, PRK14298, chaperone protein DnaJ; Provis 3e-06
PRK14282 369 PRK14282, PRK14282, chaperone protein DnaJ; Provis 4e-06
PRK14289 386 PRK14289, PRK14289, chaperone protein DnaJ; Provis 7e-06
PRK14299 291 PRK14299, PRK14299, chaperone protein DnaJ; Provis 7e-06
PRK14283 378 PRK14283, PRK14283, chaperone protein DnaJ; Provis 7e-06
PRK14292 371 PRK14292, PRK14292, chaperone protein DnaJ; Provis 2e-05
PRK14294 366 PRK14294, PRK14294, chaperone protein DnaJ; Provis 2e-05
PRK14301 373 PRK14301, PRK14301, chaperone protein DnaJ; Provis 3e-05
PRK14300 372 PRK14300, PRK14300, chaperone protein DnaJ; Provis 5e-05
PRK14287 371 PRK14287, PRK14287, chaperone protein DnaJ; Provis 8e-05
COG231495 COG2314, XynA, Predicted membrane protein [Functio 4e-04
PRK14293 374 PRK14293, PRK14293, chaperone protein DnaJ; Provis 5e-04
PRK14279 392 PRK14279, PRK14279, chaperone protein DnaJ; Provis 5e-04
PRK09430267 PRK09430, djlA, Dna-J like membrane chaperone prot 0.001
PRK10266 306 PRK10266, PRK10266, curved DNA-binding protein Cbp 0.002
PRK01356166 PRK01356, hscB, co-chaperone HscB; Provisional 0.004
>gnl|CDD|218469 pfam05154, TM2, TM2 domain Back     alignment and domain information 
 Score = 69.5 bits (171), Expect = 2e-15
 Identities = 23/50 (46%), Positives = 27/50 (54%)

Query: 29 EKSLYITYLLWLVGGIFGVHHFYLGRDIQGFLWWCTLGGYFGFGWLRDIF 78
          +KS  I  LL L  G FGVH FYLG+   G L+  T  G  G  WL D+ 
Sbjct: 2  KKSKLIALLLSLFLGGFGVHRFYLGKTGTGILYLLTFWGILGIWWLIDLI 51

This family is composed of a pair of transmembrane alpha helices connected by a short linker. The function of this domain is unknown, however it occurs in a wide range or protein contexts. Length = 51
>gnl|CDD|215804 pfam00226, DnaJ, DnaJ domain Back     alignment and domain information
>gnl|CDD|223560 COG0484, DnaJ, DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|99751 cd06257, DnaJ, DnaJ domain or J-domain Back     alignment and domain information
>gnl|CDD|197617 smart00271, DnaJ, DnaJ molecular chaperone homology domain Back     alignment and domain information
>gnl|CDD|237657 PRK14281, PRK14281, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|233829 TIGR02349, DnaJ_bact, chaperone protein DnaJ Back     alignment and domain information
>gnl|CDD|237658 PRK14284, PRK14284, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172774 PRK14286, PRK14286, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237653 PRK14276, PRK14276, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|222840 PHA01886, PHA01886, TM2 domain-containing protein Back     alignment and domain information
>gnl|CDD|184611 PRK14297, PRK14297, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237665 PRK14295, PRK14295, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184599 PRK14277, PRK14277, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172778 PRK14290, PRK14290, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237656 PRK14280, PRK14280, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172773 PRK14285, PRK14285, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237661 PRK14291, PRK14291, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237654 PRK14278, PRK14278, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|240236 PTZ00037, PTZ00037, DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>gnl|CDD|237666 PRK14296, PRK14296, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|236757 PRK10767, PRK10767, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|225124 COG2214, CbpA, DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|227694 COG5407, SEC63, Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>gnl|CDD|234368 TIGR03835, termin_org_DnaJ, terminal organelle assembly protein TopJ Back     alignment and domain information
>gnl|CDD|184612 PRK14298, PRK14298, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184603 PRK14282, PRK14282, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237660 PRK14289, PRK14289, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237667 PRK14299, PRK14299, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|184604 PRK14283, PRK14283, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237662 PRK14292, PRK14292, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237664 PRK14294, PRK14294, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237668 PRK14301, PRK14301, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|172788 PRK14300, PRK14300, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237659 PRK14287, PRK14287, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|225196 COG2314, XynA, Predicted membrane protein [Function unknown] Back     alignment and domain information
>gnl|CDD|237663 PRK14293, PRK14293, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|237655 PRK14279, PRK14279, chaperone protein DnaJ; Provisional Back     alignment and domain information
>gnl|CDD|236512 PRK09430, djlA, Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information
>gnl|CDD|182347 PRK10266, PRK10266, curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>gnl|CDD|167217 PRK01356, hscB, co-chaperone HscB; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 379
PHA0188678 TM2 domain-containing protein 99.86
COG0484 371 DnaJ DnaJ-class molecular chaperone with C-termina 99.85
KOG0713|consensus 336 99.81
PRK14288 369 chaperone protein DnaJ; Provisional 99.74
PRK14296 372 chaperone protein DnaJ; Provisional 99.73
PRK14279 392 chaperone protein DnaJ; Provisional 99.7
PF0022664 DnaJ: DnaJ domain; InterPro: IPR001623 The prokary 99.7
PRK14286 372 chaperone protein DnaJ; Provisional 99.7
KOG0718|consensus 546 99.69
KOG0712|consensus 337 99.68
PRK14287 371 chaperone protein DnaJ; Provisional 99.68
PRK14299 291 chaperone protein DnaJ; Provisional 99.67
KOG0717|consensus 508 99.67
PRK14282 369 chaperone protein DnaJ; Provisional 99.67
PRK14276 380 chaperone protein DnaJ; Provisional 99.67
PRK14283 378 chaperone protein DnaJ; Provisional 99.67
PTZ00037 421 DnaJ_C chaperone protein; Provisional 99.67
PRK14295 389 chaperone protein DnaJ; Provisional 99.66
PRK14277 386 chaperone protein DnaJ; Provisional 99.66
PRK14285 365 chaperone protein DnaJ; Provisional 99.66
KOG0550|consensus486 99.66
PRK14298 377 chaperone protein DnaJ; Provisional 99.66
PRK14301 373 chaperone protein DnaJ; Provisional 99.65
KOG4272|consensus164 99.65
PRK14294 366 chaperone protein DnaJ; Provisional 99.65
PRK14280 376 chaperone protein DnaJ; Provisional 99.65
PRK14291 382 chaperone protein DnaJ; Provisional 99.65
PRK14297 380 chaperone protein DnaJ; Provisional 99.65
PRK14278 378 chaperone protein DnaJ; Provisional 99.64
PRK14284 391 chaperone protein DnaJ; Provisional 99.64
PRK10767 371 chaperone protein DnaJ; Provisional 99.64
KOG0716|consensus 279 99.63
PRK14281 397 chaperone protein DnaJ; Provisional 99.62
KOG0715|consensus 288 99.62
KOG0691|consensus 296 99.61
PRK14289 386 chaperone protein DnaJ; Provisional 99.6
smart0027160 DnaJ DnaJ molecular chaperone homology domain. 99.6
KOG0624|consensus504 99.6
PRK10266 306 curved DNA-binding protein CbpA; Provisional 99.6
PRK14290 365 chaperone protein DnaJ; Provisional 99.59
PRK14300 372 chaperone protein DnaJ; Provisional 99.59
TIGR02349 354 DnaJ_bact chaperone protein DnaJ. This model repre 99.59
PRK14292 371 chaperone protein DnaJ; Provisional 99.57
cd0625755 DnaJ DnaJ domain or J-domain. DnaJ/Hsp40 (heat sho 99.56
PRK14293 374 chaperone protein DnaJ; Provisional 99.56
KOG0719|consensus 264 99.56
PTZ00341 1136 Ring-infected erythrocyte surface antigen; Provisi 99.54
PF0515451 TM2: TM2 domain; InterPro: IPR007829 This domain i 99.5
COG2214 237 CbpA DnaJ-class molecular chaperone [Posttranslati 99.49
PRK01356166 hscB co-chaperone HscB; Provisional 99.49
KOG0721|consensus230 99.49
PHA03102153 Small T antigen; Reviewed 99.48
PRK05014171 hscB co-chaperone HscB; Provisional 99.45
TIGR03835 871 termin_org_DnaJ terminal organelle assembly protei 99.42
PRK00294173 hscB co-chaperone HscB; Provisional 99.41
PRK03578176 hscB co-chaperone HscB; Provisional 99.39
KOG0720|consensus 490 99.39
PTZ00100116 DnaJ chaperone protein; Provisional 99.32
PRK09430267 djlA Dna-J like membrane chaperone protein; Provis 99.31
KOG0722|consensus 329 99.29
KOG0714|consensus 306 99.19
PRK01773173 hscB co-chaperone HscB; Provisional 99.15
PHA02624 647 large T antigen; Provisional 99.12
COG5407 610 SEC63 Preprotein translocase subunit Sec63 [Intrac 99.11
TIGR00714157 hscB Fe-S protein assembly co-chaperone HscB. This 98.97
KOG1150|consensus 250 98.84
COG5269 379 ZUO1 Ribosome-associated chaperone zuotin [Transla 98.6
KOG1789|consensus 2235 98.32
COG231495 XynA Predicted membrane protein [Function unknown] 98.26
KOG0723|consensus112 98.26
KOG0568|consensus 342 98.01
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 97.5
KOG3192|consensus168 97.49
COG1076174 DjlA DnaJ-domain-containing proteins 1 [Posttransl 96.38
PF03656127 Pam16: Pam16; InterPro: IPR005341 The Pam16 protei 96.11
KOG0431|consensus453 95.48
PF1344662 RPT: A repeated domain in UCH-protein 92.87
PF14687112 DUF4460: Domain of unknown function (DUF4460) 87.95
>PHA01886 TM2 domain-containing protein Back     alignment and domain information 
Probab=99.86  E-value=4.1e-22  Score=156.98  Aligned_cols=63  Identities=40%  Similarity=0.827  Sum_probs=60.0

Q ss_pred             CchHHHHHHHHHHhhhcccceeecCCchhHHHHHHhhhhhhhHHHHHHHHHhhHHHHHHhhchh
Q psy8728          29 EKSLYITYLLWLVGGIFGVHHFYLGRDIQGFLWWCTLGGYFGFGWLRDIFHIQNYVADANKDRD   92 (379)
Q Consensus        29 ~k~~~~a~~l~~~~G~~G~HrfYlg~~~~g~~~~~t~gg~~~i~~~~D~~~i~~~v~~~n~~~~   92 (379)
                      .||+.+||+||+|+|.+|+||||||++++|++|++|+ |++||||++|+|+||.+|+++|.+.+
T Consensus         1 ~Ks~~~AylL~~flG~~G~HRFYlG~~~~Gi~~l~t~-G~~gig~liD~flIp~~v~~~N~~~~   63 (78)
T PHA01886          1 MKSTAIAYVLWFFLGFFGIHRFYTGNIATGIIWLFTG-GLFGIGWFIDLFLTAGLVQSSNVRWR   63 (78)
T ss_pred             CCcHHHHHHHHHHHhhcccchhhcCChhHHHHHHHHH-HHHHHHHHHHHHHHHHHHHHHHHhhh
Confidence            3899999999999999999999999999999999999 55899999999999999999999876

>COG0484 DnaJ DnaJ-class molecular chaperone with C-terminal Zn finger domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0713|consensus Back     alignment and domain information
>PRK14288 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14296 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14279 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PF00226 DnaJ: DnaJ domain; InterPro: IPR001623 The prokaryotic heat shock protein DnaJ interacts with the chaperone hsp70-like DnaK protein [] Back     alignment and domain information
>PRK14286 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0718|consensus Back     alignment and domain information
>KOG0712|consensus Back     alignment and domain information
>PRK14287 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14299 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0717|consensus Back     alignment and domain information
>PRK14282 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14276 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14283 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PTZ00037 DnaJ_C chaperone protein; Provisional Back     alignment and domain information
>PRK14295 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14277 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14285 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0550|consensus Back     alignment and domain information
>PRK14298 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14301 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG4272|consensus Back     alignment and domain information
>PRK14294 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14280 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14291 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14297 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14278 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14284 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK10767 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0716|consensus Back     alignment and domain information
>PRK14281 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0715|consensus Back     alignment and domain information
>KOG0691|consensus Back     alignment and domain information
>PRK14289 chaperone protein DnaJ; Provisional Back     alignment and domain information
>smart00271 DnaJ DnaJ molecular chaperone homology domain Back     alignment and domain information
>KOG0624|consensus Back     alignment and domain information
>PRK10266 curved DNA-binding protein CbpA; Provisional Back     alignment and domain information
>PRK14290 chaperone protein DnaJ; Provisional Back     alignment and domain information
>PRK14300 chaperone protein DnaJ; Provisional Back     alignment and domain information
>TIGR02349 DnaJ_bact chaperone protein DnaJ Back     alignment and domain information
>PRK14292 chaperone protein DnaJ; Provisional Back     alignment and domain information
>cd06257 DnaJ DnaJ domain or J-domain Back     alignment and domain information
>PRK14293 chaperone protein DnaJ; Provisional Back     alignment and domain information
>KOG0719|consensus Back     alignment and domain information
>PTZ00341 Ring-infected erythrocyte surface antigen; Provisional Back     alignment and domain information
>PF05154 TM2: TM2 domain; InterPro: IPR007829 This domain is composed of a pair of transmembrane alpha helices connected by a short linker Back     alignment and domain information
>COG2214 CbpA DnaJ-class molecular chaperone [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK01356 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG0721|consensus Back     alignment and domain information
>PHA03102 Small T antigen; Reviewed Back     alignment and domain information
>PRK05014 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>TIGR03835 termin_org_DnaJ terminal organelle assembly protein TopJ Back     alignment and domain information
>PRK00294 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PRK03578 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>KOG0720|consensus Back     alignment and domain information
>PTZ00100 DnaJ chaperone protein; Provisional Back     alignment and domain information
>PRK09430 djlA Dna-J like membrane chaperone protein; Provisional Back     alignment and domain information
>KOG0722|consensus Back     alignment and domain information
>KOG0714|consensus Back     alignment and domain information
>PRK01773 hscB co-chaperone HscB; Provisional Back     alignment and domain information
>PHA02624 large T antigen; Provisional Back     alignment and domain information
>COG5407 SEC63 Preprotein translocase subunit Sec63 [Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR00714 hscB Fe-S protein assembly co-chaperone HscB Back     alignment and domain information
>KOG1150|consensus Back     alignment and domain information
>COG5269 ZUO1 Ribosome-associated chaperone zuotin [Translation, ribosomal structure and biogenesis / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1789|consensus Back     alignment and domain information
>COG2314 XynA Predicted membrane protein [Function unknown] Back     alignment and domain information
>KOG0723|consensus Back     alignment and domain information
>KOG0568|consensus Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3192|consensus Back     alignment and domain information
>COG1076 DjlA DnaJ-domain-containing proteins 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF03656 Pam16: Pam16; InterPro: IPR005341 The Pam16 protein is the fifth essential subunit of the pre-sequence translocase-associated protein import motor (PAM) [] Back     alignment and domain information
>KOG0431|consensus Back     alignment and domain information
>PF13446 RPT: A repeated domain in UCH-protein Back     alignment and domain information
>PF14687 DUF4460: Domain of unknown function (DUF4460) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query379
1xbl_A107 Nmr Structure Of The J-Domain (Residues 2-76) In Th 1e-07
1bq0_A103 J-Domain (Residues 1-77) Of The Escherichia Coli N- 2e-07
1bqz_A77 J-Domain (Residues 1-77) Of The Escherichia Coli N- 3e-07
2lo1_A71 Nmr Structure Of The Protein Bc008182, A Dnaj-Like 6e-06
2ctr_A88 Solution Structure Of J-Domain From Human Dnaj Subf 6e-05
2dn9_A79 Solution Structure Of J-Domain From The Dnaj Homolo 1e-04
2cug_A88 Solution Structure Of The J Domain Of The Pseudo Dn 2e-04
2o37_A92 J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From S 2e-04
2lgw_A99 Solution Structure Of The J Domain Of Hsj1a Length 4e-04
1hdj_A77 Human Hsp40 (Hdj-1), Nmr Length = 77 5e-04
2och_A73 J-domain Of Dnj-12 From Caenorhabditis Elegans Leng 5e-04
2dmx_A92 Solution Structure Of The J Domain Of Dnaj Homolog 6e-04
1wjz_A94 Soluiotn Structure Of J-Domain Of Mouse Dnaj Like P 6e-04
>pdb|1XBL|A Chain A, Nmr Structure Of The J-Domain (Residues 2-76) In The Escherichia Coli N-Terminal Fragment (Residues 2-108) Of The Molecular Chaperone Dnaj, 20 Structures Length = 107 Back     alignment and structure 
Iteration: 1

 Score = 53.9 bits (128), Expect = 1e-07,   Method: Composition-based stats.
 Identities = 23/65 (35%), Positives = 45/65 (69%), Gaps = 3/65 (4%)
Query: 306 GEQNAFKVLGLAHTARQSEINSACRHLSVKYHPDKAKSDEEKQHNQSKFYEIQQACELLS 365
            +Q+ +++LG++ TA + EI  A + L++KYHPD+ + D+E    ++KF EI++A E+L+
Sbjct: 1   AKQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGDKEA---EAKFKEIKEAYEVLT 57
Query: 366 NKHAK 370
           +   +
Sbjct: 58  DSQKR 62
>pdb|1BQ0|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-104) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 103 Back     alignment and structure
>pdb|1BQZ|A Chain A, J-Domain (Residues 1-77) Of The Escherichia Coli N-Terminal Fragment (Residues 1-78) Of The Molecular Chaperone Dnaj, Nmr, 20 Structures Length = 77 Back     alignment and structure
>pdb|2LO1|A Chain A, Nmr Structure Of The Protein Bc008182, A Dnaj-Like Domain From Homo Sapiens Length = 71 Back     alignment and structure
>pdb|2CTR|A Chain A, Solution Structure Of J-Domain From Human Dnaj Subfamily B Menber 9 Length = 88 Back     alignment and structure
>pdb|2DN9|A Chain A, Solution Structure Of J-Domain From The Dnaj Homolog, Human Tid1 Protein Length = 79 Back     alignment and structure
>pdb|2CUG|A Chain A, Solution Structure Of The J Domain Of The Pseudo Dnaj Protein, Mouse Hypothetical Mkiaa0962 Length = 88 Back     alignment and structure
>pdb|2O37|A Chain A, J-Domain Of Sis1 Protein, Hsp40 Co-Chaperone From Saccharomyces Cerevisiae Length = 92 Back     alignment and structure
>pdb|2LGW|A Chain A, Solution Structure Of The J Domain Of Hsj1a Length = 99 Back     alignment and structure
>pdb|1HDJ|A Chain A, Human Hsp40 (Hdj-1), Nmr Length = 77 Back     alignment and structure
>pdb|2OCH|A Chain A, J-domain Of Dnj-12 From Caenorhabditis Elegans Length = 73 Back     alignment and structure
>pdb|2DMX|A Chain A, Solution Structure Of The J Domain Of Dnaj Homolog Subfamily B Member 8 Length = 92 Back     alignment and structure
>pdb|1WJZ|A Chain A, Soluiotn Structure Of J-Domain Of Mouse Dnaj Like Protein Length = 94 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query379
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 6e-12
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 1e-11
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 3e-11
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 5e-11
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 6e-11
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 7e-11
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 8e-11
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 9e-11
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 9e-11
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 2e-10
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 2e-10
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 3e-10
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 3e-10
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 4e-10
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 4e-10
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 4e-10
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 5e-10
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 7e-10
3apq_A 210 DNAJ homolog subfamily C member 10; thioredoxin fo 1e-09
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 1e-09
3lz8_A 329 Putative chaperone DNAJ; structure genomics, struc 3e-09
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 1e-08
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 3e-08
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 5e-08
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 6e-07
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 9e-07
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 4e-06
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 4e-06
2guz_A71 Mitochondrial import inner membrane translocase su 6e-06
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 1e-05
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 7e-05
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Length = 92 Back     alignment and structure
 Score = 60.4 bits (147), Expect = 6e-12
 Identities = 23/66 (34%), Positives = 37/66 (56%), Gaps = 7/66 (10%)

Query: 311 FKVLGLAHTARQSEINSACRHLSVKYHPDKAKSDEEKQHNQSKFYEIQQACELLSNKHAK 370
           + +LG++ +A + E+    R  ++KYHPDK   D E      KF EI +A E+L++   K
Sbjct: 11  YDLLGVSPSANEQELKKGYRKAALKYHPDKPTGDTE------KFKEISEAFEILNDPQ-K 63

Query: 371 RRQKNQ 376
           R   +Q
Sbjct: 64  REIYDQ 69
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Length = 109 Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Length = 73 Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 78 Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Length = 155 Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Length = 94 Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Length = 88 Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 82 Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Length = 103 Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 77 Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 112 Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Length = 109 Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Length = 210 Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Length = 450 Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Length = 329 Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Length = 88 Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Length = 114 Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Length = 182 Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Length = 174 Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Length = 171 Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Length = 71 Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Length = 79 Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Length = 92 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query379
1wjz_A94 1700030A21RIK protein; J-domain, DNAJ like protein 99.78
2ej7_A82 HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, nati 99.77
2ctp_A78 DNAJ homolog subfamily B member 12; J-domain, chap 99.77
2dn9_A79 DNAJ homolog subfamily A member 3; J-domain, TID1, 99.77
1hdj_A77 Human HSP40, HDJ-1; molecular chaperone; NMR {Homo 99.77
2yua_A99 Williams-beuren syndrome chromosome region 18 prot 99.76
2ctr_A88 DNAJ homolog subfamily B member 9; J-domain, chape 99.76
2cug_A88 Mkiaa0962 protein; DNAJ-like domain, structural ge 99.75
2ctq_A112 DNAJ homolog subfamily C member 12; J-domain, chap 99.75
2qsa_A109 DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, s 99.74
2och_A73 Hypothetical protein DNJ-12; HSP40, J-domain, chap 99.74
2dmx_A92 DNAJ homolog subfamily B member 8; DNAJ J domain, 99.74
2ctw_A109 DNAJ homolog subfamily C member 5; J-domain, chape 99.74
2lgw_A99 DNAJ homolog subfamily B member 2; J domain, HSJ1A 99.73
2o37_A92 Protein SIS1; HSP40, J-domain, cochaperone, APC900 99.72
2l6l_A155 DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, 99.72
1bq0_A103 DNAJ, HSP40; chaperone, heat shock, protein foldin 99.72
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 99.69
3apq_A 210 DNAJ homolog subfamily C member 10; thioredoxin fo 99.66
3hho_A174 CO-chaperone protein HSCB homolog; structural geno 99.65
1iur_A88 KIAA0730 protein; DNAJ like domain, riken structur 99.65
1fpo_A171 HSC20, chaperone protein HSCB; molecular chaperone 99.64
2qwo_B92 Putative tyrosine-protein phosphatase auxilin; cha 99.63
3bvo_A207 CO-chaperone protein HSCB, mitochondrial precurso; 99.63
1faf_A79 Large T antigen; J domain, HPD motif, anti-paralle 99.62
1n4c_A182 Auxilin; four helix bundle, protein binding; NMR { 99.61
3lz8_A 329 Putative chaperone DNAJ; structure genomics, struc 99.6
1gh6_A114 Large T antigen; tumor suppressor, oncoprotein, an 99.59
3ag7_A106 Putative uncharacterized protein F9E10.5; J-domain 99.59
2pf4_E174 Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, 99.58
2guz_A71 Mitochondrial import inner membrane translocase su 99.57
3uo3_A181 J-type CO-chaperone JAC1, mitochondrial; structura 99.5
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 99.4
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 99.11
2guz_B65 Mitochondrial import inner membrane translocase su 98.98
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 80.45
>1wjz_A 1700030A21RIK protein; J-domain, DNAJ like protein, structural genomics, riken structural genomics/proteomics initiative, RSGI, chaperone; NMR {Mus musculus} SCOP: a.2.3.1 Back     alignment and structure
Probab=99.78  E-value=2.4e-19  Score=145.31  Aligned_cols=75  Identities=29%  Similarity=0.458  Sum_probs=68.2

Q ss_pred             CCCccchhhhcccCCCCCHHHHHHHHHHHHHHhCCCCCC---ChhHhHHHHHHHHHHHHHHHHcCChhHHHHHhhhcc
Q psy8728         304 PFGEQNAFKVLGLAHTARQSEINSACRHLSVKYHPDKAK---SDEEKQHNQSKFYEIQQACELLSNKHAKRRQKNQRS  378 (379)
Q Consensus       304 ~~~~~d~Y~vLGv~~~as~~eIkkaYRkla~~~HPDk~~---~~~~~~~a~e~f~~I~eAYevLsdp~kR~~yd~~~~  378 (379)
                      .....|+|+||||+++++.+|||++||++++++|||+++   +++.++.++++|++|++||++|+||.+|+.||..+.
T Consensus        12 ~~~~~~~y~iLgv~~~as~~eIk~aYr~l~~~~HPDk~~~~~~~~~~~~~~~~f~~i~~Ay~~L~d~~~R~~YD~~l~   89 (94)
T 1wjz_A           12 QTLKKDWYSILGADPSANMSDLKQKYQKLILLYHPDKQSADVPAGTMEECMQKFIEIDQAWKILGNEETKKKYDLQRS   89 (94)
T ss_dssp             SSSCSCHHHHTTCCTTCCHHHHHHHHHHTTSSSCSTTCCTTCCHHHHHHHHHHHHHHHHHHHHHSSSSHHHHHHHHSC
T ss_pred             cCCCCChHHHcCCCCCCCHHHHHHHHHHHHHHHCcCCCCCCCChhhhHHHHHHHHHHHHHHHHHCCHHHHHHHHHHcc
Confidence            356789999999999999999999999999999999976   345678899999999999999999999999998653
>2ej7_A HCG3 gene; HCG3 protein, DNAJ domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ctp_A DNAJ homolog subfamily B member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dn9_A DNAJ homolog subfamily A member 3; J-domain, TID1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1hdj_A Human HSP40, HDJ-1; molecular chaperone; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>2yua_A Williams-beuren syndrome chromosome region 18 protein; J domain, all helix protein, chaperone, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctr_A DNAJ homolog subfamily B member 9; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cug_A Mkiaa0962 protein; DNAJ-like domain, structural genomics, molecular chaperone, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ctq_A DNAJ homolog subfamily C member 12; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2qsa_A DNAJ homolog DNJ-2; J-domain, HSP40, APC90001.8, structural genomics, PSI-2, Pro structure initiative; 1.68A {Caenorhabditis elegans} Back     alignment and structure
>2och_A Hypothetical protein DNJ-12; HSP40, J-domain, chaperone, APC90013.2, structural genomics, protein structure initiative; 1.86A {Caenorhabditis elegans} PDB: 2lo1_A Back     alignment and structure
>2dmx_A DNAJ homolog subfamily B member 8; DNAJ J domain, helix-turn-helix motif, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ctw_A DNAJ homolog subfamily C member 5; J-domain, chaperone, helix-turn-helix, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2lgw_A DNAJ homolog subfamily B member 2; J domain, HSJ1A, CO-chaperon, chaperone; NMR {Homo sapiens} Back     alignment and structure
>2o37_A Protein SIS1; HSP40, J-domain, cochaperone, APC90055.5, structural genomics, PSI-2, protein structure initiative; 1.25A {Saccharomyces cerevisiae} Back     alignment and structure
>2l6l_A DNAJ homolog subfamily C member 24; DPH4, Zn-CSL, J-domain, chaperone; NMR {Homo sapiens} Back     alignment and structure
>1bq0_A DNAJ, HSP40; chaperone, heat shock, protein folding, DNAK; NMR {Escherichia coli} SCOP: a.2.3.1 PDB: 1xbl_A 1bqz_A Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Back     alignment and structure
>1iur_A KIAA0730 protein; DNAJ like domain, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function; NMR {Homo sapiens} SCOP: a.2.3.1 Back     alignment and structure
>1fpo_A HSC20, chaperone protein HSCB; molecular chaperone; 1.80A {Escherichia coli} SCOP: a.2.3.1 a.23.1.1 Back     alignment and structure
>2qwo_B Putative tyrosine-protein phosphatase auxilin; chaperone-cochaperone complex, ATP-binding, nucleotide-bindi nucleus, phosphorylation, stress response; HET: ADP; 1.70A {Bos taurus} PDB: 2qwp_B* 2qwq_B* 2qwr_B* 2qwn_B* 1nz6_A Back     alignment and structure
>3bvo_A CO-chaperone protein HSCB, mitochondrial precurso; structural genomics medical relev protein structure initiative, PSI-2; 3.00A {Homo sapiens} Back     alignment and structure
>1faf_A Large T antigen; J domain, HPD motif, anti-parallel hairpin of helices, viral protein; NMR {Murine polyomavirus} SCOP: a.2.3.1 Back     alignment and structure
>1n4c_A Auxilin; four helix bundle, protein binding; NMR {Bos taurus} SCOP: a.2.3.1 PDB: 1xi5_J Back     alignment and structure
>3lz8_A Putative chaperone DNAJ; structure genomics, structural genomics, PSI-2, protein STRU initiative; 2.90A {Klebsiella pneumoniae subsp} PDB: 2kqx_A Back     alignment and structure
>1gh6_A Large T antigen; tumor suppressor, oncoprotein, antitumor protein; 3.20A {Simian virus 40} SCOP: a.2.3.1 Back     alignment and structure
>3ag7_A Putative uncharacterized protein F9E10.5; J-domain, AN auxilin-like J-domain containing protein, JAC1, chloroplast accumulation response; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>2pf4_E Small T antigen; PP2A, SV40, DNAJ, aalpha subunit, hydrolase regulat protein complex; 3.10A {Simian virus 40} PDB: 2pkg_C Back     alignment and structure
>2guz_A Mitochondrial import inner membrane translocase subunit TIM14; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3uo3_A J-type CO-chaperone JAC1, mitochondrial; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, J-protein; 1.85A {Saccharomyces cerevisiae} PDB: 3uo2_A Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2guz_B Mitochondrial import inner membrane translocase subunit TIM16; DNAJ-fold, chaperone, protein transport; HET: FLC; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 379
d1nz6a_98 a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [T 8e-10
d1wjza_94 a.2.3.1 (A:) CSL-type zinc finger-containing prote 3e-08
d1fpoa176 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) doma 1e-07
d1iura_88 a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human 3e-06
d1xbla_75 a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain 4e-06
d1fafa_79 a.2.3.1 (A:) Large T antigen, the N-terminal J dom 4e-06
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Length = 98 Back     information, alignment and structure

class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: Auxilin J-domain
species: Cow (Bos taurus) [TaxId: 9913]

 Score = 53.4 bits (128), Expect = 8e-10
 Identities = 15/66 (22%), Positives = 27/66 (40%)

Query: 307 EQNAFKVLGLAHTARQSEINSACRHLSVKYHPDKAKSDEEKQHNQSKFYEIQQACELLSN 366
            +  +K +G+A      ++    R   +  HPDKA     +Q+ +  F E+  A     N
Sbjct: 32  GETKWKPVGMADLVTPEQVKKVYRKAVLVVHPDKATGQPYEQYAKMIFMELNDAWSEFEN 91

Query: 367 KHAKRR 372
           +  K  
Sbjct: 92  QGQKPL 97
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 76 Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Length = 75 Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Length = 79 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query379
d1xbla_75 DnaJ chaperone, N-terminal (J) domain {Escherichia 99.82
d1wjza_94 CSL-type zinc finger-containing protein 3 (J-domai 99.8
d1hdja_77 HSP40 {Human (Homo sapiens) [TaxId: 9606]} 99.77
d1gh6a_114 Large T antigen, the N-terminal J domain {Simian v 99.7
d1fpoa176 HSC20 (HSCB), N-terminal (J) domain {Escherichia c 99.7
d1fafa_79 Large T antigen, the N-terminal J domain {Murine p 99.66
d1nz6a_98 Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} 99.61
d1iura_88 Hypothetical protein KIAA0730 {Human (Homo sapiens 99.58
>d1xbla_ a.2.3.1 (A:) DnaJ chaperone, N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: All alpha proteins
fold: Long alpha-hairpin
superfamily: Chaperone J-domain
family: Chaperone J-domain
domain: DnaJ chaperone, N-terminal (J) domain
species: Escherichia coli [TaxId: 562]

Probab=99.82  E-value=1.1e-20  Score=146.15  Aligned_cols=67  Identities=33%  Similarity=0.652  Sum_probs=62.6

Q ss_pred             ccchhhhcccCCCCCHHHHHHHHHHHHHHhCCCCCCChhHhHHHHHHHHHHHHHHHHcCChhHHHHHhhh
Q psy8728         307 EQNAFKVLGLAHTARQSEINSACRHLSVKYHPDKAKSDEEKQHNQSKFYEIQQACELLSNKHAKRRQKNQ  376 (379)
Q Consensus       307 ~~d~Y~vLGv~~~as~~eIkkaYRkla~~~HPDk~~~~~~~~~a~e~f~~I~eAYevLsdp~kR~~yd~~  376 (379)
                      .+|+|+||||+++||.+|||+|||++++++|||+++++   +.++++|++|++||++|+||.+|+.||+.
T Consensus         2 k~dyY~vLgv~~~As~~eIk~aYr~l~~~~HPDk~~~~---~~~~~~f~~i~~Ay~vL~d~~~R~~YD~~   68 (75)
T d1xbla_           2 KQDYYEILGVSKTAEEREIRKAYKRLAMKYHPDRNQGD---KEAEAKFKEIKEAYEVLTDSQKRAAYDQY   68 (75)
T ss_dssp             CCCTTTTTCCSSSCCHHHHHHHHHHHHHHTCCTTCTTT---CHHHHHHHHHHHHHHHTTSSHHHHHHHHH
T ss_pred             CCCHHHHcCCCCCcCHHHHHHHHHHHHhhhhhhccCCC---hHHHHHHHHHHHHHHhcCCHHHHHHHHHh
Confidence            47999999999999999999999999999999998865   36788999999999999999999999974
>d1wjza_ a.2.3.1 (A:) CSL-type zinc finger-containing protein 3 (J-domain protein DjC7, 1700030a21RIK) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hdja_ a.2.3.1 (A:) HSP40 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gh6a_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Simian virus 40, Sv40 [TaxId: 10633]} Back     information, alignment and structure
>d1fpoa1 a.2.3.1 (A:1-76) HSC20 (HSCB), N-terminal (J) domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fafa_ a.2.3.1 (A:) Large T antigen, the N-terminal J domain {Murine polyomavirus [TaxId: 10634]} Back     information, alignment and structure
>d1nz6a_ a.2.3.1 (A:) Auxilin J-domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1iura_ a.2.3.1 (A:) Hypothetical protein KIAA0730 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure