Psyllid ID: psy8733


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-
MSSNFLSRKFDVSKLIAESTQFHSLYLGNIIRNTYLDSRIHTTAMSSAAHPVINFGAGPAKLPREVLEEVKETLLDYESTGISVMEMSHRSADYTKINNDTQAALRELLNVPNNYKILFLQGGGTGMFAAVAMNLISSSMNVPNNYKILFLQGGGTGMFAAVAMNLIGRTGKADYVVTGSWSKKAAAEAEKYGKVNLVIPKVSKYVSIPDQSTWNRDPEASYLYYCDNETVDGSWSKKAAAEAEKYGKVNLVIPKVSKYVSIPDQSTWNRDPEASYLYYCDNETVDGVEFNYIPDSQGIPLVSDMSSNFLSRKFDVSKFGVIIAGAQKNIGPAGITVVIVREDLLEYALPITPTVFHFKINADNNSVYNTPPTFVVHVIQRVFAWIKRQGGLAKMEQNSLQKSVLLYQEIDNSDKFYECPVQAGCRSRMNVTDIFFTFSHVQTGSAFFFGVIIAGAQKNIGPAGITVVIVREDLLEYALPITPTVFHFKINADNNSVYNTPPTFVVHVIQRVFAWIKRQGGLAKMEQNSLQKSVLLYQEIDNSDKFYECPVQAGFPLDELFLKEAKAHNMIQLKGHRLVGGIRASIYNAITVDEAVILVKFMKEFRHKHSRLSAQSQIYLS
cccccccccccccHHHHccccccccccccEEccccccccccccccccccccccccccccccccHHHHHHHHHHHccccccccEEEEcccccHHHHHHHHHHHHHHHHHHcccccHHHHHHccccccHHHHHHHHHHccccccccccEEEEEccccHHHHHHHHHHHHcccccccccccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccEEEEccccccccccccccccccccccEEEEcccccccEEEEccccccccccEEEEcccccccccccccccEEEEccccccccccccEEEEEccccccccccccccccccHHHccccccccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccHHHHHHHHHHcccccccccEEEEEEccHHcccccccccEEcccccccccccccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHccccccccccccccHHHHccccccHHHHHHHHHHHHHHHHHccccccccccccc
ccccHHHccccEEEEEEEcccHcHHHHHHHHHHcEEccccccccccccccccEEcccccccccHHHHHHHHHcccccccccccHHHcccccHHHHHHHHHHHHHHHHHHcccccEEEEEEccHHHHHHHHHHHHHcHccHcccccEEEEEEccHHHHHHHHHHHHHcccccEEEEEEccHHHHHHHHHHccccEEEEEEcEEEccccccccHHccccccccEEEccccEEEccHHHHHHHHHHHHHcccEEEEEHHHccccccccccccccccEEEEEEEcEEccccEEcccccccccccEEEEcccccccccccHHHccEEEEEHHHHccccccEEEEEEHHHcccccccccHHHcHHHHHHHccccccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHccccccEEcccHHHEcccEEEEEEEEcccHHHcHHHHccEEEEEHHHHccccccEEEEEEHHHcccccccccHHHcHHHHHHHccccccccHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHccccccEccccccHHHHHHHHHHHHHccEEccEcccccccEEEEccccccHHHHHHHHHHHHHHHHHHccEccccEEEEc
mssnflsrkfdVSKLIAESTQFHSLYLGNIIrntyldsrihttamssaahpvinfgagpaklpREVLEEVKETLLDYESTGISVMEMshrsadytkINNDTQAALRELLNVPNNYKILFLQGGGTGMFAAVAMNLISssmnvpnnyKILFLQGGGTGMFAAVAMNLIGRTGKADYVVTGSWSKKAAAEAEKYGkvnlvipkvskyvsipdqstwnrdpeasylyycdnetvdgswsKKAAAEAEKYGkvnlvipkvskyvsipdqstwnrdpeasylyycdnetvdgvefnyipdsqgiplvsdmssnflsrkfdvskfGVIIAGaqknigpagITVVIVREDLleyalpitptvfhfkinadnnsvyntpptFVVHVIQRVFAWIKRQGGLAKMEQNSLQKSVLLYQEIdnsdkfyecpvqagcrsrmnvTDIFFTFshvqtgsaFFFGVIIAGaqknigpagITVVIVREDLleyalpitptvfhfkinadnnsvyntpptFVVHVIQRVFAWIKRQGGLAKMEQNSLQKSVLLYQEidnsdkfyecpvqagfpldeLFLKEAKAHNMIQLKGHRLVGGIRASIYNAITVDEAVILVKFMKEFRhkhsrlsaqSQIYLS
MSSNFLSRKFDVSKLIAESTQFHSLYLGNIIRNTYLDSRIHTTAMSSAAHPVINFGAGPAKLPREVLEEVKETLLDYESTGISVMEMSHRSADYTKINNDTQAALRELLNVPNNYKILFLQGGGTGMFAAVAMNLISSSMNVPNNYKILFLQGGGTGMFAAVAMNLIGRTGKADYVVTGSWSKKAAAEAekygkvnlvipkvskyvsipdqstwnrdpeaSYLYYCDNETVDGSWSKKAAAEAEKygkvnlvipkvskyvsipdqstwnrdpEASYLYYCDNETVDGVEFNYIPDSQGIPLVSDMSSNFLSRKFDVSKFGVIIagaqknigpagITVVIVREDLLEYALPITPTVFHFKINADNNSVYNTPPTFVVHVIQRVFAWIKRQGGLAKMEQNSLQKSVLLYQEIDNSDKFYECPVQAGCRSRMNVTDIFFTFSHVQTGSAFFFGVIIAGAQKNIGPAGITVVIVREDLLEYALPITPTVFHFKINADNNSVYNTPPTFVVHVIQRVFAWIKRQGGLAKMEQNSLQKSVLLYQEIDNSDKFYECPVQAGFPLDELFLKEAKAHNMIQLKGHRLVGGIRASIYNAITVDEAVILVKFMKEFrhkhsrlsaqsqiyls
MSSNFLSRKFDVSKLIAESTQFHSLYLGNIIRNTYLDSRIHTTAMSSAAHPVINFGAGPAKLPREVLEEVKETLLDYESTGISVMEMSHRSADYTKINNDTQAALRELLNVPNNYKILFLQGGGTGMFAAVAMNLISSSMNVPNNYKILFLQGGGTGMFAAVAMNLIGRTGKADYVVTGSWSkkaaaeaekYGKVNLVIPKVSKYVSIPDQSTWNRDPEASYLYYCDNETVDGSWSkkaaaeaekYGKVNLVIPKVSKYVSIPDQSTWNRDPEASYLYYCDNETVDGVEFNYIPDSQGIPLVSDMSSNFLSRKFDVSKFGVIIAGAQKNIGPAGITVVIVREDLLEYALPITPTVFHFKINADNNSVYNTPPTFVVHVIQRVFAWIKRQGGLAKMEQNSLQKSVLLYQEIDNSDKFYECPVQAGCRSRMNVTDIFFTFSHVQTGSAFFFGVIIAGAQKNIGPAGITVVIVREDLLEYALPITPTVFHFKINADNNSVYNTPPTFVVHVIQRVFAWIKRQGGLAKMEQNSLQKSVLLYQEIDNSDKFYECPVQAGFPLDELFLKEAKAHNMIQLKGHRLVGGIRASIYNAITVDEAVILVKFMKEFRHKHSRLSAQSQIYLS
*********FDVSKLIAESTQFHSLYLGNIIRNTYLDSRIHTTAMSSAAHPVINFGAGPAKLPREVLEEVKETLLDYESTGISVMEM***SADYTKINNDTQAALRELLNVPNNYKILFLQGGGTGMFAAVAMNLISSSMNVPNNYKILFLQGGGTGMFAAVAMNLIGRTGKADYVVTGSWSKKAAAEAEKYGKVNLVIPKVSKYVSIPDQSTWNRDPEASYLYYCDNETVDGSWSKKAAAEAEKYGKVNLVIPKVSKYVSIPDQSTWNRDPEASYLYYCDNETVDGVEFNYIPDSQGIPLVSDMSSNFLSRKFDVSKFGVIIAGAQKNIGPAGITVVIVREDLLEYALPITPTVFHFKINADNNSVYNTPPTFVVHVIQRVFAWIKRQGGLAKMEQNSLQKSVLLYQEIDNSDKFYECPVQAGCRSRMNVTDIFFTFSHVQTGSAFFFGVIIAGAQKNIGPAGITVVIVREDLLEYALPITPTVFHFKINADNNSVYNTPPTFVVHVIQRVFAWIKRQGGLAKMEQNSLQKSVLLYQEIDNSDKFYECPVQAGFPLDELFLKEAKAHNMIQLKGHRLVGGIRASIYNAITVDEAVILVKFMKEFR***************
***********************SLYLGNIIRNTYLD**************VINFGAGPAKLPREVLEEVKETLLDYESTGISVMEMSHRSADYTKINNDTQAALRELLNVPNNYKILFLQGGGTGMFAAVAMNLISSSMNVPNNYKILFLQGGGTGMFAAVAMNLIGRTGKADYVVTGSWSKKAAAEAEKYGKVNLVIPKVSKYVSIPDQSTWNRDPEASYLYYCDNETVDGSWSKKAAAEAEKYGKVNLVIPKVSKYVSIPDQSTWNRDPEASYLYYCDNETVDGVEFNYIPDSQGIPLVSDMSSNFLSRKFDVSKFGVIIAGAQKNIGPAGITVVIVREDLLEYALPITPTVFHFKINADNNSVYNTPPTFVVHVIQRVFAWIKRQGGLAKMEQNSLQKSVLLYQEIDNSDKFYECPVQAGCRSRMNVTDIFFTFSHVQTGSAFFFGVIIAGAQKNIGPAGITVVIVREDLLEYALPITPTVFHFKINADNNSVYNTPPTFVVHVIQRVFAWIKRQGGLAKMEQNSLQKSVLLYQEIDNSDKFYECPVQAGFPLDELFLKEAKAHNMIQLKGHRLVGGIRASIYNAITVDEAVILVKFMKEFRHKHSRLS*****Y**
MSSNFLSRKFDVSKLIAESTQFHSLYLGNIIRNTYLDSRIHTTAMSSAAHPVINFGAGPAKLPREVLEEVKETLLDYESTGISVMEMSHRSADYTKINNDTQAALRELLNVPNNYKILFLQGGGTGMFAAVAMNLISSSMNVPNNYKILFLQGGGTGMFAAVAMNLIGRTGKADYVVTGSWSKKAAAEAEKYGKVNLVIPKVSKYVSIPDQSTWNRDPEASYLYYCDNETVDGSWSKKAAAEAEKYGKVNLVIPKVSKYVSIPDQSTWNRDPEASYLYYCDNETVDGVEFNYIPDSQGIPLVSDMSSNFLSRKFDVSKFGVIIAGAQKNIGPAGITVVIVREDLLEYALPITPTVFHFKINADNNSVYNTPPTFVVHVIQRVFAWIKRQGGLAKMEQNSLQKSVLLYQEIDNSDKFYECPVQAGCRSRMNVTDIFFTFSHVQTGSAFFFGVIIAGAQKNIGPAGITVVIVREDLLEYALPITPTVFHFKINADNNSVYNTPPTFVVHVIQRVFAWIKRQGGLAKMEQNSLQKSVLLYQEIDNSDKFYECPVQAGFPLDELFLKEAKAHNMIQLKGHRLVGGIRASIYNAITVDEAVILVKFMKEFRHKHSRLSAQSQIYLS
***NFLSRKFDVSKLIAESTQFHSLYLGNIIRNTYLDSR**********HPVINFGAGPAKLPREVLEEVKETLLDYESTGISVMEMSHRSADYTKINNDTQAALRELLNVPNNYKILFLQGGGTGMFAAVAMNLISSSMNVPNNYKILFLQGGGTGMFAAVAMNLIGRTGKADYVVTGSWSKKAAAEAEKYGKVNLVIPKVSKYVSIPDQSTWNRDPEASYLYYCDNETVDGSWSKKAAAEAEKYGKVNLVIPKVSKYVSIPDQSTWNRDPEASYLYYCDNETVDGVEFNYIPDSQGIPLVSDMSSNFLSRKFDVSKFGVIIAGAQKNIGPAGITVVIVREDLLEYALPITPTVFHFKINADNNSVYNTPPTFVVHVIQRVFAWIKRQGGLAKMEQNSLQKSVLLYQEIDNSDKFYECPVQAGCRSRMNVTDIFFTFSHVQTGSAFFFGVIIAGAQKNIGPAGITVVIVREDLLEYALPITPTVFHFKINADNNSVYNTPPTFVVHVIQRVFAWIKRQGGLAKMEQNSLQKSVLLYQEIDNSDKFYECPVQAGFPLDELFLKEAKAHNMIQLKGHRLVGGIRASIYNAITVDEAVILVKFMKEFRHKHSRLSAQSQIYL*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSNFLSRKFDVSKLIAESTQFHSLYLGNIIRNTYLDSRIHTTAMSSAAHPVINFGAGPAKLPREVLEEVKETLLDYESTGISVMEMSHRSADYTKINNDTQAALRELLNVPNNYKILFLQGGGTGMFAAVAMNLISSSMNVPNNYKILFLQGGGTGMFAAVAMNLIGRTGKADYVVTGSWSKKAAAEAEKYGKVNLVIPKVSKYVSIPDQSTWNRDPEASYLYYCDNETVDGSWSKKAAAEAEKYGKVNLVIPKVSKYVSIPDQSTWNRDPEASYLYYCDNETVDGVEFNYIPDSQGIPLVSDMSSNFLSRKFDVSKFGVIIAGAQKNIGPAGITVVIVREDLLEYALPITPTVFHFKINADNNSVYNTPPTFVVHVIQRVFAWIKRQGGLAKMEQNSLQKSVLLYQEIDNSDKFYECPVQAGCRSRMNVTDIFFTFSHVQTGSAFFFGVIIAGAQKNIGPAGITVVIVREDLLEYALPITPTVFHFKINADNNSVYNTPPTFVVHVIQRVFAWIKRQGGLAKMEQNSLQKSVLLYQEIDNSDKFYECPVQAGFPLDELFLKEAKAHNMIQLKGHRLVGGIRASIYNAITVDEAVILVKFMKEFRHKHSRLSAQSQIYLS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query621 2.2.26 [Sep-21-2011]
Q9VAN0364 Probable phosphoserine am yes N/A 0.475 0.810 0.490 6e-95
Q99K85370 Phosphoserine aminotransf yes N/A 0.484 0.813 0.468 2e-90
Q9Y617370 Phosphoserine aminotransf yes N/A 0.484 0.813 0.463 2e-90
P10658370 Phosphoserine aminotransf yes N/A 0.478 0.802 0.452 4e-87
Q820S0368 Phosphoserine aminotransf yes N/A 0.516 0.872 0.396 2e-76
C1D8N3359 Phosphoserine aminotransf yes N/A 0.473 0.818 0.406 7e-75
Q3SK88359 Phosphoserine aminotransf yes N/A 0.500 0.866 0.399 4e-72
A6V2Q8361 Phosphoserine aminotransf yes N/A 0.473 0.814 0.401 7e-72
P91856370 Probable phosphoserine am yes N/A 0.475 0.797 0.406 1e-71
Q02PX3361 Phosphoserine aminotransf yes N/A 0.470 0.808 0.401 6e-71
>sp|Q9VAN0|SERC_DROME Probable phosphoserine aminotransferase OS=Drosophila melanogaster GN=CG11899 PE=2 SV=1 Back     alignment and function desciption
 Score =  348 bits (894), Expect = 6e-95,   Method: Compositional matrix adjust.
 Identities = 187/381 (49%), Positives = 235/381 (61%), Gaps = 86/381 (22%)

Query: 52  VINFGAGPAKLPREVLEEVKETLLDYESTGISVMEMSHRSADYTKINNDTQAALRELLNV 111
           VINF AGPAKLP EVL+EV+E L++   +GISVMEMSHRS++Y KI++ T + LRELLNV
Sbjct: 2   VINFAAGPAKLPEEVLKEVQENLVNCNGSGISVMEMSHRSSNYAKIHDATISDLRELLNV 61

Query: 112 PNNYKILFLQGGGTGMFAAVAMNLISSSMNVPNNYKILFLQGGGTGMFAAVAMNLIGRTG 171
           P+                               NYKIL +QGGGTG FAAVA+NLIG+  
Sbjct: 62  PS-------------------------------NYKILLMQGGGTGQFAAVALNLIGK-- 88

Query: 172 KADYVVTGSWSKKAAAEAEKYGKVNLVIPKVSKYVSIPDQSTWNRDPEASYLYYCDNETV 231
                 TG+                                       A Y+       +
Sbjct: 89  ------TGT---------------------------------------ADYV-------I 96

Query: 232 DGSWSKKAAAEAEKYGKVNLVIPKVSKYVSIPDQSTWNRDPEASYLYYCDNETVDGVEFN 291
            GSWS KAA EA +YG VN V+PK++KY ++P Q TW  DP ASY+YYCDNETV+GVEF+
Sbjct: 97  TGSWSAKAAKEAAQYGTVNAVLPKLAKYTTVPRQETWKLDPNASYVYYCDNETVEGVEFD 156

Query: 292 YIPD-SQGIPLVSDMSSNFLSRKFDVSKFGVIIAGAQKNIGPAGITVVIVREDLLEYALP 350
           ++P+   G+PLV+DMSSNFLSR FDVSKFGVI AGAQKNIGPAG TV+IVR+DL+   L 
Sbjct: 157 FVPEVPAGVPLVADMSSNFLSRPFDVSKFGVIYAGAQKNIGPAGTTVIIVRDDLIGKHLK 216

Query: 351 ITPTVFHFKINADNNSVYNTPPTFVVHVIQRVFAWIKRQGGLAKMEQNSLQKSVLLYQEI 410
           ITP++ +F+    NNS+ NTPPTF ++V+  VF WIKR GG+A M + +  KS L+Y  I
Sbjct: 217 ITPSILNFEQMDKNNSLLNTPPTFGIYVMGLVFKWIKRNGGVAGMAKLAAAKSKLIYDTI 276

Query: 411 DNSDKFYECPVQAGCRSRMNV 431
           + S+ FY CPV    RSRMNV
Sbjct: 277 NQSNGFYYCPVDVNVRSRMNV 297




Catalyzes the reversible conversion of 3-phosphohydroxypyruvate to phosphoserine and of 3-hydroxy-2-oxo-4-phosphonooxybutanoate to phosphohydroxythreonine.
Drosophila melanogaster (taxid: 7227)
EC: 2EC: .EC: 6EC: .EC: 1EC: .EC: 5EC: 2
>sp|Q99K85|SERC_MOUSE Phosphoserine aminotransferase OS=Mus musculus GN=Psat1 PE=1 SV=1 Back     alignment and function description
>sp|Q9Y617|SERC_HUMAN Phosphoserine aminotransferase OS=Homo sapiens GN=PSAT1 PE=1 SV=2 Back     alignment and function description
>sp|P10658|SERC_RABIT Phosphoserine aminotransferase OS=Oryctolagus cuniculus GN=PSAT1 PE=2 SV=1 Back     alignment and function description
>sp|Q820S0|SERC_NITEU Phosphoserine aminotransferase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=serC PE=3 SV=1 Back     alignment and function description
>sp|C1D8N3|SERC_LARHH Phosphoserine aminotransferase OS=Laribacter hongkongensis (strain HLHK9) GN=serC PE=3 SV=1 Back     alignment and function description
>sp|Q3SK88|SERC_THIDA Phosphoserine aminotransferase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=serC PE=3 SV=1 Back     alignment and function description
>sp|A6V2Q8|SERC_PSEA7 Phosphoserine aminotransferase OS=Pseudomonas aeruginosa (strain PA7) GN=serC PE=3 SV=1 Back     alignment and function description
>sp|P91856|SERC_CAEEL Probable phosphoserine aminotransferase OS=Caenorhabditis elegans GN=F26H9.5 PE=3 SV=1 Back     alignment and function description
>sp|Q02PX3|SERC_PSEAB Phosphoserine aminotransferase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=serC PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query621
170043457362 phosphoserine aminotransferase [Culex qu 0.475 0.814 0.507 1e-101
91077286368 PREDICTED: similar to phosphoserine amin 0.481 0.812 0.493 5e-99
427779351409 Putative phosphoserine aminotransferase 0.542 0.823 0.488 1e-98
158293896364 AGAP004598-PA [Anopheles gambiae str. PE 0.475 0.810 0.486 5e-97
289739613364 phosphoserine aminotransferase [Glossina 0.475 0.810 0.503 3e-96
332373556368 unknown [Dendroctonus ponderosae] 0.481 0.812 0.484 8e-96
194744461364 GF16606 [Drosophila ananassae] gi|190627 0.475 0.810 0.501 1e-94
94468534362 phosphoserine aminotransferase [Aedes ae 0.475 0.814 0.505 2e-93
195449525364 GK22671 [Drosophila willistoni] gi|19416 0.475 0.810 0.485 3e-93
21356589364 CG11899 [Drosophila melanogaster] gi|195 0.475 0.810 0.490 4e-93
>gi|170043457|ref|XP_001849403.1| phosphoserine aminotransferase [Culex quinquefasciatus] gi|167866799|gb|EDS30182.1| phosphoserine aminotransferase [Culex quinquefasciatus] Back     alignment and taxonomy information
 Score =  375 bits (963), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 193/380 (50%), Positives = 236/380 (62%), Gaps = 85/380 (22%)

Query: 52  VINFGAGPAKLPREVLEEVKETLLDYESTGISVMEMSHRSADYTKINNDTQAALRELLNV 111
           VINFGAGPAKLPREVL EV++ L++Y S+G+SVMEMSHR A Y K++N+T    RELL V
Sbjct: 2   VINFGAGPAKLPREVLLEVQKELVEYGSSGMSVMEMSHRGATYVKLHNETIELARELLKV 61

Query: 112 PNNYKILFLQGGGTGMFAAVAMNLISSSMNVPNNYKILFLQGGGTGMFAAVAMNLIGRTG 171
           P+N                               YK+L +QGGGTG+FAAVAMNLIGRTG
Sbjct: 62  PDN-------------------------------YKVLLMQGGGTGLFAAVAMNLIGRTG 90

Query: 172 KADYVVTGSWSKKAAAEAEKYGKVNLVIPKVSKYVSIPDQSTWNRDPEASYLYYCDNETV 231
            AD                                               YL       V
Sbjct: 91  SAD-----------------------------------------------YL-------V 96

Query: 232 DGSWSKKAAAEAEKYGKVNLVIPKVSKYVSIPDQSTWNRDPEASYLYYCDNETVDGVEFN 291
            GSWS KAA EA KYGKVN V+PK +K   +PD  TW  DP ASYLYYCDNET++GVEF+
Sbjct: 97  TGSWSSKAAKEAAKYGKVNQVVPKAAKCTCVPDPKTWKLDPNASYLYYCDNETIEGVEFD 156

Query: 292 YIPDSQGIPLVSDMSSNFLSRKFDVSKFGVIIAGAQKNIGPAGITVVIVREDLLEYALPI 351
           ++P++ G+PLV DMSSN +SR  D+ KFGVI A AQKNIGP+GIT+VIVREDL+ + +PI
Sbjct: 157 FVPETNGVPLVVDMSSNMMSRPVDIKKFGVIFACAQKNIGPSGITLVIVREDLIGHQMPI 216

Query: 352 TPTVFHFKINADNNSVYNTPPTFVVHVIQRVFAWIKRQGGLAKMEQNSLQKSVLLYQEID 411
           TPT+  F I A +NS+ NTPPT +++++ RVFAWIKRQGGL K+ Q SL KS L+Y  I 
Sbjct: 217 TPTILDFSIVAKDNSINNTPPTLIIYIMGRVFAWIKRQGGLDKLYQASLTKSALIYDVIA 276

Query: 412 NSDKFYECPVQAGCRSRMNV 431
            S  FY CPV++  RSRMNV
Sbjct: 277 ASKDFYYCPVESKVRSRMNV 296




Source: Culex quinquefasciatus

Species: Culex quinquefasciatus

Genus: Culex

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|91077286|ref|XP_974471.1| PREDICTED: similar to phosphoserine aminotransferase [Tribolium castaneum] gi|270001676|gb|EEZ98123.1| hypothetical protein TcasGA2_TC000542 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|427779351|gb|JAA55127.1| Putative phosphoserine aminotransferase [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|158293896|ref|XP_557484.2| AGAP004598-PA [Anopheles gambiae str. PEST] gi|157016523|gb|EAL40174.2| AGAP004598-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|289739613|gb|ADD18554.1| phosphoserine aminotransferase [Glossina morsitans morsitans] Back     alignment and taxonomy information
>gi|332373556|gb|AEE61919.1| unknown [Dendroctonus ponderosae] Back     alignment and taxonomy information
>gi|194744461|ref|XP_001954712.1| GF16606 [Drosophila ananassae] gi|190627749|gb|EDV43273.1| GF16606 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|94468534|gb|ABF18116.1| phosphoserine aminotransferase [Aedes aegypti] Back     alignment and taxonomy information
>gi|195449525|ref|XP_002072110.1| GK22671 [Drosophila willistoni] gi|194168195|gb|EDW83096.1| GK22671 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|21356589|ref|NP_652046.1| CG11899 [Drosophila melanogaster] gi|195574691|ref|XP_002105318.1| GD21426 [Drosophila simulans] gi|8928355|sp|Q9VAN0.1|SERC_DROME RecName: Full=Probable phosphoserine aminotransferase; Short=PSAT; AltName: Full=Phosphohydroxythreonine aminotransferase gi|7301762|gb|AAF56874.1| CG11899 [Drosophila melanogaster] gi|21428990|gb|AAM50214.1| GM02605p [Drosophila melanogaster] gi|66804081|gb|AAY56663.1| unknown [Drosophila melanogaster] gi|66804091|gb|AAY56664.1| unknown [Drosophila simulans] gi|194201245|gb|EDX14821.1| GD21426 [Drosophila simulans] gi|220942800|gb|ACL83943.1| CG11899-PA [synthetic construct] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query621
ZFIN|ZDB-GENE-030131-5723368 psat1 "phosphoserine aminotran 0.331 0.559 0.558 5.6e-105
FB|FBgn0014427364 CG11899 [Drosophila melanogast 0.323 0.552 0.579 2.4e-104
UNIPROTKB|E2RDN1411 PSAT1 "Phosphoserine aminotran 0.331 0.501 0.553 5.6e-103
UNIPROTKB|E9PSV5370 Psat1 "Protein Psat1" [Rattus 0.331 0.556 0.567 9.1e-103
UNIPROTKB|A6QR28370 PSAT1 "Phosphoserine aminotran 0.331 0.556 0.563 1.5e-102
UNIPROTKB|Q9Y617370 PSAT1 "Phosphoserine aminotran 0.331 0.556 0.553 1e-101
MGI|MGI:2183441370 Psat1 "phosphoserine aminotran 0.323 0.543 0.567 3.4e-101
UNIPROTKB|F1NTK1366 PSAT1 "Phosphoserine aminotran 0.323 0.549 0.577 1.6e-95
UNIPROTKB|J9JHU3336 PSAT1 "Phosphoserine aminotran 0.331 0.613 0.553 3.3e-93
WB|WBGene00009177370 F26H9.5 [Caenorhabditis elegan 0.323 0.543 0.480 1.2e-87
ZFIN|ZDB-GENE-030131-5723 psat1 "phosphoserine aminotransferase 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 624 (224.7 bits), Expect = 5.6e-105, Sum P(3) = 5.6e-105
 Identities = 115/206 (55%), Positives = 147/206 (71%)

Query:   226 CDNETVDGSWSXXXXXXXXXYGKVNLVIPKVSKYVSIPDQSTWNRDPEASYLYYCDNETV 285
             C +  V G+WS         YGKVN++ PK+  Y  IPD STW+ +P ASY+YYC NETV
Sbjct:    97 CADYLVTGTWSARAAKEAEKYGKVNVIHPKLDSYTKIPDSSTWSLNPSASYVYYCCNETV 156

Query:   286 DGVEFNYIPDSQGIPLVSDMSSNFLSRKFDVSKFGVIIAGAQKNIGPAGITVVIVREDLL 345
              GVEFN+IPD++G+ LVSDMSSNFLSR  DVSKFG+I AGAQKN+G AG+TVVIVREDL+
Sbjct:   157 HGVEFNFIPDTKGVILVSDMSSNFLSRPVDVSKFGLIFAGAQKNVGCAGVTVVIVREDLI 216

Query:   346 EYALPITPTVFHFKINADNNSVYNTPPTFVVHVIQRVFAWIKRQGGLAKMEQNSLQKSVL 405
               AL   P +  +++ A NNS+YNTPP F ++++  V  WI+  GG   ME+ + QKS L
Sbjct:   217 GKALKECPIILDYQVQAGNNSLYNTPPCFSIYIMGLVLEWIRNNGGADAMERLNKQKSAL 276

Query:   406 LYQEIDNSDKFYECPVQAGCRSRMNV 431
             +Y  I+ S+ FY CPV A CRSRMN+
Sbjct:   277 VYDIINRSNGFYSCPVDAACRSRMNI 302


GO:0030170 "pyridoxal phosphate binding" evidence=IEA
GO:0004648 "O-phospho-L-serine:2-oxoglutarate aminotransferase activity" evidence=IEA
GO:0008152 "metabolic process" evidence=IEA
GO:0003824 "catalytic activity" evidence=IEA
GO:0006564 "L-serine biosynthetic process" evidence=IEA
GO:0008483 "transaminase activity" evidence=IEA
GO:0016740 "transferase activity" evidence=IEA
GO:0008652 "cellular amino acid biosynthetic process" evidence=IEA
FB|FBgn0014427 CG11899 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|E2RDN1 PSAT1 "Phosphoserine aminotransferase" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E9PSV5 Psat1 "Protein Psat1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|A6QR28 PSAT1 "Phosphoserine aminotransferase" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q9Y617 PSAT1 "Phosphoserine aminotransferase" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:2183441 Psat1 "phosphoserine aminotransferase 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1NTK1 PSAT1 "Phosphoserine aminotransferase" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|J9JHU3 PSAT1 "Phosphoserine aminotransferase" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
WB|WBGene00009177 F26H9.5 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
4th Layer2.6.1.520.824
3rd Layer2.6.10.766

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query621
PRK05355360 PRK05355, PRK05355, 3-phosphoserine/phosphohydroxy 1e-156
cd00611355 cd00611, PSAT_like, Phosphoserine aminotransferase 1e-152
TIGR01364349 TIGR01364, serC_1, phosphoserine aminotransferase 1e-138
PLN02452365 PLN02452, PLN02452, phosphoserine transaminase 1e-127
COG1932365 COG1932, SerC, Phosphoserine aminotransferase [Coe 1e-113
PRK12462364 PRK12462, PRK12462, phosphoserine aminotransferase 3e-80
PRK05355360 PRK05355, PRK05355, 3-phosphoserine/phosphohydroxy 5e-77
TIGR01364349 TIGR01364, serC_1, phosphoserine aminotransferase 1e-74
cd00611355 cd00611, PSAT_like, Phosphoserine aminotransferase 4e-73
PLN02452365 PLN02452, PLN02452, phosphoserine transaminase 6e-67
COG1932365 COG1932, SerC, Phosphoserine aminotransferase [Coe 1e-56
PRK12462364 PRK12462, PRK12462, phosphoserine aminotransferase 5e-41
pfam00266370 pfam00266, Aminotran_5, Aminotransferase class-V 2e-29
pfam00266370 pfam00266, Aminotran_5, Aminotransferase class-V 1e-09
COG0075383 COG0075, COG0075, Serine-pyruvate aminotransferase 6e-08
cd01494170 cd01494, AAT_I, Aspartate aminotransferase (AAT) s 8e-06
TIGR01366361 TIGR01366, serC_3, phosphoserine aminotransferase, 2e-05
cd06451356 cd06451, AGAT_like, Alanine-glyoxylate aminotransf 3e-05
TIGR03301355 TIGR03301, PhnW-AepZ, 2-aminoethylphosphonate amin 0.001
>gnl|CDD|235428 PRK05355, PRK05355, 3-phosphoserine/phosphohydroxythreonine aminotransferase; Provisional Back     alignment and domain information
 Score =  453 bits (1168), Expect = e-156
 Identities = 166/386 (43%), Positives = 219/386 (56%), Gaps = 87/386 (22%)

Query: 52  VINFGAGPAKLPREVLEEVKETLLDYESTGISVMEMSHRSADYTKINNDTQAALRELLNV 111
           V NF AGPA LP EVLE+ ++ LLD+  +G+SVME+SHRS ++  +  + +A LREL   
Sbjct: 4   VYNFSAGPAMLPEEVLEQAQQELLDWNGSGMSVMEISHRSKEFEAVAEEAEADLREL--- 60

Query: 112 PNNYKILFLQGGGTGMFAAVAMNLISSSMNVPNNYKILFLQGGGTGMFAAVAMNLIGRTG 171
                                       +N+P+NYK+LFLQGG +  FA V MNL+G   
Sbjct: 61  ----------------------------LNIPDNYKVLFLQGGASLQFAMVPMNLLGGGK 92

Query: 172 KADYVVTGSWSKKAAAEAEKYGKVNLVIPKVSKYVSIPDQSTWNRDPEASYLYYCDNETV 231
           KADYV TGSWSKKA  EA+KYG+VN+                                  
Sbjct: 93  KADYVDTGSWSKKAIKEAKKYGEVNVA--------------------------------- 119

Query: 232 DGSWSKKAAAEAEKYGKVNLVIPKVSKYVSIPDQSTWNRDPEASYLYYCDNETVDGVEFN 291
               S +                    +  IP    W    +A+Y++Y  NET+DG EF+
Sbjct: 120 ---ASSED-----------------DGFTYIPPLDEWQLSDDAAYVHYTSNETIDGTEFH 159

Query: 292 YIPDSQGIPLVSDMSSNFLSRKFDVSKFGVIIAGAQKNIGPAGITVVIVREDLLEYALPI 351
            +PD+  +PLV+DMSS+ LSR  DVSKFG+I AGAQKNIGPAG+T+VIVREDLL  ALP 
Sbjct: 160 ELPDTGDVPLVADMSSDILSRPIDVSKFGLIYAGAQKNIGPAGLTIVIVREDLLGRALPS 219

Query: 352 TPTVFHFKINADNNSVYNTPPTFVVHVIQRVFAWIKRQGGLAKMEQNSLQKSVLLYQEID 411
            P++  +K +ADN+S+YNTPPTF +++   VF W+K QGG+A ME+ + +K+ LLY  ID
Sbjct: 220 IPSMLDYKTHADNDSMYNTPPTFAIYLAGLVFKWLKEQGGVAAMEKRNQEKAALLYDAID 279

Query: 412 NSDKFYECPVQAGCRSRMNVTDIFFT 437
           +SD FY  PV    RSRMNV   F  
Sbjct: 280 SSD-FYRNPVAPEDRSRMNVP--FTL 302


Length = 360

>gnl|CDD|99736 cd00611, PSAT_like, Phosphoserine aminotransferase (PSAT) family Back     alignment and domain information
>gnl|CDD|130431 TIGR01364, serC_1, phosphoserine aminotransferase Back     alignment and domain information
>gnl|CDD|178071 PLN02452, PLN02452, phosphoserine transaminase Back     alignment and domain information
>gnl|CDD|224843 COG1932, SerC, Phosphoserine aminotransferase [Coenzyme metabolism / Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|183540 PRK12462, PRK12462, phosphoserine aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|235428 PRK05355, PRK05355, 3-phosphoserine/phosphohydroxythreonine aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|130431 TIGR01364, serC_1, phosphoserine aminotransferase Back     alignment and domain information
>gnl|CDD|99736 cd00611, PSAT_like, Phosphoserine aminotransferase (PSAT) family Back     alignment and domain information
>gnl|CDD|178071 PLN02452, PLN02452, phosphoserine transaminase Back     alignment and domain information
>gnl|CDD|224843 COG1932, SerC, Phosphoserine aminotransferase [Coenzyme metabolism / Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|183540 PRK12462, PRK12462, phosphoserine aminotransferase; Provisional Back     alignment and domain information
>gnl|CDD|215829 pfam00266, Aminotran_5, Aminotransferase class-V Back     alignment and domain information
>gnl|CDD|215829 pfam00266, Aminotran_5, Aminotransferase class-V Back     alignment and domain information
>gnl|CDD|223153 COG0075, COG0075, Serine-pyruvate aminotransferase/archaeal aspartate aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|99742 cd01494, AAT_I, Aspartate aminotransferase (AAT) superfamily (fold type I) of pyridoxal phosphate (PLP)-dependent enzymes Back     alignment and domain information
>gnl|CDD|130433 TIGR01366, serC_3, phosphoserine aminotransferase, putative Back     alignment and domain information
>gnl|CDD|99744 cd06451, AGAT_like, Alanine-glyoxylate aminotransferase (AGAT) family Back     alignment and domain information
>gnl|CDD|213793 TIGR03301, PhnW-AepZ, 2-aminoethylphosphonate aminotransferase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 621
KOG2790|consensus370 100.0
PRK12462364 phosphoserine aminotransferase; Provisional 100.0
COG1932365 SerC Phosphoserine aminotransferase [Coenzyme meta 100.0
PLN02452365 phosphoserine transaminase 100.0
PRK05355360 3-phosphoserine/phosphohydroxythreonine aminotrans 100.0
TIGR01364349 serC_1 phosphoserine aminotransferase. This model 100.0
cd00611355 PSAT_like Phosphoserine aminotransferase (PSAT) fa 100.0
COG0075383 Serine-pyruvate aminotransferase/archaeal aspartat 100.0
TIGR01365374 serC_2 phosphoserine aminotransferase, Methanosarc 100.0
TIGR01366361 serC_3 phosphoserine aminotransferase, putative. T 100.0
PRK03080378 phosphoserine aminotransferase; Provisional 100.0
KOG2862|consensus385 100.0
COG0520405 csdA Selenocysteine lyase/Cysteine desulfurase [Po 100.0
PLN02409401 serine--glyoxylate aminotransaminase 100.0
PF00266371 Aminotran_5: Aminotransferase class-V; InterPro: I 100.0
TIGR02326363 transamin_PhnW 2-aminoethylphosphonate--pyruvate t 100.0
PRK13479368 2-aminoethylphosphonate--pyruvate transaminase; Pr 100.0
TIGR03301355 PhnW-AepZ 2-aminoethylphosphonate aminotransferase 100.0
COG1104386 NifS Cysteine sulfinate desulfinase/cysteine desul 99.98
PRK09295406 bifunctional cysteine desulfurase/selenocysteine l 99.98
PLN02855424 Bifunctional selenocysteine lyase/cysteine desulfu 99.98
PRK10874401 cysteine sulfinate desulfinase; Provisional 99.97
TIGR03392398 FeS_syn_CsdA cysteine desulfurase, catalytic subun 99.97
PLN02651364 cysteine desulfurase 99.97
PLN02724 805 Molybdenum cofactor sulfurase 99.97
cd06451356 AGAT_like Alanine-glyoxylate aminotransferase (AGA 99.96
TIGR03402379 FeS_nifS cysteine desulfurase NifS. Members of thi 99.96
TIGR01977376 am_tr_V_EF2568 cysteine desulfurase family protein 99.96
TIGR01979403 sufS cysteine desulfurases, SufS subfamily. This m 99.96
TIGR02006402 IscS cysteine desulfurase IscS. This model represe 99.95
TIGR03403382 nifS_epsilon cysteine desulfurase, NifS family, ep 99.95
TIGR01814406 kynureninase kynureninase. This model describes ky 99.95
TIGR01976397 am_tr_V_VC1184 cysteine desulfurase family protein 99.95
PRK02948381 cysteine desulfurase; Provisional 99.95
KOG1549|consensus428 99.94
cd06453373 SufS_like Cysteine desulfurase (SufS)-like. This f 99.94
PRK12462364 phosphoserine aminotransferase; Provisional 99.93
PRK14012404 cysteine desulfurase; Provisional 99.93
TIGR03235353 DNA_S_dndA cysteine desulfurase DndA. This model d 99.93
KOG2790|consensus370 99.92
COG1932365 SerC Phosphoserine aminotransferase [Coenzyme meta 99.86
PRK09331387 Sep-tRNA:Cys-tRNA synthetase; Provisional 99.85
PLN02452365 phosphoserine transaminase 99.81
PTZ00094452 serine hydroxymethyltransferase; Provisional 99.8
cd06452361 SepCysS Sep-tRNA:Cys-tRNA synthase. This family be 99.8
PRK13520371 L-tyrosine decarboxylase; Provisional 99.8
TIGR03812373 tyr_de_CO2_Arch tyrosine decarboxylase MnfA. Membe 99.77
PRK02769380 histidine decarboxylase; Provisional 99.74
TIGR01788431 Glu-decarb-GAD glutamate decarboxylase. This model 99.73
TIGR02539370 SepCysS Sep-tRNA:Cys-tRNA synthase. Aminoacylation 99.73
PLN03226475 serine hydroxymethyltransferase; Provisional 99.69
cd00378402 SHMT Serine-glycine hydroxymethyltransferase (SHMT 99.69
PRK00011416 glyA serine hydroxymethyltransferase; Reviewed 99.69
cd00613398 GDC-P Glycine cleavage system P-protein, alpha- an 99.66
TIGR01437363 selA_rel uncharacterized pyridoxal phosphate-depen 99.62
PRK00451447 glycine dehydrogenase subunit 1; Validated 99.57
cd06450345 DOPA_deC_like DOPA decarboxylase family. This fami 99.57
cd06454349 KBL_like KBL_like; this family belongs to the pyri 99.56
PRK05937370 8-amino-7-oxononanoate synthase; Provisional 99.55
PRK04366481 glycine dehydrogenase subunit 2; Validated 99.52
PRK13580493 serine hydroxymethyltransferase; Provisional 99.52
PLN03032374 serine decarboxylase; Provisional 99.52
PLN02414 993 glycine dehydrogenase (decarboxylating) 99.51
TIGR01365374 serC_2 phosphoserine aminotransferase, Methanosarc 99.5
TIGR01822393 2am3keto_CoA 2-amino-3-ketobutyrate coenzyme A lig 99.48
PRK07179407 hypothetical protein; Provisional 99.48
PRK13034416 serine hydroxymethyltransferase; Reviewed 99.47
TIGR01141346 hisC histidinol-phosphate aminotransferase. Histid 99.45
cd00616352 AHBA_syn 3-amino-5-hydroxybenzoic acid synthase fa 99.44
TIGR00474454 selA seryl-tRNA(sec) selenium transferase. In bact 99.41
cd00615294 Orn_deC_like Ornithine decarboxylase family. This 99.4
PRK05367 954 glycine dehydrogenase; Provisional 99.39
TIGR00858360 bioF 8-amino-7-oxononanoate synthase. This model r 99.37
COG3844407 Kynureninase [Amino acid transport and metabolism] 99.36
PRK04311464 selenocysteine synthase; Provisional 99.35
TIGR01364349 serC_1 phosphoserine aminotransferase. This model 99.34
cd01494170 AAT_I Aspartate aminotransferase (AAT) superfamily 99.33
PRK06225380 aspartate aminotransferase; Provisional 99.33
cd00611355 PSAT_like Phosphoserine aminotransferase (PSAT) fa 99.32
PLN02414993 glycine dehydrogenase (decarboxylating) 99.31
PLN02271586 serine hydroxymethyltransferase 99.3
TIGR01825385 gly_Cac_T_rel pyridoxal phosphate-dependent acyltr 99.29
PRK13392410 5-aminolevulinate synthase; Provisional 99.29
PRK05958385 8-amino-7-oxononanoate synthase; Reviewed 99.29
cd00609350 AAT_like Aspartate aminotransferase family. This f 99.29
TIGR03799522 NOD_PanD_pyr putative pyridoxal-dependent aspartat 99.28
PRK05355360 3-phosphoserine/phosphohydroxythreonine aminotrans 99.27
PRK02731367 histidinol-phosphate aminotransferase; Validated 99.26
PRK08134433 O-acetylhomoserine aminocarboxypropyltransferase; 99.22
PRK06108382 aspartate aminotransferase; Provisional 99.22
cd06502338 TA_like Low-specificity threonine aldolase (TA). T 99.2
PLN02483489 serine palmitoyltransferase 99.2
PRK06939397 2-amino-3-ketobutyrate coenzyme A ligase; Provisio 99.19
PRK11658379 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate amin 99.18
PRK07908349 hypothetical protein; Provisional 99.18
PRK09105370 putative aminotransferase; Provisional 99.18
TIGR03588380 PseC UDP-4-keto-6-deoxy-N-acetylglucosamine 4-amin 99.16
TIGR01821402 5aminolev_synth 5-aminolevulinic acid synthase. Th 99.13
PRK09064407 5-aminolevulinate synthase; Validated 99.13
PRK05764393 aspartate aminotransferase; Provisional 99.11
PRK13393406 5-aminolevulinate synthase; Provisional 99.1
PRK08248431 O-acetylhomoserine aminocarboxypropyltransferase; 99.08
PRK05957389 aspartate aminotransferase; Provisional 99.07
PLN03026380 histidinol-phosphate aminotransferase; Provisional 99.06
PLN02721353 threonine aldolase 99.06
PRK05367954 glycine dehydrogenase; Provisional 99.05
PRK08056356 threonine-phosphate decarboxylase; Provisional 99.04
PRK07568397 aspartate aminotransferase; Provisional 99.03
COG0076460 GadB Glutamate decarboxylase and related PLP-depen 99.01
PRK08114395 cystathionine beta-lyase; Provisional 99.01
COG1103382 Archaea-specific pyridoxal phosphate-dependent enz 99.01
PLN02822481 serine palmitoyltransferase 99.01
PRK05387353 histidinol-phosphate aminotransferase; Provisional 99.0
PTZ00125400 ornithine aminotransferase-like protein; Provision 98.99
PRK07324373 transaminase; Validated 98.98
PRK04870356 histidinol-phosphate aminotransferase; Provisional 98.97
PRK08064390 cystathionine beta-lyase; Provisional 98.95
PRK05613437 O-acetylhomoserine aminocarboxypropyltransferase; 98.94
TIGR01366361 serC_3 phosphoserine aminotransferase, putative. T 98.94
PRK08133390 O-succinylhomoserine sulfhydrylase; Validated 98.94
TIGR03540383 DapC_direct LL-diaminopimelate aminotransferase. T 98.94
PRK07309391 aromatic amino acid aminotransferase; Validated 98.93
PRK06207405 aspartate aminotransferase; Provisional 98.93
TIGR01329378 cysta_beta_ly_E cystathionine beta-lyase, eukaryot 98.93
PRK04635354 histidinol-phosphate aminotransferase; Provisional 98.92
PRK07682378 hypothetical protein; Validated 98.91
TIGR02379376 ECA_wecE TDP-4-keto-6-deoxy-D-glucose transaminase 98.91
TIGR01324377 cysta_beta_ly_B cystathionine beta-lyase, bacteria 98.91
PRK07582366 cystathionine gamma-lyase; Validated 98.9
PLN03227392 serine palmitoyltransferase-like protein; Provisio 98.9
PLN02590539 probable tyrosine decarboxylase 98.89
PRK07505402 hypothetical protein; Provisional 98.88
PRK03158359 histidinol-phosphate aminotransferase; Provisional 98.86
PRK15407438 lipopolysaccharide biosynthesis protein RfbH; Prov 98.86
PLN02880490 tyrosine decarboxylase 98.86
PRK00950361 histidinol-phosphate aminotransferase; Validated 98.85
TIGR01265403 tyr_nico_aTase tyrosine/nicotianamine aminotransfe 98.84
PRK03080378 phosphoserine aminotransferase; Provisional 98.84
TIGR03537350 DapC succinyldiaminopimelate transaminase. Note: t 98.84
PRK08960387 hypothetical protein; Provisional 98.83
PRK06460376 hypothetical protein; Provisional 98.83
TIGR01325380 O_suc_HS_sulf O-succinylhomoserine sulfhydrylase. 98.83
PRK07504398 O-succinylhomoserine sulfhydrylase; Reviewed 98.82
PRK07550386 hypothetical protein; Provisional 98.82
PRK08045386 cystathionine gamma-synthase; Provisional 98.81
PRK09028394 cystathionine beta-lyase; Provisional 98.81
PRK08249398 cystathionine gamma-synthase; Provisional 98.81
PRK06767386 methionine gamma-lyase; Provisional 98.81
PRK07503403 methionine gamma-lyase; Provisional 98.81
PRK08776405 cystathionine gamma-synthase; Provisional 98.8
PRK07810403 O-succinylhomoserine sulfhydrylase; Provisional 98.8
cd00610413 OAT_like Acetyl ornithine aminotransferase family. 98.8
cd00614369 CGS_like CGS_like: Cystathionine gamma-synthase is 98.8
PRK05968389 hypothetical protein; Provisional 98.79
PRK07812436 O-acetylhomoserine aminocarboxypropyltransferase; 98.79
PRK09265404 aminotransferase AlaT; Validated 98.76
PRK05942394 aspartate aminotransferase; Provisional 98.75
PRK08361391 aspartate aminotransferase; Provisional 98.75
PRK03321352 putative aminotransferase; Provisional 98.75
TIGR01328391 met_gam_lyase methionine gamma-lyase. This model d 98.75
TIGR03576346 pyridox_MJ0158 pyridoxal phosphate enzyme, MJ0158 98.74
PRK08363398 alanine aminotransferase; Validated 98.74
PRK08861388 cystathionine gamma-synthase; Provisional 98.73
PRK07777387 aminotransferase; Validated 98.73
PRK09276385 LL-diaminopimelate aminotransferase; Provisional 98.73
COG0436393 Aspartate/tyrosine/aromatic aminotransferase [Amin 98.72
PRK07683387 aminotransferase A; Validated 98.72
PRK06836394 aspartate aminotransferase; Provisional 98.72
PRK08153369 histidinol-phosphate aminotransferase; Provisional 98.72
PRK05967395 cystathionine beta-lyase; Provisional 98.7
PRK14807351 histidinol-phosphate aminotransferase; Provisional 98.7
PRK12566954 glycine dehydrogenase; Provisional 98.7
PRK07811388 cystathionine gamma-synthase; Provisional 98.7
PF00464399 SHMT: Serine hydroxymethyltransferase; InterPro: I 98.69
PRK05994427 O-acetylhomoserine aminocarboxypropyltransferase; 98.69
COG0399374 WecE Predicted pyridoxal phosphate-dependent enzym 98.68
PRK13355517 bifunctional HTH-domain containing protein/aminotr 98.68
PRK11706375 TDP-4-oxo-6-deoxy-D-glucose transaminase; Provisio 98.68
PLN00145430 tyrosine/nicotianamine aminotransferase; Provision 98.67
PRK13238460 tnaA tryptophanase/L-cysteine desulfhydrase, PLP-d 98.66
PRK10534333 L-threonine aldolase; Provisional 98.65
PRK07681399 aspartate aminotransferase; Provisional 98.64
TIGR00707379 argD acetylornithine and succinylornithine aminotr 98.63
PLN02242418 methionine gamma-lyase 98.63
TIGR02080382 O_succ_thio_ly O-succinylhomoserine (thiol)-lyase. 98.63
PTZ00377481 alanine aminotransferase; Provisional 98.62
PRK01688351 histidinol-phosphate aminotransferase; Provisional 98.62
PRK06107402 aspartate aminotransferase; Provisional 98.61
PRK06234400 methionine gamma-lyase; Provisional 98.61
TIGR01140330 L_thr_O3P_dcar L-threonine-O-3-phosphate decarboxy 98.61
PRK08574385 cystathionine gamma-synthase; Provisional 98.6
PRK03317368 histidinol-phosphate aminotransferase; Provisional 98.6
PRK05939397 hypothetical protein; Provisional 98.6
PLN02187462 rooty/superroot1 98.59
PRK01533366 histidinol-phosphate aminotransferase; Validated 98.59
PTZ00433412 tyrosine aminotransferase; Provisional 98.59
PRK08912387 hypothetical protein; Provisional 98.58
PLN02656409 tyrosine transaminase 98.58
PRK04073396 rocD ornithine--oxo-acid transaminase; Provisional 98.56
PLN02509464 cystathionine beta-lyase 98.56
PRK00854401 rocD ornithine--oxo-acid transaminase; Reviewed 98.55
PRK04781364 histidinol-phosphate aminotransferase; Provisional 98.53
TIGR01326418 OAH_OAS_sulfhy OAH/OAS sulfhydrylase. This model d 98.53
PRK06176380 cystathionine gamma-synthase/cystathionine beta-ly 98.53
PRK12414384 putative aminotransferase; Provisional 98.53
TIGR03539357 DapC_actino succinyldiaminopimelate transaminase. 98.52
TIGR01264401 tyr_amTase_E tyrosine aminotransferase, eukaryotic 98.52
PF00155363 Aminotran_1_2: Aminotransferase class I and II 1-a 98.51
PRK14809357 histidinol-phosphate aminotransferase; Provisional 98.49
PRK06348384 aspartate aminotransferase; Provisional 98.49
PRK07671377 cystathionine beta-lyase; Provisional 98.47
PRK05166371 histidinol-phosphate aminotransferase; Provisional 98.47
PRK02610374 histidinol-phosphate aminotransferase; Provisional 98.47
PRK09082386 methionine aminotransferase; Validated 98.46
PRK03244398 argD acetylornithine aminotransferase; Provisional 98.46
PRK06358354 threonine-phosphate decarboxylase; Provisional 98.46
PLN00175413 aminotransferase family protein; Provisional 98.45
PRK07337388 aminotransferase; Validated 98.44
PRK06290410 aspartate aminotransferase; Provisional 98.43
TIGR00461939 gcvP glycine dehydrogenase (decarboxylating). This 98.42
PRK09148405 aminotransferase; Validated 98.41
PRK06084425 O-acetylhomoserine aminocarboxypropyltransferase; 98.39
PRK08247366 cystathionine gamma-synthase; Reviewed 98.39
PRK06434384 cystathionine gamma-lyase; Validated 98.38
PRK07050394 cystathionine beta-lyase; Provisional 98.34
PLN00143409 tyrosine/nicotianamine aminotransferase; Provision 98.33
PF00282373 Pyridoxal_deC: Pyridoxal-dependent decarboxylase c 98.33
TIGR01885401 Orn_aminotrans ornithine aminotransferase. This mo 98.33
TIGR03531444 selenium_SpcS O-phosphoseryl-tRNA(Sec) selenium tr 98.32
PF01041363 DegT_DnrJ_EryC1: DegT/DnrJ/EryC1/StrS aminotransfe 98.31
PLN02263470 serine decarboxylase 98.31
PRK07590409 L,L-diaminopimelate aminotransferase; Validated 98.3
PLN02231534 alanine transaminase 98.29
PRK07366388 succinyldiaminopimelate transaminase; Validated 98.29
PRK01278389 argD acetylornithine transaminase protein; Provisi 98.29
TIGR03542402 DAPAT_plant LL-diaminopimelate aminotransferase. T 98.29
PRK08068389 transaminase; Reviewed 98.28
COG0079356 HisC Histidinol-phosphate/aromatic aminotransferas 98.28
TIGR00461 939 gcvP glycine dehydrogenase (decarboxylating). This 98.27
PRK08175395 aminotransferase; Validated 98.26
PRK14808335 histidinol-phosphate aminotransferase; Provisional 98.23
PRK05664330 threonine-phosphate decarboxylase; Reviewed 98.18
PRK07269364 cystathionine gamma-synthase; Reviewed 98.18
PRK02627396 acetylornithine aminotransferase; Provisional 98.16
COG0075383 Serine-pyruvate aminotransferase/archaeal aspartat 98.15
TIGR03538393 DapC_gpp succinyldiaminopimelate transaminase. Thi 98.13
PRK08636403 aspartate aminotransferase; Provisional 98.13
PRK06959339 putative threonine-phosphate decarboxylase; Provis 98.12
COG0156388 BioF 7-keto-8-aminopelargonate synthetase and rela 98.09
PRK03967337 histidinol-phosphate aminotransferase; Provisional 98.08
PRK06425332 histidinol-phosphate aminotransferase; Validated 98.07
PRK15481431 transcriptional regulatory protein PtsJ; Provision 98.07
COG0112413 GlyA Glycine/serine hydroxymethyltransferase [Amin 98.05
PRK07049427 methionine gamma-lyase; Validated 98.05
PLN02624474 ornithine-delta-aminotransferase 98.04
KOG3846|consensus465 98.03
PLN02955476 8-amino-7-oxononanoate synthase 98.02
PRK06702432 O-acetylhomoserine aminocarboxypropyltransferase; 98.0
PRK07392360 threonine-phosphate decarboxylase; Validated 97.99
COG2008342 GLY1 Threonine aldolase [Amino acid transport and 97.98
PRK05093403 argD bifunctional N-succinyldiaminopimelate-aminot 97.97
PLN026721082 methionine S-methyltransferase 97.97
PRK02936377 argD acetylornithine aminotransferase; Provisional 97.97
KOG0257|consensus420 97.96
PLN02607447 1-aminocyclopropane-1-carboxylate synthase 97.93
PLN02376496 1-aminocyclopropane-1-carboxylate synthase 97.91
TIGR03246397 arg_catab_astC succinylornithine transaminase fami 97.91
PF01276417 OKR_DC_1: Orn/Lys/Arg decarboxylase, major domain; 97.87
PF00266371 Aminotran_5: Aminotransferase class-V; InterPro: I 97.87
TIGR02407412 ectoine_ectB diaminobutyrate--2-oxoglutarate amino 97.86
PRK07865364 N-succinyldiaminopimelate aminotransferase; Review 97.85
PRK12381406 bifunctional succinylornithine transaminase/acetyl 97.82
PRK09147396 succinyldiaminopimelate transaminase; Provisional 97.77
COG1921395 SelA Selenocysteine synthase [seryl-tRNASer seleni 97.74
PRK09440416 avtA valine--pyruvate transaminase; Provisional 97.74
PRK04260375 acetylornithine aminotransferase; Provisional 97.73
PTZ00376404 aspartate aminotransferase; Provisional 97.73
PLN02368407 alanine transaminase 97.7
cd00617431 Tnase_like Tryptophanase family (Tnase). This fami 97.68
TIGR03801521 asp_4_decarbox aspartate 4-decarboxylase. This enz 97.67
KOG2862|consensus385 97.66
PLN02409401 serine--glyoxylate aminotransaminase 97.63
PRK05964423 adenosylmethionine--8-amino-7-oxononanoate transam 97.63
TIGR03301355 PhnW-AepZ 2-aminoethylphosphonate aminotransferase 97.63
TIGR03811608 tyr_de_CO2_Ent tyrosine decarboxylase, Enterococcu 97.63
PRK06058443 4-aminobutyrate aminotransferase; Provisional 97.62
PRK06777421 4-aminobutyrate aminotransferase; Provisional 97.6
PRK08360443 4-aminobutyrate aminotransferase; Provisional 97.58
PRK09264425 diaminobutyrate--2-oxoglutarate aminotransferase; 97.55
COG4992404 ArgD Ornithine/acetylornithine aminotransferase [A 97.54
TIGR02618450 tyr_phenol_ly tyrosine phenol-lyase. This model de 97.52
PRK09257396 aromatic amino acid aminotransferase; Provisional 97.52
PRK15029755 arginine decarboxylase; Provisional 97.5
PF01053386 Cys_Met_Meta_PP: Cys/Met metabolism PLP-dependent 97.46
PRK13479368 2-aminoethylphosphonate--pyruvate transaminase; Pr 97.46
TIGR02326363 transamin_PhnW 2-aminoethylphosphonate--pyruvate t 97.42
TIGR00713423 hemL glutamate-1-semialdehyde-2,1-aminomutase. Thi 97.42
PRK06855433 aminotransferase; Validated 97.41
PRK05839374 hypothetical protein; Provisional 97.39
PRK09792421 4-aminobutyrate transaminase; Provisional 97.39
COG2873426 MET17 O-acetylhomoserine sulfhydrylase [Amino acid 97.34
TIGR03372442 putres_am_tran putrescine aminotransferase. Member 97.33
PLN00144382 acetylornithine transaminase 97.32
PF03841367 SelA: L-seryl-tRNA selenium transferase; InterPro: 97.31
PLN02450468 1-aminocyclopropane-1-carboxylate synthase 97.3
KOG2467|consensus477 97.3
PRK05769441 4-aminobutyrate aminotransferase; Provisional 97.29
PRK13237460 tyrosine phenol-lyase; Provisional 97.25
PRK09221445 beta alanine--pyruvate transaminase; Provisional 97.24
PRK11522459 putrescine--2-oxoglutarate aminotransferase; Provi 97.21
PRK03715395 argD acetylornithine transaminase protein; Provisi 97.2
PRK08117433 4-aminobutyrate aminotransferase; Provisional 97.16
COG0160447 GabT 4-aminobutyrate aminotransferase and related 97.08
KOG0259|consensus447 97.06
COG1168388 MalY Bifunctional PLP-dependent enzyme with beta-c 97.05
PLN02760504 4-aminobutyrate:pyruvate transaminase 97.02
PRK08354311 putative aminotransferase; Provisional 96.99
PRK13578720 ornithine decarboxylase; Provisional 96.97
PRK08593445 4-aminobutyrate aminotransferase; Provisional 96.97
KOG1368|consensus384 96.93
PRK04612408 argD acetylornithine transaminase protein; Provisi 96.92
TIGR00709442 dat 2,4-diaminobutyrate 4-transaminases. This fami 96.83
KOG1402|consensus427 96.77
PRK06917447 hypothetical protein; Provisional 96.75
PF01212290 Beta_elim_lyase: Beta-eliminating lyase; InterPro: 96.72
PRK07678451 aminotransferase; Validated 96.65
PRK15399713 lysine decarboxylase LdcC; Provisional 96.63
PRK09275527 aspartate aminotransferase; Provisional 96.62
COG1167459 ARO8 Transcriptional regulators containing a DNA-b 96.61
KOG1404|consensus442 96.6
KOG1360|consensus570 96.56
KOG1383|consensus491 96.55
PRK06918451 4-aminobutyrate aminotransferase; Reviewed 96.53
PLN02855424 Bifunctional selenocysteine lyase/cysteine desulfu 96.4
PRK07495425 4-aminobutyrate aminotransferase; Provisional 96.4
PRK07480456 putative aminotransferase; Validated 96.37
PF00202339 Aminotran_3: Aminotransferase class-III; InterPro: 96.34
PRK05639457 4-aminobutyrate aminotransferase; Provisional 96.31
PRK15400714 lysine decarboxylase CadA; Provisional 96.3
PRK06062451 hypothetical protein; Provisional 96.3
PLN02651364 cysteine desulfurase 96.28
COG0520405 csdA Selenocysteine lyase/Cysteine desulfurase [Po 96.17
cd06453373 SufS_like Cysteine desulfurase (SufS)-like. This f 96.17
PRK09295406 bifunctional cysteine desulfurase/selenocysteine l 96.13
KOG1359|consensus417 96.09
TIGR03235353 DNA_S_dndA cysteine desulfurase DndA. This model d 95.83
TIGR01979403 sufS cysteine desulfurases, SufS subfamily. This m 95.82
PRK12389428 glutamate-1-semialdehyde aminotransferase; Provisi 95.6
PRK07481449 hypothetical protein; Provisional 95.53
PRK06105460 aminotransferase; Provisional 95.46
PRK07030466 adenosylmethionine--8-amino-7-oxononanoate transam 95.42
KOG1357|consensus519 95.41
cd06451356 AGAT_like Alanine-glyoxylate aminotransferase (AGA 95.39
PLN02397423 aspartate transaminase 95.31
KOG0053|consensus409 95.27
PRK06541460 hypothetical protein; Provisional 95.19
PF02347429 GDC-P: Glycine cleavage system P-protein; InterPro 95.15
PLN02482474 glutamate-1-semialdehyde 2,1-aminomutase 95.15
PRK05965459 hypothetical protein; Provisional 95.12
PRK08637388 hypothetical protein; Provisional 95.12
TIGR01977376 am_tr_V_EF2568 cysteine desulfurase family protein 95.07
PRK12403460 putative aminotransferase; Provisional 95.07
TIGR03392398 FeS_syn_CsdA cysteine desulfurase, catalytic subun 95.05
COG1448396 TyrB Aspartate/tyrosine/aromatic aminotransferase 94.95
PRK07482461 hypothetical protein; Provisional 94.95
PRK13360442 omega amino acid--pyruvate transaminase; Provision 94.84
TIGR00700420 GABAtrnsam 4-aminobutyrate aminotransferase, proka 94.82
PRK10874401 cysteine sulfinate desulfinase; Provisional 94.7
PRK06943453 adenosylmethionine--8-amino-7-oxononanoate transam 94.65
TIGR02006402 IscS cysteine desulfurase IscS. This model represe 94.37
PRK06082459 4-aminobutyrate aminotransferase; Provisional 94.31
PRK07046453 aminotransferase; Validated 94.18
KOG0256|consensus471 94.17
PRK06916460 adenosylmethionine--8-amino-7-oxononanoate transam 93.7
PRK04013364 argD acetylornithine/acetyl-lysine aminotransferas 93.69
KOG0629|consensus510 93.59
TIGR01976397 am_tr_V_VC1184 cysteine desulfurase family protein 93.52
TIGR03403382 nifS_epsilon cysteine desulfurase, NifS family, ep 93.41
KOG1401|consensus433 93.25
COG0626396 MetC Cystathionine beta-lyases/cystathionine gamma 93.24
PRK08088425 4-aminobutyrate aminotransferase; Validated 92.67
PRK06149972 hypothetical protein; Provisional 92.66
COG0001432 HemL Glutamate-1-semialdehyde aminotransferase [Co 92.59
PRK06173429 adenosylmethionine--8-amino-7-oxononanoate transam 92.3
PRK06938464 diaminobutyrate--2-oxoglutarate aminotransferase; 92.15
PRK02948381 cysteine desulfurase; Provisional 92.13
TIGR03251431 LAT_fam L-lysine 6-transaminase. Characterized mem 91.87
TIGR01814406 kynureninase kynureninase. This model describes ky 91.63
TIGR01140330 L_thr_O3P_dcar L-threonine-O-3-phosphate decarboxy 91.39
TIGR00508427 bioA adenosylmethionine-8-amino-7-oxononanoate tra 91.12
PRK05630422 adenosylmethionine--8-amino-7-oxononanoate transam 90.99
COG0161449 BioA Adenosylmethionine-8-amino-7-oxononanoate ami 90.75
TIGR03402379 FeS_nifS cysteine desulfurase NifS. Members of thi 89.77
PRK02769380 histidine decarboxylase; Provisional 89.7
COG1982557 LdcC Arginine/lysine/ornithine decarboxylases [Ami 89.57
PRK08361391 aspartate aminotransferase; Provisional 89.36
PRK07036466 hypothetical protein; Provisional 89.21
PRK00062426 glutamate-1-semialdehyde aminotransferase; Provisi 88.82
PRK00950361 histidinol-phosphate aminotransferase; Validated 88.74
KOG2142|consensus 728 88.22
PRK07777387 aminotransferase; Validated 88.11
PRK061481013 hypothetical protein; Provisional 87.84
PRK00615433 glutamate-1-semialdehyde aminotransferase; Provisi 87.51
PLN02724 805 Molybdenum cofactor sulfurase 87.16
PLN03226475 serine hydroxymethyltransferase; Provisional 87.0
PRK06931459 diaminobutyrate--2-oxoglutarate aminotransferase; 86.91
PRK12566 954 glycine dehydrogenase; Provisional 86.34
COG0403450 GcvP Glycine cleavage system protein P (pyridoxal- 85.25
PRK08088425 4-aminobutyrate aminotransferase; Validated 85.12
PRK09276385 LL-diaminopimelate aminotransferase; Provisional 84.93
PRK06209431 glutamate-1-semialdehyde 2,1-aminomutase; Provisio 84.85
PRK14012404 cysteine desulfurase; Provisional 84.06
PRK07483443 hypothetical protein; Provisional 81.51
COG3977417 Alanine-alpha-ketoisovalerate (or valine-pyruvate) 80.95
>KOG2790|consensus Back     alignment and domain information
Probab=100.00  E-value=1.9e-90  Score=692.57  Aligned_cols=352  Identities=63%  Similarity=1.009  Sum_probs=320.1

Q ss_pred             cCCCCCceeccCCCCCCCHHHHHHHHHHHHhhccCCCcccccccccHHHHHHHHHHHHHHHHHhCCCCCCEEEEEcCCcc
Q psy8733          46 SSAAHPVINFGAGPAKLPREVLEEVKETLLDYESTGISVMEMSHRSADYTKINNDTQAALRELLNVPNNYKILFLQGGGT  125 (621)
Q Consensus        46 ~~~~~~~~lf~aGPs~~P~~Vlea~~~~l~~~~~~g~sv~e~shrs~~f~~i~~~ar~~La~Ll~~p~~yeI~f~~gggT  125 (621)
                      ...++++.+|.|||+.+|.+|+.++++.+.||++.|+|++||||||++|..++++++..+|+|+++|++|+|+|+|||||
T Consensus         2 ~~a~~~vvnFaaGPAklp~~VL~e~qkdl~n~~g~GisV~EmSHRsk~f~kii~~tes~lreLlniPdn~~vlf~QGGGt   81 (370)
T KOG2790|consen    2 MDAPERVVNFAAGPAKLPESVLLEAQKDLLNFNGSGISVMEMSHRSKDFAKIINDTESLLRELLNIPDNYKVLFLQGGGT   81 (370)
T ss_pred             CCCccceeecCCCcccCCHHHHHHHHHHhhccCCCcceEEEecccchhHHHHHHHHHHHHHHHHcCCCceeEEEEeCCCc
Confidence            34447899999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhhhHHHHHHhhhccCCCCCceeEeecCCcchhHHHHHHHhh--CCCCcEEEEEcChHHHHHHHHHHHhCCceeeecccc
Q psy8733         126 GMFAAVAMNLISSSMNVPNNYKILFLQGGGTGMFAAVAMNLI--GRTGKADYVVTGSWSKKAAAEAEKYGKVNLVIPKVS  203 (621)
Q Consensus       126 ~~~~a~alNlla~~~~~~~gd~Il~~~~~~~~~feav~~NL~--~~g~~~~~v~tG~~~~~~~~~a~~~G~~~~~~~~~~  203 (621)
                      +                               ||++++.||.  ..|+.++|++||.||.++.++|+++|.++.+.+..+
T Consensus        82 ~-------------------------------qFaAv~lNL~glK~g~~AdYiVTGsWS~KA~~EAkk~~~~~~V~~~~k  130 (370)
T KOG2790|consen   82 G-------------------------------QFAAVPLNLIGLKHGRCADYVVTGSWSAKAAEEAKKYGTPNIVIPKLK  130 (370)
T ss_pred             c-------------------------------cccccchhhhccccCCccceEEeccccHHHHHHHHhhCCceEEecccc
Confidence            9                               8888999988  466789999999999999999999998766554210


Q ss_pred             cccccCCCCCCCCCCCccccccccCccccCccchhhhHHHhhhcccccccccCCCccCCCCccccCCCCCceEEEEeccc
Q psy8733         204 KYVSIPDQSTWNRDPEASYLYYCDNETVDGSWSKKAAAEAEKYGKVNLVIPKVSKYVSIPDQSTWNRDPEASYLYYCDNE  283 (621)
Q Consensus       204 ~~~~~~~~~~~~~~~~v~~v~~~~~~~v~~~w~~~v~~e~~~~~~~~~~~~~~~~~~~ip~~~~l~i~~~t~~V~~thnE  283 (621)
                                                                          +-.|+.+|+.+.|..++|.+||++|.||
T Consensus       131 ----------------------------------------------------~y~ygkvPd~~~w~~~~da~yvyyCaNE  158 (370)
T KOG2790|consen  131 ----------------------------------------------------SYTYGKVPDPSTWELNPDASYVYYCANE  158 (370)
T ss_pred             ----------------------------------------------------ccccCcCCChhhcccCCCccEEEEecCc
Confidence                                                                1126689999999999999999999999


Q ss_pred             ccccccccccc--ccCCCcEEEecccccCCCcccccccceEEeccccccCCCccEEEEEchhHHhhhCCCCCceeecccc
Q psy8733         284 TVDGVEFNYIP--DSQGIPLVSDMSSNFLSRKFDVSKFGVIIAGAQKNIGPAGITVVIVREDLLEYALPITPTVFHFKIN  361 (621)
Q Consensus       284 T~tGv~~p~i~--~~~g~llvvDavSs~G~~pIDv~~~gvl~asaqK~lGP~Glg~livr~~ll~~~~~~~P~~ld~~~~  361 (621)
                      |++|++++.+|  ..+|+++|+|++|.|.++|+|+++                                           
T Consensus       159 TVHGVEf~~~P~~~~~~~vlVaDmSSnflSrpvDvsk-------------------------------------------  195 (370)
T KOG2790|consen  159 TVHGVEFDFIPVNDPKGAVLVADMSSNFLSRPVDVSK-------------------------------------------  195 (370)
T ss_pred             eeeceecCCCCCCCCCCceEEEecccchhcCCccchh-------------------------------------------
Confidence            99999999877  678999999999999999988754                                           


Q ss_pred             ccCCCccCCchHHHHHHHHHHHHHHHhhCCHHHHHHHHHHHHHHHHHHHHccCCcccCccCCCCCCCCcccccccccccc
Q psy8733         362 ADNNSVYNTPPTFVVHVIQRVFAWIKRQGGLAKMEQNSLQKSVLLYQEIDNSDKFYECPVQAGCRSRMNVTDIFFTFSHV  441 (621)
Q Consensus       362 ~~~~s~~~TP~v~~I~aL~~aL~~i~~~gGl~~i~~r~~~la~~L~e~L~~~~g~~~~~~~~~~RS~~nv~~~~~t~~~~  441 (621)
                                                                                                      
T Consensus       196 --------------------------------------------------------------------------------  195 (370)
T KOG2790|consen  196 --------------------------------------------------------------------------------  195 (370)
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             cCCchhhHHHHHhhcccccccCCcEEeeecHhHhhhcCCCCCceeeeeecccCCCccCCCchhHHHHHHHHHHHHHhcCC
Q psy8733         442 QTGSAFFFGVIIAGAQKNIGPAGITVVIVREDLLEYALPITPTVFHFKINADNNSVYNTPPTFVVHVIQRVFAWIKRQGG  521 (621)
Q Consensus       442 ~~~~~~~~~~~~a~~qk~~GpaGl~v~iv~~~~l~~~~~~~p~~~~y~~~~~~~s~~nTP~~~~iy~~~~vl~~~~~~gg  521 (621)
                             |++||||+|||+||||+|++|||+|+|+++.+++|++++|+.+++|||+|||||||+||++|+||+||+++||
T Consensus       196 -------~gvi~aGAQKN~G~aG~Tvvivr~dllg~~~~~tP~v~dyk~~~~NnSlyNTpP~f~iy~~~Lv~~~il~~GG  268 (370)
T KOG2790|consen  196 -------FGVIFAGAQKNVGPAGVTVVIVRKDLLGNALDITPSVLDYKIMDKNNSLYNTPPCFGIYVMGLVFEWILEKGG  268 (370)
T ss_pred             -------cceEEeccccccCccccEEEEEehhhhcccccCCccccceeeeccccccccCCCeeeeeehhhHHHHHHhccc
Confidence                   4455666677777777777777777777777778999999999999999999999999999999999999999


Q ss_pred             hHHHHHHHHHHHHHHHHHHhccCCcccccCCC-------------CCcccHHHHHHHHHccCccccCCCCCCccceeecc
Q psy8733         522 LAKMEQNSLQKSVLLYQEIDNSDKFYECPVQA-------------GFPLDELFLKEAKAHNMIQLKGHRLVGGIRASIYN  588 (621)
Q Consensus       522 ~~~~~~~~~~ka~~lY~~id~~~~~~~~~v~~-------------~~~~~~~~~~~~~~~~i~~~~g~~~~~~~r~~~~~  588 (621)
                      +++||+.|++||++||+.||+|.+||+|||++             .++++++|+++|.+++|+.+|||||+||||+|+||
T Consensus       269 l~a~e~~n~~KskllYd~iD~s~gfy~cpVe~~~RS~MNV~Fri~~d~Le~eFLkeA~~~~mv~LKGhRSVGGiRASlYN  348 (370)
T KOG2790|consen  269 LAAMEKLNQEKSKLLYDAIDNSNGFYRCPVEPSVRSRMNVPFRIEKDELEAEFLKEAAKEHMVQLKGHRSVGGIRASLYN  348 (370)
T ss_pred             HHHHHHHHHHHHHHHHHHHHhcCCeEEcccchhhhhhcccceeecchHHHHHHHHHHHHhhhhccccccccccchhhhhc
Confidence            99999999999999999999999999999999             24599999999999999999999999999999999


Q ss_pred             CCCHHHHHHHHHHHHHHHHHcC
Q psy8733         589 AITVDEAVILVKFMKEFRHKHS  610 (621)
Q Consensus       589 a~~~~~~~~l~~~~~~~~~~~~  610 (621)
                      |++.|++++|++||++|.++|.
T Consensus       349 Aisv~~~q~L~~~m~~F~k~h~  370 (370)
T KOG2790|consen  349 AISVEEVQKLAAFMKEFQKKHA  370 (370)
T ss_pred             cccHHHHHHHHHHHHHHHHhcC
Confidence            9999999999999999999984



>PRK12462 phosphoserine aminotransferase; Provisional Back     alignment and domain information
>COG1932 SerC Phosphoserine aminotransferase [Coenzyme metabolism / Amino acid transport and metabolism] Back     alignment and domain information
>PLN02452 phosphoserine transaminase Back     alignment and domain information
>PRK05355 3-phosphoserine/phosphohydroxythreonine aminotransferase; Provisional Back     alignment and domain information
>TIGR01364 serC_1 phosphoserine aminotransferase Back     alignment and domain information
>cd00611 PSAT_like Phosphoserine aminotransferase (PSAT) family Back     alignment and domain information
>COG0075 Serine-pyruvate aminotransferase/archaeal aspartate aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01365 serC_2 phosphoserine aminotransferase, Methanosarcina type Back     alignment and domain information
>TIGR01366 serC_3 phosphoserine aminotransferase, putative Back     alignment and domain information
>PRK03080 phosphoserine aminotransferase; Provisional Back     alignment and domain information
>KOG2862|consensus Back     alignment and domain information
>COG0520 csdA Selenocysteine lyase/Cysteine desulfurase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02409 serine--glyoxylate aminotransaminase Back     alignment and domain information
>PF00266 Aminotran_5: Aminotransferase class-V; InterPro: IPR000192 Aminotransferases share certain mechanistic features with other pyridoxal- phosphate dependent enzymes, such as the covalent binding of the pyridoxal- phosphate group to a lysine residue Back     alignment and domain information
>TIGR02326 transamin_PhnW 2-aminoethylphosphonate--pyruvate transaminase Back     alignment and domain information
>PRK13479 2-aminoethylphosphonate--pyruvate transaminase; Provisional Back     alignment and domain information
>TIGR03301 PhnW-AepZ 2-aminoethylphosphonate aminotransferase Back     alignment and domain information
>COG1104 NifS Cysteine sulfinate desulfinase/cysteine desulfurase and related enzymes [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09295 bifunctional cysteine desulfurase/selenocysteine lyase; Validated Back     alignment and domain information
>PLN02855 Bifunctional selenocysteine lyase/cysteine desulfurase Back     alignment and domain information
>PRK10874 cysteine sulfinate desulfinase; Provisional Back     alignment and domain information
>TIGR03392 FeS_syn_CsdA cysteine desulfurase, catalytic subunit CsdA Back     alignment and domain information
>PLN02651 cysteine desulfurase Back     alignment and domain information
>PLN02724 Molybdenum cofactor sulfurase Back     alignment and domain information
>cd06451 AGAT_like Alanine-glyoxylate aminotransferase (AGAT) family Back     alignment and domain information
>TIGR03402 FeS_nifS cysteine desulfurase NifS Back     alignment and domain information
>TIGR01977 am_tr_V_EF2568 cysteine desulfurase family protein Back     alignment and domain information
>TIGR01979 sufS cysteine desulfurases, SufS subfamily Back     alignment and domain information
>TIGR02006 IscS cysteine desulfurase IscS Back     alignment and domain information
>TIGR03403 nifS_epsilon cysteine desulfurase, NifS family, epsilon proteobacteria type Back     alignment and domain information
>TIGR01814 kynureninase kynureninase Back     alignment and domain information
>TIGR01976 am_tr_V_VC1184 cysteine desulfurase family protein, VC1184 subfamily Back     alignment and domain information
>PRK02948 cysteine desulfurase; Provisional Back     alignment and domain information
>KOG1549|consensus Back     alignment and domain information
>cd06453 SufS_like Cysteine desulfurase (SufS)-like Back     alignment and domain information
>PRK12462 phosphoserine aminotransferase; Provisional Back     alignment and domain information
>PRK14012 cysteine desulfurase; Provisional Back     alignment and domain information
>TIGR03235 DNA_S_dndA cysteine desulfurase DndA Back     alignment and domain information
>KOG2790|consensus Back     alignment and domain information
>COG1932 SerC Phosphoserine aminotransferase [Coenzyme metabolism / Amino acid transport and metabolism] Back     alignment and domain information
>PRK09331 Sep-tRNA:Cys-tRNA synthetase; Provisional Back     alignment and domain information
>PLN02452 phosphoserine transaminase Back     alignment and domain information
>PTZ00094 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>cd06452 SepCysS Sep-tRNA:Cys-tRNA synthase Back     alignment and domain information
>PRK13520 L-tyrosine decarboxylase; Provisional Back     alignment and domain information
>TIGR03812 tyr_de_CO2_Arch tyrosine decarboxylase MnfA Back     alignment and domain information
>PRK02769 histidine decarboxylase; Provisional Back     alignment and domain information
>TIGR01788 Glu-decarb-GAD glutamate decarboxylase Back     alignment and domain information
>TIGR02539 SepCysS Sep-tRNA:Cys-tRNA synthase Back     alignment and domain information
>PLN03226 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>cd00378 SHMT Serine-glycine hydroxymethyltransferase (SHMT) Back     alignment and domain information
>PRK00011 glyA serine hydroxymethyltransferase; Reviewed Back     alignment and domain information
>cd00613 GDC-P Glycine cleavage system P-protein, alpha- and beta-subunits Back     alignment and domain information
>TIGR01437 selA_rel uncharacterized pyridoxal phosphate-dependent enzyme Back     alignment and domain information
>PRK00451 glycine dehydrogenase subunit 1; Validated Back     alignment and domain information
>cd06450 DOPA_deC_like DOPA decarboxylase family Back     alignment and domain information
>cd06454 KBL_like KBL_like; this family belongs to the pyridoxal phosphate (PLP)-dependent aspartate aminotransferase superfamily (fold I) Back     alignment and domain information
>PRK05937 8-amino-7-oxononanoate synthase; Provisional Back     alignment and domain information
>PRK04366 glycine dehydrogenase subunit 2; Validated Back     alignment and domain information
>PRK13580 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>PLN03032 serine decarboxylase; Provisional Back     alignment and domain information
>PLN02414 glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>TIGR01365 serC_2 phosphoserine aminotransferase, Methanosarcina type Back     alignment and domain information
>TIGR01822 2am3keto_CoA 2-amino-3-ketobutyrate coenzyme A ligase Back     alignment and domain information
>PRK07179 hypothetical protein; Provisional Back     alignment and domain information
>PRK13034 serine hydroxymethyltransferase; Reviewed Back     alignment and domain information
>TIGR01141 hisC histidinol-phosphate aminotransferase Back     alignment and domain information
>cd00616 AHBA_syn 3-amino-5-hydroxybenzoic acid synthase family (AHBA_syn) Back     alignment and domain information
>TIGR00474 selA seryl-tRNA(sec) selenium transferase Back     alignment and domain information
>cd00615 Orn_deC_like Ornithine decarboxylase family Back     alignment and domain information
>PRK05367 glycine dehydrogenase; Provisional Back     alignment and domain information
>TIGR00858 bioF 8-amino-7-oxononanoate synthase Back     alignment and domain information
>COG3844 Kynureninase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK04311 selenocysteine synthase; Provisional Back     alignment and domain information
>TIGR01364 serC_1 phosphoserine aminotransferase Back     alignment and domain information
>cd01494 AAT_I Aspartate aminotransferase (AAT) superfamily (fold type I) of pyridoxal phosphate (PLP)-dependent enzymes Back     alignment and domain information
>PRK06225 aspartate aminotransferase; Provisional Back     alignment and domain information
>cd00611 PSAT_like Phosphoserine aminotransferase (PSAT) family Back     alignment and domain information
>PLN02414 glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>PLN02271 serine hydroxymethyltransferase Back     alignment and domain information
>TIGR01825 gly_Cac_T_rel pyridoxal phosphate-dependent acyltransferase, putative Back     alignment and domain information
>PRK13392 5-aminolevulinate synthase; Provisional Back     alignment and domain information
>PRK05958 8-amino-7-oxononanoate synthase; Reviewed Back     alignment and domain information
>cd00609 AAT_like Aspartate aminotransferase family Back     alignment and domain information
>TIGR03799 NOD_PanD_pyr putative pyridoxal-dependent aspartate 1-decarboxylase Back     alignment and domain information
>PRK05355 3-phosphoserine/phosphohydroxythreonine aminotransferase; Provisional Back     alignment and domain information
>PRK02731 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PRK08134 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK06108 aspartate aminotransferase; Provisional Back     alignment and domain information
>cd06502 TA_like Low-specificity threonine aldolase (TA) Back     alignment and domain information
>PLN02483 serine palmitoyltransferase Back     alignment and domain information
>PRK06939 2-amino-3-ketobutyrate coenzyme A ligase; Provisional Back     alignment and domain information
>PRK11658 UDP-4-amino-4-deoxy-L-arabinose--oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>PRK07908 hypothetical protein; Provisional Back     alignment and domain information
>PRK09105 putative aminotransferase; Provisional Back     alignment and domain information
>TIGR03588 PseC UDP-4-keto-6-deoxy-N-acetylglucosamine 4-aminotransferase Back     alignment and domain information
>TIGR01821 5aminolev_synth 5-aminolevulinic acid synthase Back     alignment and domain information
>PRK09064 5-aminolevulinate synthase; Validated Back     alignment and domain information
>PRK05764 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK13393 5-aminolevulinate synthase; Provisional Back     alignment and domain information
>PRK08248 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK05957 aspartate aminotransferase; Provisional Back     alignment and domain information
>PLN03026 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PLN02721 threonine aldolase Back     alignment and domain information
>PRK05367 glycine dehydrogenase; Provisional Back     alignment and domain information
>PRK08056 threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>PRK07568 aspartate aminotransferase; Provisional Back     alignment and domain information
>COG0076 GadB Glutamate decarboxylase and related PLP-dependent proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08114 cystathionine beta-lyase; Provisional Back     alignment and domain information
>COG1103 Archaea-specific pyridoxal phosphate-dependent enzymes [General function prediction only] Back     alignment and domain information
>PLN02822 serine palmitoyltransferase Back     alignment and domain information
>PRK05387 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PTZ00125 ornithine aminotransferase-like protein; Provisional Back     alignment and domain information
>PRK07324 transaminase; Validated Back     alignment and domain information
>PRK04870 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK08064 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK05613 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>TIGR01366 serC_3 phosphoserine aminotransferase, putative Back     alignment and domain information
>PRK08133 O-succinylhomoserine sulfhydrylase; Validated Back     alignment and domain information
>TIGR03540 DapC_direct LL-diaminopimelate aminotransferase Back     alignment and domain information
>PRK07309 aromatic amino acid aminotransferase; Validated Back     alignment and domain information
>PRK06207 aspartate aminotransferase; Provisional Back     alignment and domain information
>TIGR01329 cysta_beta_ly_E cystathionine beta-lyase, eukaryotic Back     alignment and domain information
>PRK04635 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK07682 hypothetical protein; Validated Back     alignment and domain information
>TIGR02379 ECA_wecE TDP-4-keto-6-deoxy-D-glucose transaminase Back     alignment and domain information
>TIGR01324 cysta_beta_ly_B cystathionine beta-lyase, bacterial Back     alignment and domain information
>PRK07582 cystathionine gamma-lyase; Validated Back     alignment and domain information
>PLN03227 serine palmitoyltransferase-like protein; Provisional Back     alignment and domain information
>PLN02590 probable tyrosine decarboxylase Back     alignment and domain information
>PRK07505 hypothetical protein; Provisional Back     alignment and domain information
>PRK03158 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK15407 lipopolysaccharide biosynthesis protein RfbH; Provisional Back     alignment and domain information
>PLN02880 tyrosine decarboxylase Back     alignment and domain information
>PRK00950 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>TIGR01265 tyr_nico_aTase tyrosine/nicotianamine aminotransferases Back     alignment and domain information
>PRK03080 phosphoserine aminotransferase; Provisional Back     alignment and domain information
>TIGR03537 DapC succinyldiaminopimelate transaminase Back     alignment and domain information
>PRK08960 hypothetical protein; Provisional Back     alignment and domain information
>PRK06460 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01325 O_suc_HS_sulf O-succinylhomoserine sulfhydrylase Back     alignment and domain information
>PRK07504 O-succinylhomoserine sulfhydrylase; Reviewed Back     alignment and domain information
>PRK07550 hypothetical protein; Provisional Back     alignment and domain information
>PRK08045 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK09028 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK08249 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK06767 methionine gamma-lyase; Provisional Back     alignment and domain information
>PRK07503 methionine gamma-lyase; Provisional Back     alignment and domain information
>PRK08776 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK07810 O-succinylhomoserine sulfhydrylase; Provisional Back     alignment and domain information
>cd00610 OAT_like Acetyl ornithine aminotransferase family Back     alignment and domain information
>cd00614 CGS_like CGS_like: Cystathionine gamma-synthase is a PLP dependent enzyme and catalyzes the committed step of methionine biosynthesis Back     alignment and domain information
>PRK05968 hypothetical protein; Provisional Back     alignment and domain information
>PRK07812 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK09265 aminotransferase AlaT; Validated Back     alignment and domain information
>PRK05942 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK08361 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK03321 putative aminotransferase; Provisional Back     alignment and domain information
>TIGR01328 met_gam_lyase methionine gamma-lyase Back     alignment and domain information
>TIGR03576 pyridox_MJ0158 pyridoxal phosphate enzyme, MJ0158 family Back     alignment and domain information
>PRK08363 alanine aminotransferase; Validated Back     alignment and domain information
>PRK08861 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK07777 aminotransferase; Validated Back     alignment and domain information
>PRK09276 LL-diaminopimelate aminotransferase; Provisional Back     alignment and domain information
>COG0436 Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07683 aminotransferase A; Validated Back     alignment and domain information
>PRK06836 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK08153 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK05967 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK14807 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK12566 glycine dehydrogenase; Provisional Back     alignment and domain information
>PRK07811 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PF00464 SHMT: Serine hydroxymethyltransferase; InterPro: IPR001085 Synonym(s): Serine hydroxymethyltransferase, Serine aldolase, Threonine aldolase Serine hydroxymethyltransferase (SHMT) is a pyridoxal phosphate (PLP) dependent enzyme and belongs to the aspartate aminotransferase superfamily (fold type I) [] Back     alignment and domain information
>PRK05994 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>COG0399 WecE Predicted pyridoxal phosphate-dependent enzyme apparently involved in regulation of cell wall biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK13355 bifunctional HTH-domain containing protein/aminotransferase; Provisional Back     alignment and domain information
>PRK11706 TDP-4-oxo-6-deoxy-D-glucose transaminase; Provisional Back     alignment and domain information
>PLN00145 tyrosine/nicotianamine aminotransferase; Provisional Back     alignment and domain information
>PRK13238 tnaA tryptophanase/L-cysteine desulfhydrase, PLP-dependent; Provisional Back     alignment and domain information
>PRK10534 L-threonine aldolase; Provisional Back     alignment and domain information
>PRK07681 aspartate aminotransferase; Provisional Back     alignment and domain information
>TIGR00707 argD acetylornithine and succinylornithine aminotransferases Back     alignment and domain information
>PLN02242 methionine gamma-lyase Back     alignment and domain information
>TIGR02080 O_succ_thio_ly O-succinylhomoserine (thiol)-lyase Back     alignment and domain information
>PTZ00377 alanine aminotransferase; Provisional Back     alignment and domain information
>PRK01688 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK06107 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK06234 methionine gamma-lyase; Provisional Back     alignment and domain information
>TIGR01140 L_thr_O3P_dcar L-threonine-O-3-phosphate decarboxylase Back     alignment and domain information
>PRK08574 cystathionine gamma-synthase; Provisional Back     alignment and domain information
>PRK03317 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK05939 hypothetical protein; Provisional Back     alignment and domain information
>PLN02187 rooty/superroot1 Back     alignment and domain information
>PRK01533 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PTZ00433 tyrosine aminotransferase; Provisional Back     alignment and domain information
>PRK08912 hypothetical protein; Provisional Back     alignment and domain information
>PLN02656 tyrosine transaminase Back     alignment and domain information
>PRK04073 rocD ornithine--oxo-acid transaminase; Provisional Back     alignment and domain information
>PLN02509 cystathionine beta-lyase Back     alignment and domain information
>PRK00854 rocD ornithine--oxo-acid transaminase; Reviewed Back     alignment and domain information
>PRK04781 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>TIGR01326 OAH_OAS_sulfhy OAH/OAS sulfhydrylase Back     alignment and domain information
>PRK06176 cystathionine gamma-synthase/cystathionine beta-lyase; Validated Back     alignment and domain information
>PRK12414 putative aminotransferase; Provisional Back     alignment and domain information
>TIGR03539 DapC_actino succinyldiaminopimelate transaminase Back     alignment and domain information
>TIGR01264 tyr_amTase_E tyrosine aminotransferase, eukaryotic Back     alignment and domain information
>PF00155 Aminotran_1_2: Aminotransferase class I and II 1-aminocyclopropane-1-carboxylate synthase signature aspartate aminotransferase signature; InterPro: IPR004839 Aminotransferases share certain mechanistic features with other pyridoxal-phosphate dependent enzymes, such as the covalent binding of the pyridoxal-phosphate group to a lysine residue Back     alignment and domain information
>PRK14809 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK06348 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK07671 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PRK05166 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK02610 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK09082 methionine aminotransferase; Validated Back     alignment and domain information
>PRK03244 argD acetylornithine aminotransferase; Provisional Back     alignment and domain information
>PRK06358 threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>PLN00175 aminotransferase family protein; Provisional Back     alignment and domain information
>PRK07337 aminotransferase; Validated Back     alignment and domain information
>PRK06290 aspartate aminotransferase; Provisional Back     alignment and domain information
>TIGR00461 gcvP glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK09148 aminotransferase; Validated Back     alignment and domain information
>PRK06084 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK08247 cystathionine gamma-synthase; Reviewed Back     alignment and domain information
>PRK06434 cystathionine gamma-lyase; Validated Back     alignment and domain information
>PRK07050 cystathionine beta-lyase; Provisional Back     alignment and domain information
>PLN00143 tyrosine/nicotianamine aminotransferase; Provisional Back     alignment and domain information
>PF00282 Pyridoxal_deC: Pyridoxal-dependent decarboxylase conserved domain; InterPro: IPR002129 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal) Back     alignment and domain information
>TIGR01885 Orn_aminotrans ornithine aminotransferase Back     alignment and domain information
>TIGR03531 selenium_SpcS O-phosphoseryl-tRNA(Sec) selenium transferase Back     alignment and domain information
>PF01041 DegT_DnrJ_EryC1: DegT/DnrJ/EryC1/StrS aminotransferase family; InterPro: IPR000653 This entry represents a family that are probably all pyridoxal-phosphate-dependent aminotransferase enzymes with a variety of molecular functions Back     alignment and domain information
>PLN02263 serine decarboxylase Back     alignment and domain information
>PRK07590 L,L-diaminopimelate aminotransferase; Validated Back     alignment and domain information
>PLN02231 alanine transaminase Back     alignment and domain information
>PRK07366 succinyldiaminopimelate transaminase; Validated Back     alignment and domain information
>PRK01278 argD acetylornithine transaminase protein; Provisional Back     alignment and domain information
>TIGR03542 DAPAT_plant LL-diaminopimelate aminotransferase Back     alignment and domain information
>PRK08068 transaminase; Reviewed Back     alignment and domain information
>COG0079 HisC Histidinol-phosphate/aromatic aminotransferase and cobyric acid decarboxylase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00461 gcvP glycine dehydrogenase (decarboxylating) Back     alignment and domain information
>PRK08175 aminotransferase; Validated Back     alignment and domain information
>PRK14808 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK05664 threonine-phosphate decarboxylase; Reviewed Back     alignment and domain information
>PRK07269 cystathionine gamma-synthase; Reviewed Back     alignment and domain information
>PRK02627 acetylornithine aminotransferase; Provisional Back     alignment and domain information
>COG0075 Serine-pyruvate aminotransferase/archaeal aspartate aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03538 DapC_gpp succinyldiaminopimelate transaminase Back     alignment and domain information
>PRK08636 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK06959 putative threonine-phosphate decarboxylase; Provisional Back     alignment and domain information
>COG0156 BioF 7-keto-8-aminopelargonate synthetase and related enzymes [Coenzyme metabolism] Back     alignment and domain information
>PRK03967 histidinol-phosphate aminotransferase; Provisional Back     alignment and domain information
>PRK06425 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>PRK15481 transcriptional regulatory protein PtsJ; Provisional Back     alignment and domain information
>COG0112 GlyA Glycine/serine hydroxymethyltransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07049 methionine gamma-lyase; Validated Back     alignment and domain information
>PLN02624 ornithine-delta-aminotransferase Back     alignment and domain information
>KOG3846|consensus Back     alignment and domain information
>PLN02955 8-amino-7-oxononanoate synthase Back     alignment and domain information
>PRK06702 O-acetylhomoserine aminocarboxypropyltransferase; Validated Back     alignment and domain information
>PRK07392 threonine-phosphate decarboxylase; Validated Back     alignment and domain information
>COG2008 GLY1 Threonine aldolase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05093 argD bifunctional N-succinyldiaminopimelate-aminotransferase/acetylornithine transaminase protein; Reviewed Back     alignment and domain information
>PLN02672 methionine S-methyltransferase Back     alignment and domain information
>PRK02936 argD acetylornithine aminotransferase; Provisional Back     alignment and domain information
>KOG0257|consensus Back     alignment and domain information
>PLN02607 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>PLN02376 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>TIGR03246 arg_catab_astC succinylornithine transaminase family Back     alignment and domain information
>PF01276 OKR_DC_1: Orn/Lys/Arg decarboxylase, major domain; InterPro: IPR000310 Pyridoxal-dependent decarboxylases are bacterial proteins acting on ornithine, lysine, arginine and related substrates [] Back     alignment and domain information
>PF00266 Aminotran_5: Aminotransferase class-V; InterPro: IPR000192 Aminotransferases share certain mechanistic features with other pyridoxal- phosphate dependent enzymes, such as the covalent binding of the pyridoxal- phosphate group to a lysine residue Back     alignment and domain information
>TIGR02407 ectoine_ectB diaminobutyrate--2-oxoglutarate aminotransferase Back     alignment and domain information
>PRK07865 N-succinyldiaminopimelate aminotransferase; Reviewed Back     alignment and domain information
>PRK12381 bifunctional succinylornithine transaminase/acetylornithine transaminase; Provisional Back     alignment and domain information
>PRK09147 succinyldiaminopimelate transaminase; Provisional Back     alignment and domain information
>COG1921 SelA Selenocysteine synthase [seryl-tRNASer selenium transferase] [Amino acid transport and metabolism] Back     alignment and domain information
>PRK09440 avtA valine--pyruvate transaminase; Provisional Back     alignment and domain information
>PRK04260 acetylornithine aminotransferase; Provisional Back     alignment and domain information
>PTZ00376 aspartate aminotransferase; Provisional Back     alignment and domain information
>PLN02368 alanine transaminase Back     alignment and domain information
>cd00617 Tnase_like Tryptophanase family (Tnase) Back     alignment and domain information
>TIGR03801 asp_4_decarbox aspartate 4-decarboxylase Back     alignment and domain information
>KOG2862|consensus Back     alignment and domain information
>PLN02409 serine--glyoxylate aminotransaminase Back     alignment and domain information
>PRK05964 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>TIGR03301 PhnW-AepZ 2-aminoethylphosphonate aminotransferase Back     alignment and domain information
>TIGR03811 tyr_de_CO2_Ent tyrosine decarboxylase, Enterococcus type Back     alignment and domain information
>PRK06058 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK06777 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK08360 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK09264 diaminobutyrate--2-oxoglutarate aminotransferase; Validated Back     alignment and domain information
>COG4992 ArgD Ornithine/acetylornithine aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02618 tyr_phenol_ly tyrosine phenol-lyase Back     alignment and domain information
>PRK09257 aromatic amino acid aminotransferase; Provisional Back     alignment and domain information
>PRK15029 arginine decarboxylase; Provisional Back     alignment and domain information
>PF01053 Cys_Met_Meta_PP: Cys/Met metabolism PLP-dependent enzyme; InterPro: IPR000277 Pyridoxal phosphate is the active form of vitamin B6 (pyridoxine or pyridoxal) Back     alignment and domain information
>PRK13479 2-aminoethylphosphonate--pyruvate transaminase; Provisional Back     alignment and domain information
>TIGR02326 transamin_PhnW 2-aminoethylphosphonate--pyruvate transaminase Back     alignment and domain information
>TIGR00713 hemL glutamate-1-semialdehyde-2,1-aminomutase Back     alignment and domain information
>PRK06855 aminotransferase; Validated Back     alignment and domain information
>PRK05839 hypothetical protein; Provisional Back     alignment and domain information
>PRK09792 4-aminobutyrate transaminase; Provisional Back     alignment and domain information
>COG2873 MET17 O-acetylhomoserine sulfhydrylase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03372 putres_am_tran putrescine aminotransferase Back     alignment and domain information
>PLN00144 acetylornithine transaminase Back     alignment and domain information
>PF03841 SelA: L-seryl-tRNA selenium transferase; InterPro: IPR018319 In prokaryotes, the incorporation of selenocysteine as the 21st amino acid, encoded by TGA, requires several elements: SelC is the tRNA itself, SelD acts as a donor of reduced selenium, SelA modifies a serine residue on SelC into selenocysteine, and SelB is a selenocysteine-specific translation elongation factor Back     alignment and domain information
>PLN02450 1-aminocyclopropane-1-carboxylate synthase Back     alignment and domain information
>KOG2467|consensus Back     alignment and domain information
>PRK05769 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK13237 tyrosine phenol-lyase; Provisional Back     alignment and domain information
>PRK09221 beta alanine--pyruvate transaminase; Provisional Back     alignment and domain information
>PRK11522 putrescine--2-oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>PRK03715 argD acetylornithine transaminase protein; Provisional Back     alignment and domain information
>PRK08117 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>COG0160 GabT 4-aminobutyrate aminotransferase and related aminotransferases [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0259|consensus Back     alignment and domain information
>COG1168 MalY Bifunctional PLP-dependent enzyme with beta-cystathionase and maltose regulon repressor activities [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02760 4-aminobutyrate:pyruvate transaminase Back     alignment and domain information
>PRK08354 putative aminotransferase; Provisional Back     alignment and domain information
>PRK13578 ornithine decarboxylase; Provisional Back     alignment and domain information
>PRK08593 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>KOG1368|consensus Back     alignment and domain information
>PRK04612 argD acetylornithine transaminase protein; Provisional Back     alignment and domain information
>TIGR00709 dat 2,4-diaminobutyrate 4-transaminases Back     alignment and domain information
>KOG1402|consensus Back     alignment and domain information
>PRK06917 hypothetical protein; Provisional Back     alignment and domain information
>PF01212 Beta_elim_lyase: Beta-eliminating lyase; InterPro: IPR001597 This domain is found in many tryptophanases (tryptophan indole-lyase, TNase), tyrosine phenol-lyases (TPL) and threonine aldolases Back     alignment and domain information
>PRK07678 aminotransferase; Validated Back     alignment and domain information
>PRK15399 lysine decarboxylase LdcC; Provisional Back     alignment and domain information
>PRK09275 aspartate aminotransferase; Provisional Back     alignment and domain information
>COG1167 ARO8 Transcriptional regulators containing a DNA-binding HTH domain and an aminotransferase domain (MocR family) and their eukaryotic orthologs [Transcription / Amino acid transport and metabolism] Back     alignment and domain information
>KOG1404|consensus Back     alignment and domain information
>KOG1360|consensus Back     alignment and domain information
>KOG1383|consensus Back     alignment and domain information
>PRK06918 4-aminobutyrate aminotransferase; Reviewed Back     alignment and domain information
>PLN02855 Bifunctional selenocysteine lyase/cysteine desulfurase Back     alignment and domain information
>PRK07495 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK07480 putative aminotransferase; Validated Back     alignment and domain information
>PF00202 Aminotran_3: Aminotransferase class-III; InterPro: IPR005814 Aminotransferases share certain mechanistic features with other pyridoxalphosphate-dependent enzymes, such as the covalent binding of the pyridoxalphosphate group to a lysine residue Back     alignment and domain information
>PRK05639 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK15400 lysine decarboxylase CadA; Provisional Back     alignment and domain information
>PRK06062 hypothetical protein; Provisional Back     alignment and domain information
>PLN02651 cysteine desulfurase Back     alignment and domain information
>COG0520 csdA Selenocysteine lyase/Cysteine desulfurase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd06453 SufS_like Cysteine desulfurase (SufS)-like Back     alignment and domain information
>PRK09295 bifunctional cysteine desulfurase/selenocysteine lyase; Validated Back     alignment and domain information
>KOG1359|consensus Back     alignment and domain information
>TIGR03235 DNA_S_dndA cysteine desulfurase DndA Back     alignment and domain information
>TIGR01979 sufS cysteine desulfurases, SufS subfamily Back     alignment and domain information
>PRK12389 glutamate-1-semialdehyde aminotransferase; Provisional Back     alignment and domain information
>PRK07481 hypothetical protein; Provisional Back     alignment and domain information
>PRK06105 aminotransferase; Provisional Back     alignment and domain information
>PRK07030 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>KOG1357|consensus Back     alignment and domain information
>cd06451 AGAT_like Alanine-glyoxylate aminotransferase (AGAT) family Back     alignment and domain information
>PLN02397 aspartate transaminase Back     alignment and domain information
>KOG0053|consensus Back     alignment and domain information
>PRK06541 hypothetical protein; Provisional Back     alignment and domain information
>PF02347 GDC-P: Glycine cleavage system P-protein; InterPro: IPR020580 This family consists of glycine cleavage system P-proteins (1 Back     alignment and domain information
>PLN02482 glutamate-1-semialdehyde 2,1-aminomutase Back     alignment and domain information
>PRK05965 hypothetical protein; Provisional Back     alignment and domain information
>PRK08637 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01977 am_tr_V_EF2568 cysteine desulfurase family protein Back     alignment and domain information
>PRK12403 putative aminotransferase; Provisional Back     alignment and domain information
>TIGR03392 FeS_syn_CsdA cysteine desulfurase, catalytic subunit CsdA Back     alignment and domain information
>COG1448 TyrB Aspartate/tyrosine/aromatic aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07482 hypothetical protein; Provisional Back     alignment and domain information
>PRK13360 omega amino acid--pyruvate transaminase; Provisional Back     alignment and domain information
>TIGR00700 GABAtrnsam 4-aminobutyrate aminotransferase, prokaryotic type Back     alignment and domain information
>PRK10874 cysteine sulfinate desulfinase; Provisional Back     alignment and domain information
>PRK06943 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>TIGR02006 IscS cysteine desulfurase IscS Back     alignment and domain information
>PRK06082 4-aminobutyrate aminotransferase; Provisional Back     alignment and domain information
>PRK07046 aminotransferase; Validated Back     alignment and domain information
>KOG0256|consensus Back     alignment and domain information
>PRK06916 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK04013 argD acetylornithine/acetyl-lysine aminotransferase; Provisional Back     alignment and domain information
>KOG0629|consensus Back     alignment and domain information
>TIGR01976 am_tr_V_VC1184 cysteine desulfurase family protein, VC1184 subfamily Back     alignment and domain information
>TIGR03403 nifS_epsilon cysteine desulfurase, NifS family, epsilon proteobacteria type Back     alignment and domain information
>KOG1401|consensus Back     alignment and domain information
>COG0626 MetC Cystathionine beta-lyases/cystathionine gamma-synthases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08088 4-aminobutyrate aminotransferase; Validated Back     alignment and domain information
>PRK06149 hypothetical protein; Provisional Back     alignment and domain information
>COG0001 HemL Glutamate-1-semialdehyde aminotransferase [Coenzyme metabolism] Back     alignment and domain information
>PRK06173 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>PRK06938 diaminobutyrate--2-oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>PRK02948 cysteine desulfurase; Provisional Back     alignment and domain information
>TIGR03251 LAT_fam L-lysine 6-transaminase Back     alignment and domain information
>TIGR01814 kynureninase kynureninase Back     alignment and domain information
>TIGR01140 L_thr_O3P_dcar L-threonine-O-3-phosphate decarboxylase Back     alignment and domain information
>TIGR00508 bioA adenosylmethionine-8-amino-7-oxononanoate transaminase Back     alignment and domain information
>PRK05630 adenosylmethionine--8-amino-7-oxononanoate transaminase; Provisional Back     alignment and domain information
>COG0161 BioA Adenosylmethionine-8-amino-7-oxononanoate aminotransferase [Coenzyme metabolism] Back     alignment and domain information
>TIGR03402 FeS_nifS cysteine desulfurase NifS Back     alignment and domain information
>PRK02769 histidine decarboxylase; Provisional Back     alignment and domain information
>COG1982 LdcC Arginine/lysine/ornithine decarboxylases [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08361 aspartate aminotransferase; Provisional Back     alignment and domain information
>PRK07036 hypothetical protein; Provisional Back     alignment and domain information
>PRK00062 glutamate-1-semialdehyde aminotransferase; Provisional Back     alignment and domain information
>PRK00950 histidinol-phosphate aminotransferase; Validated Back     alignment and domain information
>KOG2142|consensus Back     alignment and domain information
>PRK07777 aminotransferase; Validated Back     alignment and domain information
>PRK06148 hypothetical protein; Provisional Back     alignment and domain information
>PRK00615 glutamate-1-semialdehyde aminotransferase; Provisional Back     alignment and domain information
>PLN02724 Molybdenum cofactor sulfurase Back     alignment and domain information
>PLN03226 serine hydroxymethyltransferase; Provisional Back     alignment and domain information
>PRK06931 diaminobutyrate--2-oxoglutarate aminotransferase; Provisional Back     alignment and domain information
>PRK12566 glycine dehydrogenase; Provisional Back     alignment and domain information
>COG0403 GcvP Glycine cleavage system protein P (pyridoxal-binding), N-terminal domain [Amino acid transport and metabolism] Back     alignment and domain information
>PRK08088 4-aminobutyrate aminotransferase; Validated Back     alignment and domain information
>PRK09276 LL-diaminopimelate aminotransferase; Provisional Back     alignment and domain information
>PRK06209 glutamate-1-semialdehyde 2,1-aminomutase; Provisional Back     alignment and domain information
>PRK14012 cysteine desulfurase; Provisional Back     alignment and domain information
>PRK07483 hypothetical protein; Provisional Back     alignment and domain information
>COG3977 Alanine-alpha-ketoisovalerate (or valine-pyruvate) aminotransferase [Amino acid transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query621
3e77_A377 Human Phosphoserine Aminotransferase In Complex Wit 3e-82
3e77_A377 Human Phosphoserine Aminotransferase In Complex Wit 4e-42
1bjo_A360 The Structure Of Phosphoserine Aminotransferase Fro 5e-61
1bjo_A360 The Structure Of Phosphoserine Aminotransferase Fro 2e-38
3qm2_A386 2.25 Angstrom Crystal Structure Of Phosphoserine Am 1e-60
3qm2_A386 2.25 Angstrom Crystal Structure Of Phosphoserine Am 7e-38
3qbo_A364 Crystal Structure Of Phosphoserine Aminotransferase 1e-60
3qbo_A364 Crystal Structure Of Phosphoserine Aminotransferase 5e-40
1bjn_A360 Structure Of Phosphoserine Aminotransferase From Es 2e-60
1bjn_A360 Structure Of Phosphoserine Aminotransferase From Es 8e-38
1bt4_A362 Phosphoserine Aminotransferase From Bacillus Circul 5e-60
1bt4_A362 Phosphoserine Aminotransferase From Bacillus Circul 7e-35
2bie_A361 Radiation Damage Of The Schiff Base In Phosphoserin 2e-56
2bie_A361 Radiation Damage Of The Schiff Base In Phosphoserin 2e-32
1w23_A360 Crystal Structure Of Phosphoserine Aminotransferase 2e-56
1w23_A360 Crystal Structure Of Phosphoserine Aminotransferase 2e-32
3m5u_A361 Crystal Structure Of Phosphoserine Aminotransferase 9e-38
3m5u_A361 Crystal Structure Of Phosphoserine Aminotransferase 1e-28
2fyf_A398 Structure Of A Putative Phosphoserine Aminotransfer 7e-05
2dr1_A386 Crystal Structure Of The Ph1308 Protein From Pyroco 8e-04
>pdb|3E77|A Chain A, Human Phosphoserine Aminotransferase In Complex With Plp Length = 377 Back     alignment and structure

Iteration: 1

Score = 302 bits (774), Expect = 3e-82, Method: Compositional matrix adjust. Identities = 162/371 (43%), Positives = 210/371 (56%), Gaps = 85/371 (22%) Query: 62 LPREVLEEVKETLLDYESTGISVMEMSHRSADYTKINNDTQAALRELLNVPNNYKILFLQ 121 LP VL E+++ LLDY+ GISV+EMSHRS+D+ KI N+T+ +RELL VP+ Sbjct: 24 LPHSVLLEIQKELLDYKGVGISVLEMSHRSSDFAKIINNTENLVRELLAVPD-------- 75 Query: 122 GGGTGMFAAVAMNLISSSMNVPNNYKILFLQGGGTGMFAAVAMNLIG-RTGKADYVVTGS 180 NYK++FLQGGG G F+AV +NLIG + G+ Sbjct: 76 -----------------------NYKVIFLQGGGCGQFSAVPLNLIGLKAGR-------- 104 Query: 181 WSXXXXXXXXXYGKVNLVIPKVSKYVSIPDQSTWNRDPEASYLYYCDNETVDGSWSXXXX 240 C + V G+WS Sbjct: 105 ---------------------------------------------CADYVVTGAWSAKAA 119 Query: 241 XXXXXYGKVNLVIPKVSKYVSIPDQSTWNRDPEASYLYYCDNETVDGVEFNYIPDSQGIP 300 +G +N+V PK+ Y IPD STWN +P+ASY+YYC NETV GVEF++IPD +G Sbjct: 120 EEAKKFGTINIVHPKLGSYTKIPDPSTWNLNPDASYVYYCANETVHGVEFDFIPDVKGAV 179 Query: 301 LVSDMSSNFLSRKFDVSKFGVIIAGAQKNIGPAGITVVIVREDLLEYALPITPTVFHFKI 360 LV DMSSNFLS+ DVSKFGVI AGAQKN+G AG+TVVIVR+DLL +AL P+V +K+ Sbjct: 180 LVCDMSSNFLSKPVDVSKFGVIFAGAQKNVGSAGVTVVIVRDDLLGFALRECPSVLEYKV 239 Query: 361 NADNNSVYNTPPTFVVHVIQRVFAWIKRQGGLAKMEQNSLQKSVLLYQEIDNSDKFYECP 420 A N+S+YNTPP F ++V+ V WIK GG A ME+ S KS +Y+ IDNS FY CP Sbjct: 240 QAGNSSLYNTPPCFSIYVMGLVLEWIKNNGGAAAMEKLSSIKSQTIYEIIDNSQGFYVCP 299 Query: 421 VQAGCRSRMNV 431 V+ RS+MN+ Sbjct: 300 VEPQNRSKMNI 310
>pdb|3E77|A Chain A, Human Phosphoserine Aminotransferase In Complex With Plp Length = 377 Back     alignment and structure
>pdb|1BJO|A Chain A, The Structure Of Phosphoserine Aminotransferase From E. Coli In Complex With Alpha-Methyl-L-Glutamate Length = 360 Back     alignment and structure
>pdb|1BJO|A Chain A, The Structure Of Phosphoserine Aminotransferase From E. Coli In Complex With Alpha-Methyl-L-Glutamate Length = 360 Back     alignment and structure
>pdb|3QM2|A Chain A, 2.25 Angstrom Crystal Structure Of Phosphoserine Aminotransferase (Serc) From Salmonella Enterica Subsp. Enterica Serovar Typhimurium Length = 386 Back     alignment and structure
>pdb|3QM2|A Chain A, 2.25 Angstrom Crystal Structure Of Phosphoserine Aminotransferase (Serc) From Salmonella Enterica Subsp. Enterica Serovar Typhimurium Length = 386 Back     alignment and structure
>pdb|3QBO|A Chain A, Crystal Structure Of Phosphoserine Aminotransferase From Yersinia Pestis Co92 Length = 364 Back     alignment and structure
>pdb|3QBO|A Chain A, Crystal Structure Of Phosphoserine Aminotransferase From Yersinia Pestis Co92 Length = 364 Back     alignment and structure
>pdb|1BJN|A Chain A, Structure Of Phosphoserine Aminotransferase From Escherichia Coli Length = 360 Back     alignment and structure
>pdb|1BJN|A Chain A, Structure Of Phosphoserine Aminotransferase From Escherichia Coli Length = 360 Back     alignment and structure
>pdb|1BT4|A Chain A, Phosphoserine Aminotransferase From Bacillus Circulans Subsp. Alkalophilus Length = 362 Back     alignment and structure
>pdb|1BT4|A Chain A, Phosphoserine Aminotransferase From Bacillus Circulans Subsp. Alkalophilus Length = 362 Back     alignment and structure
>pdb|2BIE|A Chain A, Radiation Damage Of The Schiff Base In Phosphoserine Aminotransferase (Structure H) Length = 361 Back     alignment and structure
>pdb|2BIE|A Chain A, Radiation Damage Of The Schiff Base In Phosphoserine Aminotransferase (Structure H) Length = 361 Back     alignment and structure
>pdb|1W23|A Chain A, Crystal Structure Of Phosphoserine Aminotransferase From Bacillus Alcalophilus Length = 360 Back     alignment and structure
>pdb|1W23|A Chain A, Crystal Structure Of Phosphoserine Aminotransferase From Bacillus Alcalophilus Length = 360 Back     alignment and structure
>pdb|3M5U|A Chain A, Crystal Structure Of Phosphoserine Aminotransferase From Campylobacter Jejuni Length = 361 Back     alignment and structure
>pdb|3M5U|A Chain A, Crystal Structure Of Phosphoserine Aminotransferase From Campylobacter Jejuni Length = 361 Back     alignment and structure
>pdb|2FYF|A Chain A, Structure Of A Putative Phosphoserine Aminotransferase From Mycobacterium Tuberculosis Length = 398 Back     alignment and structure
>pdb|2DR1|A Chain A, Crystal Structure Of The Ph1308 Protein From Pyrococcus Horikoshii Ot3 Length = 386 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query621
1w23_A360 Phosphoserine aminotransferase; pyridoxal-5'-phosp 1e-164
1w23_A360 Phosphoserine aminotransferase; pyridoxal-5'-phosp 1e-80
2c0r_A362 PSAT, phosphoserine aminotransferase; pyridoxal-5' 1e-164
2c0r_A362 PSAT, phosphoserine aminotransferase; pyridoxal-5' 2e-81
3qm2_A386 Phosphoserine aminotransferase; structural genomic 1e-161
3qm2_A386 Phosphoserine aminotransferase; structural genomic 4e-80
3e77_A377 Phosphoserine aminotransferase; SERC, PLP, structu 1e-158
3e77_A377 Phosphoserine aminotransferase; SERC, PLP, structu 1e-81
3m5u_A361 Phosphoserine aminotransferase; alpha-beta half sa 1e-156
3m5u_A361 Phosphoserine aminotransferase; alpha-beta half sa 4e-80
2fyf_A398 PSAT, phosphoserine aminotransferase; PLP-dependen 1e-111
2fyf_A398 PSAT, phosphoserine aminotransferase; PLP-dependen 2e-52
3ffr_A362 Phosphoserine aminotransferase SERC; structural ge 1e-107
3ffr_A362 Phosphoserine aminotransferase SERC; structural ge 4e-49
3f0h_A376 Aminotransferase; RER070207000802, structural geno 8e-11
1m32_A366 2-aminoethylphosphonate-pyruvate aminotransferase; 8e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
2yrr_A353 Aminotransferase, class V; structural genomics, NP 7e-05
3zrp_A384 Serine-pyruvate aminotransferase (AGXT); HET: PLP; 2e-04
2dr1_A386 PH1308 protein, 386AA long hypothetical serine ami 4e-04
3ke3_A379 Putative serine-pyruvate aminotransferase; structu 4e-04
>1w23_A Phosphoserine aminotransferase; pyridoxal-5'-phosphate; HET: PGE PLP EPE; 1.08A {Bacillus alcalophilus} SCOP: c.67.1.4 PDB: 2bhx_A* 2bi1_A* 2bi2_A* 2bi3_A* 2bi5_A* 2bi9_A* 2bia_A* 2bie_A* 2big_A* Length = 360 Back     alignment and structure
 Score =  472 bits (1218), Expect = e-164
 Identities = 129/386 (33%), Positives = 196/386 (50%), Gaps = 86/386 (22%)

Query: 52  VINFGAGPAKLPREVLEEVKETLLDYESTGISVMEMSHRSADYTKINNDTQAALRELLNV 111
           V NF AGP+ LP+  LE  ++ LL++  T +SVME+SHRS  Y +++   Q  LREL   
Sbjct: 4   VFNFNAGPSALPKPALERAQKELLNFNDTQMSVMELSHRSQSYEEVHEQAQNLLREL--- 60

Query: 112 PNNYKILFLQGGGTGMFAAVAMNLISSSMNVPNNYKILFLQGGGTGMFAAVAMNLIGRTG 171
                                       + +PN+Y+ILFLQGG +  F  + MNL+ +  
Sbjct: 61  ----------------------------LQIPNDYQILFLQGGASLQFTMLPMNLLTKGT 92

Query: 172 KADYVVTGSWSKKAAAEAEKYGKVNLVIPKVSKYVSIPDQSTWNRDPEASYLYYCDNETV 231
             +YV+TGSWS+KA  EA+  G+ ++                                  
Sbjct: 93  IGNYVLTGSWSEKALKEAKLLGETHIA--------------------------------- 119

Query: 232 DGSWSKKAAAEAEKYGKVNLVIPKVSKYVSIPDQSTWNRDPEASYLYYCDNETVDGVEFN 291
               S KA                 + Y SIPD S +  +   +YL+   N T+ G ++ 
Sbjct: 120 ---ASTKA-----------------NSYQSIPDFSEFQLNENDAYLHITSNNTIYGTQYQ 159

Query: 292 YIPDSQGIPLVSDMSSNFLSRKFDVSKFGVIIAGAQKNIGPAGITVVIVREDLLEYALPI 351
             P+    PL++DMSS+ LSR   V++FG+I AGAQKN+GP+G+TVVIV++DLL   +  
Sbjct: 160 NFPEINHAPLIADMSSDILSRPLKVNQFGMIYAGAQKNLGPSGVTVVIVKKDLLNTKVEQ 219

Query: 352 TPTVFHFKINADNNSVYNTPPTFVVHVIQRVFAWIKRQGGLAKMEQNSLQKSVLLYQEID 411
            PT+  +  +  ++S+YNTPPTF +++++ V  WIK  GG   + + + +K+ ++Y  ID
Sbjct: 220 VPTMLQYATHIKSDSLYNTPPTFSIYMLRNVLDWIKDLGGAEAIAKQNEEKAKIIYDTID 279

Query: 412 NSDKFYECPVQAGCRSRMNVTDIFFT 437
            S+ FY    + G RS MNVT  F  
Sbjct: 280 ESNGFYVGHAEKGSRSLMNVT--FNL 303


>1w23_A Phosphoserine aminotransferase; pyridoxal-5'-phosphate; HET: PGE PLP EPE; 1.08A {Bacillus alcalophilus} SCOP: c.67.1.4 PDB: 2bhx_A* 2bi1_A* 2bi2_A* 2bi3_A* 2bi5_A* 2bi9_A* 2bia_A* 2bie_A* 2big_A* Length = 360 Back     alignment and structure
>2c0r_A PSAT, phosphoserine aminotransferase; pyridoxal-5'-phosphate, pyridine serine biosynthesis, amino-acid biosynthesis, pyridoxal phosphate; HET: PLP; 1.2A {Bacillus circulans} SCOP: c.67.1.4 PDB: 1bt4_A* 1w3u_A* Length = 362 Back     alignment and structure
>2c0r_A PSAT, phosphoserine aminotransferase; pyridoxal-5'-phosphate, pyridine serine biosynthesis, amino-acid biosynthesis, pyridoxal phosphate; HET: PLP; 1.2A {Bacillus circulans} SCOP: c.67.1.4 PDB: 1bt4_A* 1w3u_A* Length = 362 Back     alignment and structure
>3qm2_A Phosphoserine aminotransferase; structural genomics, center for structural genomics of infec diseases, csgid; 2.25A {Salmonella enterica subsp} PDB: 1bjn_A* 1bjo_A* 3qbo_A* Length = 386 Back     alignment and structure
>3qm2_A Phosphoserine aminotransferase; structural genomics, center for structural genomics of infec diseases, csgid; 2.25A {Salmonella enterica subsp} PDB: 1bjn_A* 1bjo_A* 3qbo_A* Length = 386 Back     alignment and structure
>3e77_A Phosphoserine aminotransferase; SERC, PLP, structural genomi structural genomics consortium, SGC, amino-acid biosynthesi aminotransferase; HET: PLP; 2.50A {Homo sapiens} Length = 377 Back     alignment and structure
>3e77_A Phosphoserine aminotransferase; SERC, PLP, structural genomi structural genomics consortium, SGC, amino-acid biosynthesi aminotransferase; HET: PLP; 2.50A {Homo sapiens} Length = 377 Back     alignment and structure
>3m5u_A Phosphoserine aminotransferase; alpha-beta half sandwich, csgid, amino-acid biosynthesis, cytoplasm, pyridoxal phosphate; HET: MES; 2.15A {Campylobacter jejuni} Length = 361 Back     alignment and structure
>3m5u_A Phosphoserine aminotransferase; alpha-beta half sandwich, csgid, amino-acid biosynthesis, cytoplasm, pyridoxal phosphate; HET: MES; 2.15A {Campylobacter jejuni} Length = 361 Back     alignment and structure
>2fyf_A PSAT, phosphoserine aminotransferase; PLP-dependent enzyme, dimer, structural genomics; HET: PLP; 1.50A {Mycobacterium tuberculosis} PDB: 3vom_A* Length = 398 Back     alignment and structure
>2fyf_A PSAT, phosphoserine aminotransferase; PLP-dependent enzyme, dimer, structural genomics; HET: PLP; 1.50A {Mycobacterium tuberculosis} PDB: 3vom_A* Length = 398 Back     alignment and structure
>3ffr_A Phosphoserine aminotransferase SERC; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: LLP MSE P33; 1.75A {Cytophaga hutchinsonii atcc 33406} Length = 362 Back     alignment and structure
>3ffr_A Phosphoserine aminotransferase SERC; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: LLP MSE P33; 1.75A {Cytophaga hutchinsonii atcc 33406} Length = 362 Back     alignment and structure
>3f0h_A Aminotransferase; RER070207000802, structural genomics, JOIN for structural genomics, JCSG; HET: MSE LLP; 1.70A {Eubacterium rectale} Length = 376 Back     alignment and structure
>1m32_A 2-aminoethylphosphonate-pyruvate aminotransferase; PLP-dependent aminotransferase fold; HET: PLP; 2.20A {Salmonella typhimurium} SCOP: c.67.1.3 Length = 366 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2yrr_A Aminotransferase, class V; structural genomics, NPPSFA, national PROJ protein structural and functional analyses; HET: PLP; 1.86A {Thermus thermophilus} PDB: 2yri_A* Length = 353 Back     alignment and structure
>3zrp_A Serine-pyruvate aminotransferase (AGXT); HET: PLP; 1.75A {Sulfolobus solfataricus} PDB: 3zrq_A* 3zrr_A* Length = 384 Back     alignment and structure
>2dr1_A PH1308 protein, 386AA long hypothetical serine aminotransferase; PLP, structural genomics, NPPSFA; HET: PLP; 1.90A {Pyrococcus horikoshii} Length = 386 Back     alignment and structure
>3ke3_A Putative serine-pyruvate aminotransferase; structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: LLP; 2.20A {Psychrobacter arcticus 273-4} Length = 379 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query621
3e77_A377 Phosphoserine aminotransferase; SERC, PLP, structu 100.0
3m5u_A361 Phosphoserine aminotransferase; alpha-beta half sa 100.0
3qm2_A386 Phosphoserine aminotransferase; structural genomic 100.0
2c0r_A362 PSAT, phosphoserine aminotransferase; pyridoxal-5' 100.0
1w23_A360 Phosphoserine aminotransferase; pyridoxal-5'-phosp 100.0
3ffr_A362 Phosphoserine aminotransferase SERC; structural ge 100.0
2fyf_A398 PSAT, phosphoserine aminotransferase; PLP-dependen 99.97
3f0h_A376 Aminotransferase; RER070207000802, structural geno 99.97
3kgw_A393 Alanine-glyoxylate aminotransferase; AAH25799.1, p 99.95
3zrp_A384 Serine-pyruvate aminotransferase (AGXT); HET: PLP; 99.95
2z9v_A392 Aspartate aminotransferase; pyridoxamine, pyruvate 99.95
3nnk_A411 Ureidoglycine-glyoxylate aminotransferase; PLP-dep 99.95
2huf_A393 Alanine glyoxylate aminotransferase; alpha and bet 99.95
1iug_A352 Putative aspartate aminotransferase; wild type, py 99.95
3isl_A416 Purine catabolism protein PUCG; pyridoxalphosphate 99.94
3ke3_A379 Putative serine-pyruvate aminotransferase; structu 99.94
2ch1_A396 3-hydroxykynurenine transaminase; PLP-enzyme, kynu 99.94
2dr1_A386 PH1308 protein, 386AA long hypothetical serine ami 99.94
2bkw_A385 Alanine-glyoxylate aminotransferase 1; analine-gly 99.94
2yrr_A353 Aminotransferase, class V; structural genomics, NP 99.94
1m32_A366 2-aminoethylphosphonate-pyruvate aminotransferase; 99.93
4hvk_A382 Probable cysteine desulfurase 2; transferase and I 99.92
1vjo_A393 Alanine--glyoxylate aminotransferase; 17130350, AL 99.92
3cai_A406 Possible aminotransferase; RV3778C; 1.80A {Mycobac 99.91
1kmj_A406 Selenocysteine lyase; persulfide perselenide NIFS 99.91
1elu_A390 L-cysteine/L-cystine C-S lyase; FES cluster biosyn 99.91
4eb5_A382 Probable cysteine desulfurase 2; scaffold, transfe 99.91
1t3i_A420 Probable cysteine desulfurase; PLP-binding enzyme, 99.91
1qz9_A416 Kynureninase; kynurenine, tryptophan, PLP, vitamin 99.89
1eg5_A384 Aminotransferase; PLP-dependent enzymes, iron-sulf 99.89
3lvm_A423 Cysteine desulfurase; structural genomics, montrea 99.88
3e9k_A465 Kynureninase; kynurenine-L-hydrolase, kynurenine h 99.88
3vax_A400 Putative uncharacterized protein DNDA; desulfurase 99.88
3a9z_A432 Selenocysteine lyase; PLP, cytoplasm, pyridoxal ph 99.85
3f9t_A397 TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L 99.78
2e7j_A371 SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-st 99.77
1wyu_A438 Glycine dehydrogenase (decarboxylating) subunit 1; 99.75
2dgk_A452 GAD-beta, GADB, glutamate decarboxylase beta; gadb 99.72
3hbx_A502 GAD 1, glutamate decarboxylase 1; calmodulin-bindi 99.71
2fnu_A375 Aminotransferase; protein-product complex, structu 99.7
3ffh_A363 Histidinol-phosphate aminotransferase; APC88260, l 99.7
2qma_A497 Diaminobutyrate-pyruvate transaminase and L-2,4- d 99.65
3mc6_A497 Sphingosine-1-phosphate lyase; carboxy-lyase activ 99.65
1rv3_A483 Serine hydroxymethyltransferase, cytosolic; one-ca 99.64
2jis_A515 Cysteine sulfinic acid decarboxylase; pyridoxal ph 99.63
1svv_A359 Threonine aldolase; structural genomics, structura 99.63
3get_A365 Histidinol-phosphate aminotransferase; NP_281508.1 99.63
3ly1_A354 Putative histidinol-phosphate aminotransferase; st 99.63
3euc_A367 Histidinol-phosphate aminotransferase 2; YP_297314 99.62
2z67_A456 O-phosphoseryl-tRNA(SEC) selenium transferase; sel 99.61
3hdo_A360 Histidinol-phosphate aminotransferase; PSI-II, his 99.61
3mad_A514 Sphingosine-1-phosphate lyase; carboxy-lyase activ 99.61
4e1o_A481 HDC, histidine decarboxylase; lyase; HET: PLP PVH; 99.6
3dyd_A427 Tyrosine aminotransferase; PLP, SGC, structural ge 99.6
3g0t_A437 Putative aminotransferase; NP_905498.1, putative a 99.6
3b8x_A390 WBDK, pyridoxamine 5-phosphate-dependent dehydrase 99.59
3uwc_A374 Nucleotide-sugar aminotransferase; lipopolysacchar 99.59
2okj_A504 Glutamate decarboxylase 1; PLP-dependent decarboxy 99.59
3frk_A373 QDTB; aminotransferase, sugar-modification, natura 99.59
1gd9_A389 Aspartate aminotransferase; pyridoxal enzyme, temp 99.59
1fc4_A401 2-amino-3-ketobutyrate conenzyme A ligase; 2-amino 99.59
3vp6_A511 Glutamate decarboxylase 1; catalytic loop SWAP, ly 99.59
2a7v_A490 Serine hydroxymethyltransferase; structural genomi 99.59
2w8t_A427 SPT, serine palmitoyltransferase; HET: LLP; 1.25A 99.58
3kax_A383 Aminotransferase, classes I and II; PLP, C-S lyase 99.58
3dr4_A391 Putative perosamine synthetase; deoxysugar, pyrido 99.58
3dzz_A391 Putative pyridoxal 5'-phosphate-dependent C-S LYA; 99.58
2vi8_A405 Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, 99.58
4dq6_A391 Putative pyridoxal phosphate-dependent transferas; 99.57
3h14_A391 Aminotransferase, classes I and II; YP_167802.1, S 99.57
3nyt_A367 Aminotransferase WBPE; PLP binding, nucleotide-sug 99.57
2oga_A399 Transaminase; PLP-dependent enzyme, desosamine, de 99.56
3k40_A475 Aromatic-L-amino-acid decarboxylase; PLP dependent 99.56
3p1t_A337 Putative histidinol-phosphate aminotransferase; PL 99.56
1js3_A486 DDC;, DOPA decarboxylase; carbidopa, parkinson'S d 99.56
1v2d_A381 Glutamine aminotransferase; PLP, riken structural 99.56
3a2b_A398 Serine palmitoyltransferase; vitamin B6-dependent 99.56
1bs0_A384 Protein (8-amino-7-oxonanoate synthase); PLP-depen 99.55
3tqx_A399 2-amino-3-ketobutyrate coenzyme A ligase; energy m 99.54
1o69_A394 Aminotransferase; structural genomics, unknown fun 99.54
1wyu_B474 Glycine dehydrogenase subunit 2 (P-protein); alpha 99.54
3nra_A407 Aspartate aminotransferase; structural genomics, j 99.53
1lc5_A364 COBD, L-threonine-O-3-phosphate decarboxylase; PLP 99.53
1b9h_A388 AHBA synthase, protein (3-amino-5-hydroxybenzoic a 99.53
1bw0_A416 TAT, protein (tyrosine aminotransferase); tyrosine 99.51
3fdb_A377 Beta C-S lyase, putative PLP-dependent beta-cystat 99.51
1v72_A356 Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2 99.51
3n0l_A417 Serine hydroxymethyltransferase; alpha beta class, 99.5
2dkj_A407 Serine hydroxymethyltransferase; PLP dependent enz 99.5
2x5d_A412 Probable aminotransferase; HET: LLP PLP; 2.25A {Ps 99.49
1j32_A388 Aspartate aminotransferase; HET: PLP; 2.10A {Phorm 99.49
3e77_A377 Phosphoserine aminotransferase; SERC, PLP, structu 99.49
1pff_A331 Methionine gamma-lyase; homocysteine; 2.50A {Trich 99.48
2c81_A418 Glutamine-2-deoxy-scyllo-inosose aminotransferase; 99.48
3ecd_A425 Serine hydroxymethyltransferase 2; ssgcid, decode, 99.48
1b5p_A385 Protein (aspartate aminotransferase); pyridoxal en 99.48
3asa_A400 LL-diaminopimelate aminotransferase; PLP dependent 99.48
1mdo_A393 ARNB aminotransferase; type 1 aminotransferase fol 99.47
3l8a_A421 METC, putative aminotransferase, probable beta-cys 99.47
3fkd_A350 L-threonine-O-3-phosphate decarboxylase; structura 99.47
1u08_A386 Hypothetical aminotransferase YBDL; alpha beta pro 99.47
3cq5_A369 Histidinol-phosphate aminotransferase; PLP, PMP, a 99.46
3ftb_A361 Histidinol-phosphate aminotransferase; structural 99.46
2bwn_A401 5-aminolevulinate synthase; tetrapyrrole biosynthe 99.46
2z61_A370 Probable aspartate aminotransferase 2; amino acid 99.45
1o4s_A389 Aspartate aminotransferase; TM1255, structural gen 99.45
1xi9_A406 Putative transaminase; alanine aminotransferase, s 99.45
2o0r_A411 RV0858C (N-succinyldiaminopimelate aminotransfera; 99.44
3h7f_A447 Serine hydroxymethyltransferase 1; cytoplasm, one- 99.44
3qgu_A449 LL-diaminopimelate aminotransferase; L-lysine, pyr 99.44
3op7_A375 Aminotransferase class I and II; PLP-dependent tra 99.43
1c7n_A399 Cystalysin; transferase, aminotransferase, pyridox 99.43
2gb3_A409 Aspartate aminotransferase; TM1698, structural gen 99.41
2dou_A376 Probable N-succinyldiaminopimelate aminotransfera; 99.41
3gbx_A420 Serine hydroxymethyltransferase; structural genomi 99.41
1fg7_A356 Histidinol phosphate aminotransferase; HISC, histi 99.4
3fvs_A422 Kynurenine--oxoglutarate transaminase 1; alpha bet 99.4
3e2y_A410 Kynurenine-oxoglutarate transaminase 3; alpha beta 99.4
3ele_A398 Amino transferase; RER070207001803, structural gen 99.4
2eh6_A375 Acoat, acetylornithine aminotransferase; ARGD, str 99.38
3m5u_A361 Phosphoserine aminotransferase; alpha-beta half sa 99.38
1yiz_A429 Kynurenine aminotransferase; glutamine transaminas 99.37
3ezs_A376 Aminotransferase ASPB; NP_207418.1, structural gen 99.36
2zyj_A397 Alpha-aminodipate aminotransferase; alpha-aminoadi 99.36
3bb8_A437 CDP-4-keto-6-deoxy-D-glucose-3-dehydrase; aspartat 99.35
2x3l_A446 ORN/Lys/Arg decarboxylase family protein; lyase; H 99.35
1uu1_A335 Histidinol-phosphate aminotransferase; histidine b 99.34
3jtx_A396 Aminotransferase; NP_283882.1, structural genomics 99.34
1c4k_A730 Protein (ornithine decarboxylase); lyase; HET: PLP 99.34
3ei9_A432 LL-diaminopimelate aminotransferase; lysine biosyn 99.34
3ju7_A377 Putative PLP-dependent aminotransferase; NP_978343 99.34
1d2f_A390 MALY protein; aminotransferase fold, large PLP-bin 99.33
2o1b_A404 Aminotransferase, class I; aminotrasferase; HET: P 99.33
1vef_A395 Acetylornithine/acetyl-lysine aminotransferase; PL 99.33
2vyc_A755 Biodegradative arginine decarboxylase; pyridoxal p 99.33
2ay1_A394 Aroat, aromatic amino acid aminotransferase; HET: 99.32
2po3_A424 4-dehydrase; external aldimine, PLP, aminotransfer 99.32
1gc0_A398 Methionine gamma-lyase; pyridoxal-5'-phosphate; HE 99.31
1vp4_A425 Aminotransferase, putative; structural genomics, j 99.31
3qm2_A386 Phosphoserine aminotransferase; structural genomic 99.31
3ruy_A392 Ornithine aminotransferase; structural genomics, c 99.31
3kki_A409 CAI-1 autoinducer synthase; quorum sensing, CQSA, 99.3
3aow_A448 Putative uncharacterized protein PH0207; protein-P 99.3
2zc0_A407 Alanine glyoxylate transaminase; alanine:glyoxylat 99.29
1cs1_A386 CGS, protein (cystathionine gamma-synthase); lyase 99.29
2fq6_A415 Cystathionine beta-lyase; protein-inhibitor comple 99.27
1jg8_A347 L-ALLO-threonine aldolase; glycine biosynthesis, p 99.24
3b46_A447 Aminotransferase BNA3; kynurenine aminotransferase 99.21
3rq1_A418 Aminotransferase class I and II; structural genomi 99.2
2r2n_A425 Kynurenine/alpha-aminoadipate aminotransferase mit 99.2
2rfv_A398 Methionine gamma-lyase; pyridoxal-5'-phosphate, PL 99.18
2cb1_A412 O-acetyl homoserine sulfhydrylase; PLP enzyme, lya 99.18
1ajs_A412 Aspartate aminotransferase; PIG, in the presence o 99.17
4adb_A406 Succinylornithine transaminase; transferase, PLP e 99.17
2x5f_A430 Aspartate_tyrosine_phenylalanine pyridoxal-5' phos 99.17
1qgn_A445 Protein (cystathionine gamma-synthase); methionine 99.17
3fsl_A397 Aromatic-amino-acid aminotransferase; tyrosine ami 99.17
2ord_A397 Acoat, acetylornithine aminotransferase; TM1785, a 99.16
1iay_A428 ACC synthase 2, 1-aminocyclopropane-1-carboxylate 99.16
3qhx_A392 Cystathionine gamma-synthase METB (CGS); structura 99.15
1s0a_A429 Adenosylmethionine-8-amino-7-oxononanoate aminotra 99.15
3tcm_A500 Alanine aminotransferase 2; pyridoxal phosphate (P 99.15
2aeu_A374 Hypothetical protein MJ0158; selenocysteine syntha 99.14
3piu_A435 1-aminocyclopropane-1-carboxylate synthase; fruit 99.14
1yaa_A412 Aspartate aminotransferase; HET: PLP; 2.05A {Sacch 99.14
3a8u_X449 Omega-amino acid--pyruvate aminotransferase; large 99.14
1n8p_A393 Cystathionine gamma-lyase; three open alpha/beta s 99.14
4f4e_A420 Aromatic-amino-acid aminotransferase; ssgcid, stru 99.09
1sff_A426 4-aminobutyrate aminotransferase; enzyme complexes 99.09
3g7q_A417 Valine-pyruvate aminotransferase; NP_462565.1, str 99.08
3t18_A413 Aminotransferase class I and II; PSI-biology, MCSG 99.07
2q7w_A396 Aspartate aminotransferase; mechanism-based inhibi 99.07
2oat_A439 Ornithine aminotransferase; 5-fluoromethylornithin 99.07
3if2_A444 Aminotransferase; YP_265399.1, structura genomics, 99.07
3jzl_A409 Putative cystathionine beta-lyase involved in ALU 99.06
1e5e_A404 MGL, methionine gamma-lyase; methionine biosynthes 99.06
3bwn_A391 AT1G70560, L-tryptophan aminotransferase; auxin sy 99.06
2pb2_A420 Acetylornithine/succinyldiaminopimelate aminotran; 99.04
3nx3_A395 Acoat, acetylornithine aminotransferase; csgid, st 99.04
1z7d_A433 Ornithine aminotransferase; structural genomics co 99.03
3cog_A403 Cystathionine gamma-lyase; CTH, PLP, propargylglyc 99.02
3acz_A389 Methionine gamma-lyase; L-methionine; HET: LLP; 1. 99.02
3ez1_A423 Aminotransferase MOCR family; YP_604413.1, struct 99.01
2ctz_A421 O-acetyl-L-homoserine sulfhydrylase; crystal, O-ac 99.0
3meb_A448 Aspartate aminotransferase; pyridoxal PHOS transfe 99.0
3ndn_A414 O-succinylhomoserine sulfhydrylase; seattle struct 99.0
1ax4_A467 Tryptophanase; tryptophan biosynthesis, tryptophan 98.99
3dxv_A439 Alpha-amino-epsilon-caprolactam racemase; fold-TYP 98.96
7aat_A401 Aspartate aminotransferase; transferase(aminotrans 98.95
1zod_A433 DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, 98.94
2oqx_A467 Tryptophanase; lyase, pyridoxal phosphate, tryptop 98.93
3i16_A427 Aluminum resistance protein; YP_878183.1, carbon-s 98.92
3ppl_A427 Aspartate aminotransferase; dimer, PLP-dependent t 98.92
3ihj_A498 Alanine aminotransferase 2; helix, structural geno 98.89
3ht4_A431 Aluminum resistance protein; lyase, putative cysta 98.88
3f6t_A533 Aspartate aminotransferase; YP_194538.1, STRU geno 98.88
3hvy_A427 Cystathionine beta-lyase family protein, YNBB B.S 98.87
3ri6_A430 O-acetylhomoserine sulfhydrylase; PYR 5'-phosphate 98.86
3pj0_A359 LMO0305 protein; structural genomics, joint center 98.85
1ibj_A464 CBL, cystathionine beta-lyase; PLP-dependent enzym 98.84
2eo5_A419 419AA long hypothetical aminotransferase; PLP enzy 98.8
2cjg_A449 L-lysine-epsilon aminotransferase; internal aldimi 98.78
3d6k_A422 Putative aminotransferase; APC82464, corynebacteri 98.75
3lws_A357 Aromatic amino acid beta-eliminating lyase/threoni 98.75
3n75_A715 LDC, lysine decarboxylase, inducible; pyridoxal-5' 98.74
3i4j_A430 Aminotransferase, class III; structural GENOMICS,N 98.73
3fq8_A427 Glutamate-1-semialdehyde 2,1-aminomutase; drug res 98.72
3n5m_A452 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 98.72
3nmy_A400 Xometc, cystathionine gamma-lyase-like protein; Cy 98.71
3dod_A448 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 98.7
3l44_A434 Glutamate-1-semialdehyde 2,1-aminomutase 1; alpha 98.68
2ez2_A456 Beta-tyrosinase, tyrosine phenol-lyase; PLP-depend 98.66
3k28_A429 Glutamate-1-semialdehyde 2,1-aminomutase 2; biosyn 98.66
3b1d_A392 Betac-S lyase; HET: PLP PLS EPE; 1.66A {Streptococ 98.09
4e77_A429 Glutamate-1-semialdehyde 2,1-aminomutase; structur 98.64
3tfu_A457 Adenosylmethionine-8-amino-7-oxononanoate aminotr; 98.64
2zy4_A546 L-aspartate beta-decarboxylase; pyridoxal 5'-phosp 98.57
3gju_A460 Putative aminotransferase; pyridoxal phosphate, PL 98.54
3oks_A451 4-aminobutyrate transaminase; ssgcid, transferase, 98.52
4ffc_A453 4-aminobutyrate aminotransferase (GABT); structura 98.5
3hmu_A472 Aminotransferase, class III; structural genomics, 98.48
4a6r_A459 Omega transaminase; transferase, PLP-binding enzym 98.43
3i5t_A476 Aminotransferase; pyridoxal 5'-phosphate, PSI-2, N 98.35
2cy8_A453 D-phgat, D-phenylglycine aminotransferase; structu 98.25
4eu1_A409 Mitochondrial aspartate aminotransferase; ssgcid, 98.25
2hox_A427 ALLIIN lyase 1; cysteine sulphoxide lyase, ALLIINA 98.23
2c0r_A362 PSAT, phosphoserine aminotransferase; pyridoxal-5' 98.22
2epj_A434 Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzy 98.21
3bc8_A450 O-phosphoseryl-tRNA(SEC) selenium transferase; dis 98.17
2e7u_A424 Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzy 98.08
4h51_A420 Aspartate aminotransferase; ssgcid, structural gen 98.07
4ao9_A454 Beta-phenylalanine aminotransferase; HET: PLP; 1.5 97.99
1w23_A360 Phosphoserine aminotransferase; pyridoxal-5'-phosp 97.95
2yky_A465 Beta-transaminase; transferase; HET: PLP SFE; 1.69 97.08
3ou5_A490 Serine hydroxymethyltransferase, mitochondrial; st 97.84
3hl2_A501 O-phosphoseryl-tRNA(SEC) selenium transferase; sel 97.47
3ffr_A362 Phosphoserine aminotransferase SERC; structural ge 97.45
2fyf_A398 PSAT, phosphoserine aminotransferase; PLP-dependen 97.35
3k7y_A405 Aspartate aminotransferase; aminotrans pyridoxal p 97.25
1ohv_A472 4-aminobutyrate aminotransferase; PLP-dependent en 96.89
3ke3_A379 Putative serine-pyruvate aminotransferase; structu 96.86
3f0h_A376 Aminotransferase; RER070207000802, structural geno 96.73
4atq_A456 4-aminobutyrate transaminase; transferase; HET: PL 96.61
4e3q_A473 Pyruvate transaminase; aminotransferase, transfera 96.01
1ajs_A412 Aspartate aminotransferase; PIG, in the presence o 95.71
1uu1_A335 Histidinol-phosphate aminotransferase; histidine b 95.58
2dr1_A386 PH1308 protein, 386AA long hypothetical serine ami 95.47
1kmj_A406 Selenocysteine lyase; persulfide perselenide NIFS 95.43
1m32_A366 2-aminoethylphosphonate-pyruvate aminotransferase; 95.35
1elu_A390 L-cysteine/L-cystine C-S lyase; FES cluster biosyn 95.33
1yaa_A412 Aspartate aminotransferase; HET: PLP; 2.05A {Sacch 95.33
2huf_A393 Alanine glyoxylate aminotransferase; alpha and bet 95.32
1t3i_A420 Probable cysteine desulfurase; PLP-binding enzyme, 94.8
2q7w_A396 Aspartate aminotransferase; mechanism-based inhibi 94.61
2yrr_A353 Aminotransferase, class V; structural genomics, NP 94.26
2bkw_A385 Alanine-glyoxylate aminotransferase 1; analine-gly 94.19
2ch1_A396 3-hydroxykynurenine transaminase; PLP-enzyme, kynu 94.18
2z9v_A392 Aspartate aminotransferase; pyridoxamine, pyruvate 94.11
3zrp_A384 Serine-pyruvate aminotransferase (AGXT); HET: PLP; 94.08
3lvm_A423 Cysteine desulfurase; structural genomics, montrea 93.91
3b46_A447 Aminotransferase BNA3; kynurenine aminotransferase 93.74
2o1b_A404 Aminotransferase, class I; aminotrasferase; HET: P 93.67
3kgw_A393 Alanine-glyoxylate aminotransferase; AAH25799.1, p 93.64
1iug_A352 Putative aspartate aminotransferase; wild type, py 93.57
4hvk_A382 Probable cysteine desulfurase 2; transferase and I 93.52
3nnk_A411 Ureidoglycine-glyoxylate aminotransferase; PLP-dep 93.38
4eb5_A382 Probable cysteine desulfurase 2; scaffold, transfe 93.23
3isl_A416 Purine catabolism protein PUCG; pyridoxalphosphate 93.16
3vax_A400 Putative uncharacterized protein DNDA; desulfurase 93.07
1eg5_A384 Aminotransferase; PLP-dependent enzymes, iron-sulf 92.97
3fsl_A397 Aromatic-amino-acid aminotransferase; tyrosine ami 92.56
3e9k_A465 Kynureninase; kynurenine-L-hydrolase, kynurenine h 92.39
1d2f_A390 MALY protein; aminotransferase fold, large PLP-bin 92.22
1vjo_A393 Alanine--glyoxylate aminotransferase; 17130350, AL 92.19
2z67_A456 O-phosphoseryl-tRNA(SEC) selenium transferase; sel 91.58
3cai_A406 Possible aminotransferase; RV3778C; 1.80A {Mycobac 91.3
4f4e_A420 Aromatic-amino-acid aminotransferase; ssgcid, stru 90.69
3meb_A448 Aspartate aminotransferase; pyridoxal PHOS transfe 89.6
1qz9_A416 Kynureninase; kynurenine, tryptophan, PLP, vitamin 89.13
2vi8_A405 Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, 87.71
2epj_A434 Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzy 87.28
2hox_A427 ALLIIN lyase 1; cysteine sulphoxide lyase, ALLIINA 86.16
3lws_A357 Aromatic amino acid beta-eliminating lyase/threoni 83.18
4eu1_A409 Mitochondrial aspartate aminotransferase; ssgcid, 82.23
3b1d_A392 Betac-S lyase; HET: PLP PLS EPE; 1.66A {Streptococ 82.45
3a9z_A432 Selenocysteine lyase; PLP, cytoplasm, pyridoxal ph 81.33
7aat_A401 Aspartate aminotransferase; transferase(aminotrans 80.92
2e7u_A424 Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzy 80.81
2rfv_A398 Methionine gamma-lyase; pyridoxal-5'-phosphate, PL 80.62
>3e77_A Phosphoserine aminotransferase; SERC, PLP, structural genomi structural genomics consortium, SGC, amino-acid biosynthesi aminotransferase; HET: PLP; 2.50A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=3.9e-61  Score=517.31  Aligned_cols=361  Identities=56%  Similarity=0.911  Sum_probs=313.5

Q ss_pred             ceeccCCCCCCCHHHHHHHHHHHHhhccCCCcccccccccHHHHHHHHHHHHHHHHHhCCCCCCEEEEEcCCcchhhhHH
Q psy8733          52 VINFGAGPAKLPREVLEEVKETLLDYESTGISVMEMSHRSADYTKINNDTQAALRELLNVPNNYKILFLQGGGTGMFAAV  131 (621)
Q Consensus        52 ~~lf~aGPs~~P~~Vlea~~~~l~~~~~~g~sv~e~shrs~~f~~i~~~ar~~La~Ll~~p~~yeI~f~~gggT~~~~a~  131 (621)
                      -.|+.|+++++|++|+++|.+++.+|.++|+|+++++||+++|.++++++|+.+++|||++++++|+|++||||+     
T Consensus        14 ~~~n~at~~~~p~~Vl~a~~~~~~~~~~n~~s~~~~~hr~~~~~~~~~~ar~~la~ll~~~~~~evif~t~~~T~-----   88 (377)
T 3e77_A           14 GTENLYFQSMLPHSVLLEIQKELLDYKGVGISVLEMSHRSSDFAKIINNTENLVRELLAVPDNYKVIFLQGGGCG-----   88 (377)
T ss_dssp             -CCCEECSCCCCHHHHHHHHHTSSSGGGSSSCTTTCCTTSHHHHHHHHHHHHHHHHHHTCCTTEEEEEESSHHHH-----
T ss_pred             ccccccccCCCCHHHHHHHHHHHHhcccCCccccccCCCCHHHHHHHHHHHHHHHHHhCCCCCCeEEEEcCchHH-----
Confidence            358899999999999999999999999999999999999999999999999999999999887899999899999     


Q ss_pred             HHHHhhhccCCCCCceeEeecCCcchhHHHHHHHhhCC--CCcEEEEEcChHHHHHHHHHHHhCCceeeecccccccccC
Q psy8733         132 AMNLISSSMNVPNNYKILFLQGGGTGMFAAVAMNLIGR--TGKADYVVTGSWSKKAAAEAEKYGKVNLVIPKVSKYVSIP  209 (621)
Q Consensus       132 alNlla~~~~~~~gd~Il~~~~~~~~~feav~~NL~~~--g~~~~~v~tG~~~~~~~~~a~~~G~~~~~~~~~~~~~~~~  209 (621)
                                                +|++++.|++.+  ||+++++++|.|+++|.++++++|.+.++.+.        
T Consensus        89 --------------------------a~n~a~~~l~~~~~Gd~v~~~~~g~~~~~~~~~a~~~G~~~~~~~~--------  134 (377)
T 3e77_A           89 --------------------------QFSAVPLNLIGLKAGRCADYVVTGAWSAKAAEEAKKFGTINIVHPK--------  134 (377)
T ss_dssp             --------------------------HHHHHHHHHGGGSTTCEEEECCCSHHHHHHHHHHTTTSEEEECSCC--------
T ss_pred             --------------------------HHHHHHHhccCCCCCCeEEEEECCHHHHHHHHHHHHhCCceEEecc--------
Confidence                                      555577788754  89999999999999999999999864332211        


Q ss_pred             CCCCCCCCCCccccccccCccccCccchhhhHHHhhhcccccccccCCCccCCCCccccCCCCCceEEEEeccccccccc
Q psy8733         210 DQSTWNRDPEASYLYYCDNETVDGSWSKKAAAEAEKYGKVNLVIPKVSKYVSIPDQSTWNRDPEASYLYYCDNETVDGVE  289 (621)
Q Consensus       210 ~~~~~~~~~~v~~v~~~~~~~v~~~w~~~v~~e~~~~~~~~~~~~~~~~~~~ip~~~~l~i~~~t~~V~~thnET~tGv~  289 (621)
                                              +|+                      .+..|+..++.+++++++|++|||||++|++
T Consensus       135 ------------------------~~~----------------------~~~~~~~~~~~i~~~t~lV~~~h~et~tG~~  168 (377)
T 3e77_A          135 ------------------------LGS----------------------YTKIPDPSTWNLNPDASYVYYCANETVHGVE  168 (377)
T ss_dssp             ------------------------CSS----------------------SCSCCCGGGCCCCTTCSCEEEESEETTTTEE
T ss_pred             ------------------------CCC----------------------cCCCCChHHhccCCCccEEEEeCccCchheE
Confidence                                    111                      1112222344678899999999999999999


Q ss_pred             cccccccCCCcEEEecccccCCCcccccccceEEeccccccCCCccEEEEEchhHHhhhCCCCCceeeccccccCCCccC
Q psy8733         290 FNYIPDSQGIPLVSDMSSNFLSRKFDVSKFGVIIAGAQKNIGPAGITVVIVREDLLEYALPITPTVFHFKINADNNSVYN  369 (621)
Q Consensus       290 ~p~i~~~~g~llvvDavSs~G~~pIDv~~~gvl~asaqK~lGP~Glg~livr~~ll~~~~~~~P~~ld~~~~~~~~s~~~  369 (621)
                      +|++++.+|++++||++|++|+.|+|+++||++++|+|||+||+|+|++|+|+++++++.+..|.|++|....+.+++++
T Consensus       169 ~pii~~~~~~~~~vD~~q~~g~~~id~~~~~~~~~s~~K~~gp~G~g~l~~~~~~l~~~~~~~p~~~~~~~~~~~~~~~~  248 (377)
T 3e77_A          169 FDFIPDVKGAVLVCDMSSNFLSKPVDVSKFGVIFAGAQKNVGSAGVTVVIVRDDLLGFALRECPSVLEYKVQAGNSSLYN  248 (377)
T ss_dssp             CSSCCCCTTCCEEEECTTTTTSSCCCGGGCSEEEEEGGGTTSCTTCEEEEEETTSCSCCCTTSCGGGCHHHHHTTTTCSS
T ss_pred             chhhhccCCCEEEEEcccccCCCCCchhhcCEEEEecccccCCCccEEEEEcHHHHhhccCCCCchhhHHHHhhcCCCCC
Confidence            99988889999999999999999999999999999999999999999999999999988888888888887666778899


Q ss_pred             CchHHHHHHHHHHHHHHHhhCCHHHHHHHHHHHHHHHHHHHHccCCcccCccCCCCCCCCcccccccccccccCCchhhH
Q psy8733         370 TPPTFVVHVIQRVFAWIKRQGGLAKMEQNSLQKSVLLYQEIDNSDKFYECPVQAGCRSRMNVTDIFFTFSHVQTGSAFFF  449 (621)
Q Consensus       370 TP~v~~I~aL~~aL~~i~~~gGl~~i~~r~~~la~~L~e~L~~~~g~~~~~~~~~~RS~~nv~~~~~t~~~~~~~~~~~~  449 (621)
                      |||+++|++|++||+|+.++||++++++|+++++++++++|++++|+++++.+++.||+++++                 
T Consensus       249 Tp~v~~i~~l~~al~~l~~~GG~~~i~~~~~~l~~~l~~~L~~~~g~~~~~~~~~~rs~~ivs-----------------  311 (377)
T 3e77_A          249 TPPCFSIYVMGLVLEWIKNNGGAAAMEKLSSIKSQTIYEIIDNSQGFYVCPVEPQNRSKMNIP-----------------  311 (377)
T ss_dssp             CCCHHHHHHHHHHHHHHHHTTHHHHHHHHHHHHHHHHHHHHHTSTTSEECCSCGGGBCSSEEE-----------------
T ss_pred             CchHHHHHHHHHHHHHHHHccCHHHHHHHHHHHHHHHHHHHHhcCCceecCCCHHHcCCcEEE-----------------
Confidence            999999999999999999998899999999999999999999998898777677889998775                 


Q ss_pred             HHHHhhcccccccCCcEEeeecHhHhhhcCCCCCceeeeeecccCCCccCCCchhHHHHHHHHHHHHHhcCChHHHHHHH
Q psy8733         450 GVIIAGAQKNIGPAGITVVIVREDLLEYALPITPTVFHFKINADNNSVYNTPPTFVVHVIQRVFAWIKRQGGLAKMEQNS  529 (621)
Q Consensus       450 ~~~~a~~qk~~GpaGl~v~iv~~~~l~~~~~~~p~~~~y~~~~~~~s~~nTP~~~~iy~~~~vl~~~~~~gg~~~~~~~~  529 (621)
                                                            +.. -                                     
T Consensus       312 --------------------------------------f~~-~-------------------------------------  315 (377)
T 3e77_A          312 --------------------------------------FRI-G-------------------------------------  315 (377)
T ss_dssp             --------------------------------------EEE-S-------------------------------------
T ss_pred             --------------------------------------EEc-C-------------------------------------
Confidence                                                  111 0                                     


Q ss_pred             HHHHHHHHHHHhccCCcccccCCCCCcccHHHHHHHHHccCccccCCCCCCccceeeccCCCHHHHHHHHHHHHHHHHHc
Q psy8733         530 LQKSVLLYQEIDNSDKFYECPVQAGFPLDELFLKEAKAHNMIQLKGHRLVGGIRASIYNAITVDEAVILVKFMKEFRHKH  609 (621)
Q Consensus       530 ~~ka~~lY~~id~~~~~~~~~v~~~~~~~~~~~~~~~~~~i~~~~g~~~~~~~r~~~~~a~~~~~~~~l~~~~~~~~~~~  609 (621)
                                          .++++.+++..|++.++++||...+||+..|+||+|+++.+|.||+++|+++|++|.++|
T Consensus       316 --------------------~~~~~~~~~~~~l~~l~~~Gi~~~~g~~~~g~iRiS~~~~~t~edId~l~~al~~~~~~~  375 (377)
T 3e77_A          316 --------------------NAKGDDALEKRFLDKALELNMLSLKGHRSVGGIRASLYNAVTIEDVQKLAAFMKKFLEMH  375 (377)
T ss_dssp             --------------------STTCCHHHHHHHHHHHHHTTEESCBCCTTTCSEEEECCTTSCHHHHHHHHHHHHHHHHHH
T ss_pred             --------------------CCCCchhHHHHHHHHHHHCCcEEeCCCCcCCEEEEECCCCCCHHHHHHHHHHHHHHHHHc
Confidence                                001001244678888899999999999999999999999999999999999999999998


Q ss_pred             C
Q psy8733         610 S  610 (621)
Q Consensus       610 ~  610 (621)
                      +
T Consensus       376 ~  376 (377)
T 3e77_A          376 Q  376 (377)
T ss_dssp             C
T ss_pred             C
Confidence            6



>3m5u_A Phosphoserine aminotransferase; alpha-beta half sandwich, csgid, amino-acid biosynthesis, cytoplasm, pyridoxal phosphate; HET: MES; 2.15A {Campylobacter jejuni} SCOP: c.67.1.0 Back     alignment and structure
>3qm2_A Phosphoserine aminotransferase; structural genomics, center for structural genomics of infec diseases, csgid; 2.25A {Salmonella enterica subsp} PDB: 1bjn_A* 1bjo_A* 3qbo_A* Back     alignment and structure
>2c0r_A PSAT, phosphoserine aminotransferase; pyridoxal-5'-phosphate, pyridine serine biosynthesis, amino-acid biosynthesis, pyridoxal phosphate; HET: PLP; 1.2A {Bacillus circulans} SCOP: c.67.1.4 PDB: 1bt4_A* 1w3u_A* Back     alignment and structure
>1w23_A Phosphoserine aminotransferase; pyridoxal-5'-phosphate; HET: PGE PLP EPE; 1.08A {Bacillus alcalophilus} SCOP: c.67.1.4 PDB: 2bhx_A* 2bi1_A* 2bi2_A* 2bi3_A* 2bi5_A* 2bi9_A* 2bia_A* 2bie_A* 2big_A* Back     alignment and structure
>3ffr_A Phosphoserine aminotransferase SERC; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: LLP MSE P33; 1.75A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>2fyf_A PSAT, phosphoserine aminotransferase; PLP-dependent enzyme, dimer, structural genomics; HET: PLP; 1.50A {Mycobacterium tuberculosis} PDB: 3vom_A* Back     alignment and structure
>3f0h_A Aminotransferase; RER070207000802, structural genomics, JOIN for structural genomics, JCSG; HET: MSE LLP; 1.70A {Eubacterium rectale} Back     alignment and structure
>3kgw_A Alanine-glyoxylate aminotransferase; AAH25799.1, putative aminotransferase, structural genomics, center for structural genomics, JCSG; HET: PLP; 1.65A {Mus musculus} SCOP: c.67.1.3 PDB: 3kgx_A 3imz_A* 3r9a_A* 1h0c_A* 1j04_A* Back     alignment and structure
>3zrp_A Serine-pyruvate aminotransferase (AGXT); HET: PLP; 1.75A {Sulfolobus solfataricus} PDB: 3zrq_A* 3zrr_A* Back     alignment and structure
>2z9v_A Aspartate aminotransferase; pyridoxamine, pyruvate; HET: PXM; 1.70A {Mesorhizobium loti} PDB: 2z9u_A* 2z9w_A* 2z9x_A* Back     alignment and structure
>3nnk_A Ureidoglycine-glyoxylate aminotransferase; PLP-dependent; HET: LLP; 2.58A {Klebsiella pneumoniae} Back     alignment and structure
>2huf_A Alanine glyoxylate aminotransferase; alpha and beta protein, PLP-dependent transferase; HET: LLP; 1.75A {Aedes aegypti} PDB: 2hui_A* 2huu_A* Back     alignment and structure
>1iug_A Putative aspartate aminotransferase; wild type, pyridoxal-5'-phosphate form, riken structural genomics/proteomics initiative, RSGI; HET: LLP; 2.20A {Thermus thermophilus} SCOP: c.67.1.3 Back     alignment and structure
>3isl_A Purine catabolism protein PUCG; pyridoxalphosphate, PLP dependent enzymes, purine metabolism transaminases, aminotransferases; HET: PLP; 2.06A {Bacillus subtilis} Back     alignment and structure
>3ke3_A Putative serine-pyruvate aminotransferase; structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: LLP; 2.20A {Psychrobacter arcticus 273-4} Back     alignment and structure
>2ch1_A 3-hydroxykynurenine transaminase; PLP-enzyme, kynurenine pathway, transferase; HET: LLP; 2.4A {Anopheles gambiae} SCOP: c.67.1.3 PDB: 2ch2_A* Back     alignment and structure
>2dr1_A PH1308 protein, 386AA long hypothetical serine aminotransferase; PLP, structural genomics, NPPSFA; HET: PLP; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>2bkw_A Alanine-glyoxylate aminotransferase 1; analine-glyoxylate aminotransferase, pyridoxal-5-phosphate, SAD, glycolate pathway; HET: LLP; 2.57A {Saccharomyces cerevisiae} SCOP: c.67.1.3 Back     alignment and structure
>2yrr_A Aminotransferase, class V; structural genomics, NPPSFA, national PROJ protein structural and functional analyses; HET: PLP; 1.86A {Thermus thermophilus} PDB: 2yri_A* Back     alignment and structure
>1m32_A 2-aminoethylphosphonate-pyruvate aminotransferase; PLP-dependent aminotransferase fold; HET: PLP; 2.20A {Salmonella typhimurium} SCOP: c.67.1.3 Back     alignment and structure
>4hvk_A Probable cysteine desulfurase 2; transferase and ISCS, transferase; HET: PMP PG4; 1.43A {Archaeoglobus fulgidus} PDB: 4eb7_A* 4eb5_A* Back     alignment and structure
>1vjo_A Alanine--glyoxylate aminotransferase; 17130350, ALR1004, STR genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: PLP; 1.70A {Nostoc SP} SCOP: c.67.1.3 Back     alignment and structure
>3cai_A Possible aminotransferase; RV3778C; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure
>1kmj_A Selenocysteine lyase; persulfide perselenide NIFS pyridoxal phosphate, structural PSI, protein structure initiative; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.3 PDB: 1i29_A* 1jf9_A* 1kmk_A* 1c0n_A* Back     alignment and structure
>1elu_A L-cysteine/L-cystine C-S lyase; FES cluster biosynthesis, pyridoxal 5'-phosphate, thiocystei aminoacrylate, enzyme-product complex; HET: PDA; 1.55A {Synechocystis SP} SCOP: c.67.1.3 PDB: 1elq_A* 1n2t_A* 1n31_A* Back     alignment and structure
>4eb5_A Probable cysteine desulfurase 2; scaffold, transferase-metal binding protein complex; HET: PLP EPE; 2.53A {Archaeoglobus fulgidus} PDB: 4eb7_A* Back     alignment and structure
>1t3i_A Probable cysteine desulfurase; PLP-binding enzyme, transferase; HET: 2OS PLP; 1.80A {Synechocystis SP} SCOP: c.67.1.3 Back     alignment and structure
>1qz9_A Kynureninase; kynurenine, tryptophan, PLP, vitamin B6, pyridoxal-5'-phosph hydrolase; HET: PLP P3G; 1.85A {Pseudomonas fluorescens} SCOP: c.67.1.3 Back     alignment and structure
>1eg5_A Aminotransferase; PLP-dependent enzymes, iron-sulfur-cluster synthesis, C-S BE transferase; HET: PLP; 2.00A {Thermotoga maritima} SCOP: c.67.1.3 PDB: 1ecx_A* Back     alignment and structure
>3lvm_A Cysteine desulfurase; structural genomics, montreal-kingston bacterial structural genomics initiative, BSGI, transferase; HET: PLP; 2.05A {Escherichia coli} PDB: 3lvk_A* 3lvl_B* 3lvj_A* 1p3w_B* Back     alignment and structure
>3e9k_A Kynureninase; kynurenine-L-hydrolase, kynurenine hydrolase, pyridoxal-5'-phosphate, inhibitor complex, 3-hydroxy hippur hydroxyhippuric acid, PLP; HET: PLP 3XH; 1.70A {Homo sapiens} PDB: 2hzp_A* Back     alignment and structure
>3vax_A Putative uncharacterized protein DNDA; desulfurase, transferase; HET: PLP; 2.40A {Streptomyces lividans} Back     alignment and structure
>3a9z_A Selenocysteine lyase; PLP, cytoplasm, pyridoxal phosphate, transferase; HET: PLP SLP; 1.55A {Rattus norvegicus} PDB: 3a9x_A* 3a9y_A* 3gzd_A* 3gzc_A* 2hdy_A* Back     alignment and structure
>3f9t_A TDC, L-tyrosine decarboxylase MFNA; NP_247014.1, L-tyrosine decarboxylase MFNA (EC 4.1.1.25), ST genomics; HET: PLP; 2.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>2e7j_A SEP-tRNA:Cys-tRNA synthase; seven-stranded BETE-strand, lyase, structural genomics; HET: PLP; 2.40A {Archaeoglobus fulgidus} SCOP: c.67.1.9 PDB: 2e7i_A* Back     alignment and structure
>1wyu_A Glycine dehydrogenase (decarboxylating) subunit 1; alpha(2)beta(2) tetramer, riken structural genomics/proteomi initiative, RSGI; HET: PLP; 2.10A {Thermus thermophilus} SCOP: c.67.1.7 PDB: 1wyt_A* 1wyv_A* Back     alignment and structure
>2dgk_A GAD-beta, GADB, glutamate decarboxylase beta; gadbd1-14, autoinhibition, substituted aldamine, lyase; HET: PLP; 1.90A {Escherichia coli} PDB: 2dgm_A* 1pmo_A* 2dgl_A* 1pmm_A* 3fz6_A* 3fz7_A 3fz8_A* 1xey_A* Back     alignment and structure
>3hbx_A GAD 1, glutamate decarboxylase 1; calmodulin-binding, lyase, pyridoxal phosphate; HET: LLP; 2.67A {Arabidopsis thaliana} Back     alignment and structure
>2fnu_A Aminotransferase; protein-product complex, structural genomics, montreal-kings bacterial structural genomics initiative, BSGI; HET: PMP UD1; 1.50A {Helicobacter pylori} SCOP: c.67.1.4 PDB: 2fni_A* 2fn6_A* Back     alignment and structure
>3ffh_A Histidinol-phosphate aminotransferase; APC88260, listeria in CLIP11262, structural genomics, PSI-2; 2.31A {Listeria innocua} SCOP: c.67.1.0 Back     alignment and structure
>2qma_A Diaminobutyrate-pyruvate transaminase and L-2,4- diaminobutyrate decarboxylase; structural genomics, APC91511.1, glutamate decarboxylase; HET: MSE; 1.81A {Vibrio parahaemolyticus} Back     alignment and structure
>3mc6_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxyl phosphate; HET: LLP; 3.15A {Saccharomyces cerevisiae} Back     alignment and structure
>1rv3_A Serine hydroxymethyltransferase, cytosolic; one-carbon metabolism; HET: GLY PLP; 2.40A {Oryctolagus cuniculus} SCOP: c.67.1.4 PDB: 1rv4_A* 1rvu_A* 1rvy_A* 1ls3_A* 1cj0_A* 1bj4_A* 1eji_A* Back     alignment and structure
>2jis_A Cysteine sulfinic acid decarboxylase; pyridoxal phosphate, alternative splicing, pyridoxal phosphate (PLP), structural genomics consortium (SGC); HET: PLP; 1.6A {Homo sapiens} Back     alignment and structure
>1svv_A Threonine aldolase; structural genomics, structural genomics of pathogenic proto SGPP, protein structure initiative, PSI; 2.10A {Leishmania major} SCOP: c.67.1.1 Back     alignment and structure
>3get_A Histidinol-phosphate aminotransferase; NP_281508.1, structural genomics, joint center for structural genomics; HET: LLP MSE; 2.01A {Campylobacter jejuni subsp} Back     alignment and structure
>3ly1_A Putative histidinol-phosphate aminotransferase; structural G joint center for structural genomics, JCSG; HET: MSE PLP CIT; 1.80A {Erwinia carotovora atroseptica} Back     alignment and structure
>3euc_A Histidinol-phosphate aminotransferase 2; YP_297314.1, structur genomics, joint center for structural genomics, JCSG; HET: MSE; 2.05A {Ralstonia eutropha JMP134} SCOP: c.67.1.0 Back     alignment and structure
>2z67_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine biosynthesis, seven-stranded BETE-strand, PYR 5'-phosphate; HET: PLP; 2.50A {Methanococcus maripaludis} SCOP: c.67.1.9 Back     alignment and structure
>3hdo_A Histidinol-phosphate aminotransferase; PSI-II, histidinol-phosphate aminotrans structural genomics, protein structure initiative; 1.61A {Geobacter metallireducens gs-15} Back     alignment and structure
>3mad_A Sphingosine-1-phosphate lyase; carboxy-lyase activity, pyridoxal phosphate; HET: LLP; 2.00A {Symbiobacterium thermophilum} PDB: 3maf_A* 3mau_A* 3mbb_A* Back     alignment and structure
>4e1o_A HDC, histidine decarboxylase; lyase; HET: PLP PVH; 1.80A {Homo sapiens} Back     alignment and structure
>3dyd_A Tyrosine aminotransferase; PLP, SGC, structural genomics, structural genomics consortium, disease mutation, phenylalani catabolism; HET: PLP; 2.30A {Homo sapiens} PDB: 3pdx_A* Back     alignment and structure
>3g0t_A Putative aminotransferase; NP_905498.1, putative aspartate aminotransferase, structural genomics, joint center for structural genomics; HET: MSE LLP PE4; 1.75A {Porphyromonas gingivalis} Back     alignment and structure
>3b8x_A WBDK, pyridoxamine 5-phosphate-dependent dehydrase; aspartate aminotransferase, colitose, perosamine, O-antigen, pyridoxal phosphate,; HET: G4M; 1.70A {Escherichia coli} PDB: 2gms_A* 2gmu_A* 2r0t_A* 3gr9_A* Back     alignment and structure
>3uwc_A Nucleotide-sugar aminotransferase; lipopolysaccharide biosynthesis; HET: MSE PMP; 1.80A {Coxiella burnetii} Back     alignment and structure
>2okj_A Glutamate decarboxylase 1; PLP-dependent decarboxylase, lyase; HET: LLP PLZ; 2.30A {Homo sapiens} PDB: 2okk_A* Back     alignment and structure
>3frk_A QDTB; aminotransferase, sugar-modification, natural porduct; HET: TQP; 2.15A {Thermoanaerobacteriumthermosaccharolyticum} Back     alignment and structure
>1gd9_A Aspartate aminotransferase; pyridoxal enzyme, temperature dependence O substrate recognition; HET: PLP; 1.80A {Pyrococcus horikoshii} SCOP: c.67.1.1 PDB: 1gde_A* 1dju_A* Back     alignment and structure
>1fc4_A 2-amino-3-ketobutyrate conenzyme A ligase; 2-amino-3-ketobutyrate COA ligase, pyridoxal phosphate, COEN transferase, structural genomics; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.4 Back     alignment and structure
>3vp6_A Glutamate decarboxylase 1; catalytic loop SWAP, lyase; HET: LLP HLD; 2.10A {Homo sapiens} PDB: 2okj_A* 2okk_A* Back     alignment and structure
>2a7v_A Serine hydroxymethyltransferase; structural genomics, structural genomics consortium, SGC; 2.04A {Homo sapiens} PDB: 3ou5_A Back     alignment and structure
>2w8t_A SPT, serine palmitoyltransferase; HET: LLP; 1.25A {Sphingomonas paucimobilis} PDB: 2w8u_A* 2w8w_A* 2xbn_A* 2w8j_A* 2w8v_A* 2jg2_A* 2jgt_A 2x8u_A* Back     alignment and structure
>3dr4_A Putative perosamine synthetase; deoxysugar, pyridoxal phosphate, aspartate aminotransferase, O-antigen; HET: G4M; 1.60A {Caulobacter crescentus} PDB: 3dr7_A* 3bn1_A* Back     alignment and structure
>3dzz_A Putative pyridoxal 5'-phosphate-dependent C-S LYA; putative PLP-dependent aminotransferase; HET: MSE LLP PG4; 1.61A {Lactobacillus delbrueckii subsp} SCOP: c.67.1.0 Back     alignment and structure
>2vi8_A Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, enzyme memory, pyridoxal phosphate, one-carbon metabolism, PLP-dependent enzymes; HET: PLP; 1.67A {Bacillus stearothermophilus} PDB: 2vi9_A* 2via_A* 2vib_A* 1kkj_A* 1kkp_A* 1kl1_A* 1kl2_A* 1yjs_A* 2w7f_A* 2w7d_A* 2w7e_A* 2w7g_A* 2w7h_A* 1yjz_A* 1yjy_A* 2vgu_A* 2vgs_A* 2vgt_A* 2vgv_A* 2vgw_A* ... Back     alignment and structure
>4dq6_A Putative pyridoxal phosphate-dependent transferas; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: PLP; 1.50A {Clostridium difficile} PDB: 4dgt_A* Back     alignment and structure
>3h14_A Aminotransferase, classes I and II; YP_167802.1, SPO258 structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.90A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>3nyt_A Aminotransferase WBPE; PLP binding, nucleotide-sugar binding; HET: ULP; 1.30A {Pseudomonas aeruginosa} PDB: 3nys_A* 3nyu_A* 3nu8_A* 3nu7_A* 3nub_A* Back     alignment and structure
>2oga_A Transaminase; PLP-dependent enzyme, desosamine, deoxysugars, antibiotics, hydrolase; HET: PGU; 2.05A {Streptomyces venezuelae} PDB: 2oge_A* Back     alignment and structure
>3k40_A Aromatic-L-amino-acid decarboxylase; PLP dependent protein, alpha beta protein, alternative splicing, catecholamine biosynthesis, lyase; HET: LLP; 1.75A {Drosophila melanogaster} SCOP: c.67.1.6 Back     alignment and structure
>3p1t_A Putative histidinol-phosphate aminotransferase; PLP-dependent transferase-like, structural genomics, joint C structural genomics, JCSG; HET: TLA; 2.60A {Burkholderia pseudomallei} Back     alignment and structure
>1js3_A DDC;, DOPA decarboxylase; carbidopa, parkinson'S disease, vitamin; HET: PLP 142; 2.25A {Sus scrofa} SCOP: c.67.1.6 PDB: 1js6_A* 3rch_A* 3rbl_A 3rbf_A* Back     alignment and structure
>1v2d_A Glutamine aminotransferase; PLP, riken structural genomics/proteomics initi RSGI, structural genomics; HET: PLP; 1.90A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1v2e_A* 1v2f_A* Back     alignment and structure
>3a2b_A Serine palmitoyltransferase; vitamin B6-dependent enzyme fold type I, acyltransferase, PY phosphate; HET: PLP; 2.30A {Sphingobacterium multivorum} Back     alignment and structure
>1bs0_A Protein (8-amino-7-oxonanoate synthase); PLP-dependent acyl-COA synthase, biotin biosynthesis, 8-AMIN oxonanoate synthase; 1.65A {Escherichia coli} SCOP: c.67.1.4 PDB: 2g6w_A* 1dje_A* 1dj9_A* Back     alignment and structure
>3tqx_A 2-amino-3-ketobutyrate coenzyme A ligase; energy metabolism, transferase; HET: PLP; 2.30A {Coxiella burnetii} Back     alignment and structure
>1o69_A Aminotransferase; structural genomics, unknown function; HET: X04; 1.84A {Campylobacter jejuni} SCOP: c.67.1.4 PDB: 1o62_A 1o61_A* Back     alignment and structure
>1wyu_B Glycine dehydrogenase subunit 2 (P-protein); alpha(2)beta(2) tetramer, riken structural genomics/proteomi initiative, RSGI; HET: PLP; 2.10A {Thermus thermophilus} SCOP: c.67.1.7 PDB: 1wyt_B* 1wyv_B* Back     alignment and structure
>3nra_A Aspartate aminotransferase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: LLP; 2.15A {Rhodobacter sphaeroides} Back     alignment and structure
>1lc5_A COBD, L-threonine-O-3-phosphate decarboxylase; PLP-dependent decarboxylase cobalamin, lyase; 1.46A {Salmonella enterica} SCOP: c.67.1.1 PDB: 1lc7_A* 1lc8_A* 1lkc_A* Back     alignment and structure
>1b9h_A AHBA synthase, protein (3-amino-5-hydroxybenzoic acid synthase); rifamycin biosynthesis (RIFD gene); HET: PLP; 2.00A {Amycolatopsis mediterranei} SCOP: c.67.1.4 PDB: 1b9i_A* Back     alignment and structure
>1bw0_A TAT, protein (tyrosine aminotransferase); tyrosine catabolism, pyridoxal-5'-phosphate, PLP; HET: LLP; 2.50A {Trypanosoma cruzi} SCOP: c.67.1.1 Back     alignment and structure
>3fdb_A Beta C-S lyase, putative PLP-dependent beta-cystathionase; PLP-dependent transferase-like fold, structural genomics; HET: LLP; 1.99A {Corynebacterium diphtheriae} Back     alignment and structure
>1v72_A Aldolase; PLP-dependent enzyme, lyase; HET: PLP; 2.05A {Pseudomonas putida} SCOP: c.67.1.1 Back     alignment and structure
>3n0l_A Serine hydroxymethyltransferase; alpha beta class, 3-layer(ABA) sandwich, CSGI transferase, structural genomics; HET: MSE; 1.80A {Campylobacter jejuni} SCOP: c.67.1.0 Back     alignment and structure
>2dkj_A Serine hydroxymethyltransferase; PLP dependent enzyme, structural genomics; HET: PLP; 1.15A {Thermus thermophilus} Back     alignment and structure
>2x5d_A Probable aminotransferase; HET: LLP PLP; 2.25A {Pseudomonas aeruginosa} Back     alignment and structure
>1j32_A Aspartate aminotransferase; HET: PLP; 2.10A {Phormidium lapideum} SCOP: c.67.1.1 Back     alignment and structure
>3e77_A Phosphoserine aminotransferase; SERC, PLP, structural genomi structural genomics consortium, SGC, amino-acid biosynthesi aminotransferase; HET: PLP; 2.50A {Homo sapiens} Back     alignment and structure
>1pff_A Methionine gamma-lyase; homocysteine; 2.50A {Trichomonas vaginalis} SCOP: c.67.1.3 Back     alignment and structure
>2c81_A Glutamine-2-deoxy-scyllo-inosose aminotransferase; SMAT, butirosin, aminoglycoside antibiotics; HET: PMP; 1.7A {Bacillus circulans} PDB: 2c7t_A* Back     alignment and structure
>3ecd_A Serine hydroxymethyltransferase 2; ssgcid, decode, bupsa00008A, one-carbon metabolism, pyridoxa phosphate, structural genomics; 1.60A {Burkholderia pseudomallei} Back     alignment and structure
>1b5p_A Protein (aspartate aminotransferase); pyridoxal enzyme; HET: PLP; 1.80A {Thermus thermophilus} SCOP: c.67.1.1 PDB: 1gck_A* 1b5o_A* 5bj4_A* 1gc4_A* 1gc3_A* 1bkg_A* 5bj3_A* 1bjw_A* Back     alignment and structure
>3asa_A LL-diaminopimelate aminotransferase; PLP dependent aminotransferase; 2.05A {Chlamydia trachomatis} PDB: 3asb_A* Back     alignment and structure
>1mdo_A ARNB aminotransferase; type 1 aminotransferase fold; HET: MSE PMP; 1.70A {Salmonella typhimurium} SCOP: c.67.1.4 PDB: 1mdx_A* 1mdz_A* Back     alignment and structure
>3l8a_A METC, putative aminotransferase, probable beta-cystathi; beta-cystathionase, lyase; HET: PLP; 1.54A {Streptococcus mutans} Back     alignment and structure
>3fkd_A L-threonine-O-3-phosphate decarboxylase; structural genomic, , structural genomics, PSI-2, protein structure initiative; 2.50A {Porphyromonas gingivalis} Back     alignment and structure
>1u08_A Hypothetical aminotransferase YBDL; alpha beta protein; HET: PLP; 2.35A {Escherichia coli} SCOP: c.67.1.1 Back     alignment and structure
>3cq5_A Histidinol-phosphate aminotransferase; PLP, PMP, amino-acid biosynthesis, histidine biosynthesis, pyridoxal phosphate; HET: PMP; 1.80A {Corynebacterium glutamicum} PDB: 3cq6_A* 3cq4_A Back     alignment and structure
>3ftb_A Histidinol-phosphate aminotransferase; structural genomics, PSI, MCSG, protein structure initiative; 2.00A {Clostridium acetobutylicum} SCOP: c.67.1.0 Back     alignment and structure
>2bwn_A 5-aminolevulinate synthase; tetrapyrrole biosynthesis, heme biosynthesis, pyridoxal PHOS dependent, transferase, acyltransferase; HET: LLP; 2.1A {Rhodobacter capsulatus} SCOP: c.67.1.4 PDB: 2bwo_A* 2bwp_A* Back     alignment and structure
>2z61_A Probable aspartate aminotransferase 2; amino acid aminotransferase, kynurenine aminotransferase, MJ0684, cytoplasm; HET: LLP; 2.20A {Methanococcus jannaschii} Back     alignment and structure
>1o4s_A Aspartate aminotransferase; TM1255, structural genomics, JCS protein structure initiative, joint center for structural G transferase; HET: PLP; 1.90A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>1xi9_A Putative transaminase; alanine aminotransferase, southeast collaboratory for structural genomics, secsg; HET: PLP; 2.33A {Pyrococcus furiosus} SCOP: c.67.1.1 Back     alignment and structure
>2o0r_A RV0858C (N-succinyldiaminopimelate aminotransfera; PLP-binding enzyme, lysine biosynthesis, aminotransferase, S genomics; HET: LLP; 2.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3h7f_A Serine hydroxymethyltransferase 1; cytoplasm, one-carbon metabolism, pyridoxal phosphate, structural genomics; HET: LLP; 1.50A {Mycobacterium tuberculosis} Back     alignment and structure
>3qgu_A LL-diaminopimelate aminotransferase; L-lysine, pyridoxal-5' phosphate, chamydomonas reinhardtii; HET: GOL; 1.55A {Chlamydomonas reinhardtii} Back     alignment and structure
>3op7_A Aminotransferase class I and II; PLP-dependent transferase, structural genomics, joint center structural genomics, JCSG; HET: LLP UNL; 1.70A {Streptococcus suis 89} PDB: 3p6k_A* Back     alignment and structure
>1c7n_A Cystalysin; transferase, aminotransferase, pyridoxal phosphate; HET: PLP; 1.90A {Treponema denticola} SCOP: c.67.1.3 PDB: 1c7o_A* Back     alignment and structure
>2gb3_A Aspartate aminotransferase; TM1698, structural genomics, PSI structure initiative, joint center for structural genomics; HET: LLP; 2.50A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>2dou_A Probable N-succinyldiaminopimelate aminotransfera; PLP-dependent enzyme, structural genomics, NPPSFA; HET: EPE; 2.30A {Thermus thermophilus} Back     alignment and structure
>3gbx_A Serine hydroxymethyltransferase; structural genomics, IDP01011, serine hydroxymethyltransfera salmonella typhimurium.; HET: MSE; 1.80A {Salmonella typhimurium} SCOP: c.67.1.4 PDB: 1dfo_A* 3g8m_A* 1eqb_A* Back     alignment and structure
>1fg7_A Histidinol phosphate aminotransferase; HISC, histidine biosynthesis, pyridoxal PH montreal-kingston bacterial structural genomics initiative; HET: PMP; 1.50A {Escherichia coli} SCOP: c.67.1.1 PDB: 1fg3_A* 1gew_A* 1gex_A* 1gey_A* 1iji_A* Back     alignment and structure
>3fvs_A Kynurenine--oxoglutarate transaminase 1; alpha beta protein, PLP dependent protein, aminotransferase, pyridoxal phosphate, transferase; HET: LLP; 1.50A {Homo sapiens} SCOP: c.67.1.1 PDB: 3fvu_A* 3fvx_A* 1w7l_A* 1w7m_A* 1w7n_A* Back     alignment and structure
>3e2y_A Kynurenine-oxoglutarate transaminase 3; alpha beta protein, PLP dependent protein, aminotransferase, pyridoxal phosphate, transferase; HET: GLN PMP; 2.26A {Mus musculus} SCOP: c.67.1.0 PDB: 2zjg_A* 3e2f_A* 3e2z_A* Back     alignment and structure
>3ele_A Amino transferase; RER070207001803, structural genomics, JOI for structural genomics, JCSG; HET: MSE PLP; 2.10A {Eubacterium rectale} Back     alignment and structure
>2eh6_A Acoat, acetylornithine aminotransferase; ARGD, structural genomics, NPPSFA, national project on prote structural and functional analyses; HET: PLP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>3m5u_A Phosphoserine aminotransferase; alpha-beta half sandwich, csgid, amino-acid biosynthesis, cytoplasm, pyridoxal phosphate; HET: MES; 2.15A {Campylobacter jejuni} SCOP: c.67.1.0 Back     alignment and structure
>1yiz_A Kynurenine aminotransferase; glutamine transaminase; kynurenic acid, mosquito, PLP-enzyme, pyridoxal phosphate, PLP; HET: LLP; 1.55A {Aedes aegypti} SCOP: c.67.1.1 PDB: 1yiy_A* 2r5c_A* 2r5e_A* Back     alignment and structure
>3ezs_A Aminotransferase ASPB; NP_207418.1, structural genomics, JOI for structural genomics, JCSG; HET: MSE; 2.19A {Helicobacter pylori 26695} SCOP: c.67.1.0 Back     alignment and structure
>2zyj_A Alpha-aminodipate aminotransferase; alpha-aminoadipate aminotransferase; HET: PGU; 1.67A {Thermus thermophilus} PDB: 2egy_A* 2dtv_A* 2zg5_A* 2zp7_A* 2z1y_A* 3cbf_A* Back     alignment and structure
>2x3l_A ORN/Lys/Arg decarboxylase family protein; lyase; HET: LLP; 2.00A {Staphylococcus aureus} Back     alignment and structure
>1uu1_A Histidinol-phosphate aminotransferase; histidine biosynthesis, pyridoxal phosphate, complete proteome; HET: PMP HSA; 2.38A {Thermotoga maritima} SCOP: c.67.1.1 PDB: 1uu0_A 1h1c_A* 1uu2_A* 2f8j_A* Back     alignment and structure
>3jtx_A Aminotransferase; NP_283882.1, structural genomics, joint CE structural genomics, JCSG, protein structure initiative; HET: LLP MES; 1.91A {Neisseria meningitidis Z2491} Back     alignment and structure
>1c4k_A Protein (ornithine decarboxylase); lyase; HET: PLP GTP; 2.70A {Lactobacillus SP} SCOP: c.23.1.4 c.67.1.5 d.125.1.1 PDB: 1ord_A* Back     alignment and structure
>3ei9_A LL-diaminopimelate aminotransferase; lysine biosynthesis, pyridoxal 5' phosphat external aldimine, chloroplast, pyridox phosphate; HET: PL6; 1.55A {Arabidopsis thaliana} PDB: 3ei8_A* 3eib_A* 3ei6_A* 2z1z_A* 3ei5_A* 2z20_A* 3ei7_A 3eia_A* Back     alignment and structure
>3ju7_A Putative PLP-dependent aminotransferase; NP_978343.1, struct genomics, joint center for structural genomics, JCSG; HET: LLP PGE; 2.19A {Bacillus cereus atcc 10987} Back     alignment and structure
>1d2f_A MALY protein; aminotransferase fold, large PLP-binding domain, small C-TER domain, open alpha-beta structure., transferase; HET: PLP; 2.50A {Escherichia coli} SCOP: c.67.1.3 Back     alignment and structure
>2o1b_A Aminotransferase, class I; aminotrasferase; HET: PLP; 1.95A {Staphylococcus aureus} Back     alignment and structure
>1vef_A Acetylornithine/acetyl-lysine aminotransferase; PLP, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: PLP; 1.35A {Thermus thermophilus} SCOP: c.67.1.4 PDB: 1wkg_A* 1wkh_A* Back     alignment and structure
>2vyc_A Biodegradative arginine decarboxylase; pyridoxal phosphate, PLP-dependent E lyase, acid resistance; HET: LLP; 2.4A {Escherichia coli} Back     alignment and structure
>2ay1_A Aroat, aromatic amino acid aminotransferase; HET: PLP AHC; 2.20A {Paracoccus denitrificans} SCOP: c.67.1.1 PDB: 1ay5_A* 1ay4_A* 1ay8_A* 2ay2_A* 2ay3_A* 2ay4_A* 2ay5_A* 2ay6_A* 2ay7_A* 2ay8_A* 2ay9_A* Back     alignment and structure
>2po3_A 4-dehydrase; external aldimine, PLP, aminotransferase, TDP-sugar; HET: T4K; 2.10A {Streptomyces venezuelae} Back     alignment and structure
>1gc0_A Methionine gamma-lyase; pyridoxal-5'-phosphate; HET: LLP; 1.70A {Pseudomonas putida} SCOP: c.67.1.3 PDB: 1gc2_A* 1pg8_A* 1ukj_A* 2o7c_A* Back     alignment and structure
>1vp4_A Aminotransferase, putative; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: MSE PLP; 1.82A {Thermotoga maritima} SCOP: c.67.1.1 Back     alignment and structure
>3qm2_A Phosphoserine aminotransferase; structural genomics, center for structural genomics of infec diseases, csgid; 2.25A {Salmonella enterica subsp} PDB: 1bjn_A* 1bjo_A* 3qbo_A* Back     alignment and structure
>3ruy_A Ornithine aminotransferase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha and beta protein; HET: LLP; 2.65A {Bacillus anthracis} SCOP: c.67.1.0 Back     alignment and structure
>3kki_A CAI-1 autoinducer synthase; quorum sensing, CQSA, P virulence, acyltransferase, aminotransferase, pyridoxal PHO transferase; HET: PLP; 1.80A {Vibrio cholerae} PDB: 3hqt_A* 2wk9_A* 2wk8_A* 2wka_A* 2wk7_A Back     alignment and structure
>3aow_A Putative uncharacterized protein PH0207; protein-PLP-AKG triple complex, schiff-base linkage, kynuren aminotransferase; HET: PLP AKG; 1.56A {Pyrococcus horikoshii} PDB: 3aov_A* 3ath_A* 3av7_A* 1x0m_A 1wst_A* Back     alignment and structure
>2zc0_A Alanine glyoxylate transaminase; alanine:glyoxylate aminotransferase, archaea, thermococcus L transferase; HET: PMP; 2.30A {Thermococcus litoralis} Back     alignment and structure
>1cs1_A CGS, protein (cystathionine gamma-synthase); lyase, LLP-dependent enzymes, methionine biosynthesis; HET: LLP DHD; 1.50A {Escherichia coli} SCOP: c.67.1.3 Back     alignment and structure
>2fq6_A Cystathionine beta-lyase; protein-inhibitor complex, PLP cofactor covalently bound to inhibitor; HET: P3F; 1.78A {Escherichia coli} SCOP: c.67.1.3 PDB: 2gqn_A* 1cl1_A* 1cl2_A* Back     alignment and structure
>1jg8_A L-ALLO-threonine aldolase; glycine biosynthesis, pyridoxal-5'- phosphate, calcium binding site, structural genomics, PSI; HET: LLP; 1.80A {Thermotoga maritima} SCOP: c.67.1.1 PDB: 1lw4_A* 1lw5_A* 1m6s_A* 2fm1_A* Back     alignment and structure
>3b46_A Aminotransferase BNA3; kynurenine aminotransferase, LLP, PLP, cytoplasm, mitochondrion, pyridoxal phosphate; HET: LLP; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3rq1_A Aminotransferase class I and II; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, alpha-beta structure, cytosol; HET: AKG GOL; 2.20A {Veillonella parvula} Back     alignment and structure
>2r2n_A Kynurenine/alpha-aminoadipate aminotransferase mitochondrial; alpha & beta protein, PLP-dependent transferase, aminotransf mitochondrion; HET: PMP KYN; 1.95A {Homo sapiens} PDB: 2qlr_A* 3dc1_A* 3ue8_A* 2vgz_A* 2xh1_A* Back     alignment and structure
>2rfv_A Methionine gamma-lyase; pyridoxal-5'-phosphate, PLP-dependent enzyme; HET: LLP; 1.35A {Citrobacter freundii} PDB: 1y4i_A* 3jwa_A* 3jw9_A* 3jwb_A* 3mkj_A* Back     alignment and structure
>2cb1_A O-acetyl homoserine sulfhydrylase; PLP enzyme, lyase, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: LLP; 2.0A {Thermus thermophilus} Back     alignment and structure
>1ajs_A Aspartate aminotransferase; PIG, in the presence of ligand 2-methylaspartate; HET: LLP PLA; 1.60A {Sus scrofa} SCOP: c.67.1.1 PDB: 1ajr_A* 3ii0_A* 1aat_A 2cst_A* Back     alignment and structure
>4adb_A Succinylornithine transaminase; transferase, PLP enzymes, aminotransferase; HET: PLP; 2.20A {Escherichia coli} PDB: 4adc_A* 4add_A* 4ade_A Back     alignment and structure
>2x5f_A Aspartate_tyrosine_phenylalanine pyridoxal-5' phosphate-dependent aminotransferase...; HET: PLP EPE; 1.80A {Staphylococcus aureus} Back     alignment and structure
>1qgn_A Protein (cystathionine gamma-synthase); methionine biosynthesis, pyridoxal 5'-phosphate, gamma-famil; HET: PLP; 2.90A {Nicotiana tabacum} SCOP: c.67.1.3 PDB: 1i41_A* 1i48_A* 1i43_A* Back     alignment and structure
>3fsl_A Aromatic-amino-acid aminotransferase; tyrosine aminotransferase, pyridoxal phosphate, internal ALD schiff base, amino-acid biosynthesis; HET: PLR; 2.35A {Escherichia coli k-12} SCOP: c.67.1.1 PDB: 3tat_A* Back     alignment and structure
>2ord_A Acoat, acetylornithine aminotransferase; TM1785, acetylornithine aminotransferase (EC 2.6.1.11) (ACOA structural genomics; HET: MSE PLP; 1.40A {Thermotoga maritima MSB8} PDB: 2e54_A* Back     alignment and structure
>1iay_A ACC synthase 2, 1-aminocyclopropane-1-carboxylate synthase 2; protein-cofactor-inhibitor complex, V6-dependent enzyme, LYA; HET: PLP AVG; 2.70A {Solanum lycopersicum} SCOP: c.67.1.4 PDB: 1iax_A* Back     alignment and structure
>3qhx_A Cystathionine gamma-synthase METB (CGS); structural genomics, seattle structural genomics center for infectious disease, ssgcid, CGS_LIKE; HET: LLP EPE; 1.65A {Mycobacterium ulcerans} SCOP: c.67.1.0 PDB: 3qi6_A* Back     alignment and structure
>1s0a_A Adenosylmethionine-8-amino-7-oxononanoate aminotransferase; fold type I, subclass II, homodimer; HET: LLP; 1.71A {Escherichia coli} SCOP: c.67.1.4 PDB: 1qj5_A* 1mlz_A* 1qj3_A* 1mly_A* 1s06_A* 1s08_A* 1s09_A* 1s07_A* 1mgv_A* 1dty_A* Back     alignment and structure
>3tcm_A Alanine aminotransferase 2; pyridoxal phosphate (PLP)-binding; HET: DCS; 2.71A {Hordeum vulgare} Back     alignment and structure
>2aeu_A Hypothetical protein MJ0158; selenocysteine synthase, PLP, pyridoxal phosphate, HOMO- oligomerization, unknown function; 1.70A {Methanocaldococcus jannaschii} SCOP: c.67.1.8 PDB: 2aev_A* Back     alignment and structure
>3piu_A 1-aminocyclopropane-1-carboxylate synthase; fruit ripening, ethylene biosynthesis, lyase, pyridoxal 5'-P binding; HET: LLP PLR; 1.35A {Malus domestica} SCOP: c.67.1.4 PDB: 1m4n_A* 1m7y_A* 1ynu_A* 1b8g_A* Back     alignment and structure
>1yaa_A Aspartate aminotransferase; HET: PLP; 2.05A {Saccharomyces cerevisiae} SCOP: c.67.1.1 Back     alignment and structure
>3a8u_X Omega-amino acid--pyruvate aminotransferase; large pleated sheet, transaminase, pyridox phosphate; HET: PLP; 1.40A {Pseudomonas putida} Back     alignment and structure
>1n8p_A Cystathionine gamma-lyase; three open alpha/beta structures; HET: PLP; 2.60A {Saccharomyces cerevisiae} SCOP: c.67.1.3 Back     alignment and structure
>4f4e_A Aromatic-amino-acid aminotransferase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: LLP; 1.80A {Burkholderia pseudomallei} PDB: 4eff_A* Back     alignment and structure
>1sff_A 4-aminobutyrate aminotransferase; enzyme complexes; HET: IK2; 1.90A {Escherichia coli} SCOP: c.67.1.4 PDB: 1sf2_A* 1szk_A* 1szu_A* 1szs_A* Back     alignment and structure
>3g7q_A Valine-pyruvate aminotransferase; NP_462565.1, structur genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: MSE; 1.80A {Salmonella typhimurium} Back     alignment and structure
>2q7w_A Aspartate aminotransferase; mechanism-based inhibitor, PLP, sadta, PH dependence; HET: KST PSZ PMP GOL; 1.40A {Escherichia coli} SCOP: c.67.1.1 PDB: 2qa3_A* 2qb2_A* 2qb3_A* 2qbt_A* 3qn6_A* 3pa9_A* 1aaw_A* 1amq_A* 1ams_A* 1arg_A* 1amr_A* 1art_A* 1asa_A* 1asd_A* 1ase_A* 1asl_A* 1asm_A* 1asn_A* 1c9c_A* 1cq6_A* ... Back     alignment and structure
>2oat_A Ornithine aminotransferase; 5-fluoromethylornithine, PLP-dependent ENZ pyridoxal phosphate; HET: PFM; 1.95A {Homo sapiens} SCOP: c.67.1.4 PDB: 1oat_A* 2byj_A* 2byl_A* 1gbn_A* 2can_A* Back     alignment and structure
>3if2_A Aminotransferase; YP_265399.1, structura genomics, joint center for structural genomics, JCSG, prote structure initiative, PSI-2; HET: PLP; 2.50A {Psychrobacter arcticus 273-4} Back     alignment and structure
>3jzl_A Putative cystathionine beta-lyase involved in ALU resistance; putative cystathionine beta-lyase involved in aluminum resis structural genomics; HET: LLP; 1.91A {Listeria monocytogenes str} PDB: 3fd0_A* Back     alignment and structure
>1e5e_A MGL, methionine gamma-lyase; methionine biosynthesis, PLP-dependent enzymes, C-S gamma lyase; HET: PPJ; 2.18A {Trichomonas vaginalis} SCOP: c.67.1.3 PDB: 1e5f_A* Back     alignment and structure
>3bwn_A AT1G70560, L-tryptophan aminotransferase; auxin synthesis, pyridoxal-5'- phosphate, indole-3-pyruvate; HET: LLP PMP PHE; 2.25A {Arabidopsis thaliana} PDB: 3bwo_A* Back     alignment and structure
>2pb2_A Acetylornithine/succinyldiaminopimelate aminotran; ARGD, pyridoxal 5'-phosphate, arginine metabolism, lysine biosynthesis, gabaculine; HET: PLP; 1.91A {Salmonella typhimurium} PDB: 2pb0_A* Back     alignment and structure
>3nx3_A Acoat, acetylornithine aminotransferase; csgid, structural genomics, center for structural genomics O infectious diseases; 1.80A {Campylobacter jejuni subsp} Back     alignment and structure
>1z7d_A Ornithine aminotransferase; structural genomics consortium, SGC, malaria; 2.10A {Plasmodium yoelii yoelii} SCOP: c.67.1.4 PDB: 3lg0_A 3ntj_A Back     alignment and structure
>3cog_A Cystathionine gamma-lyase; CTH, PLP, propargylglycine, SGC, inhibitor, structural genom stockholm, structural genomics consortium; HET: PLP; 2.00A {Homo sapiens} PDB: 2nmp_A* 3elp_B Back     alignment and structure
>3acz_A Methionine gamma-lyase; L-methionine; HET: LLP; 1.97A {Entamoeba histolytica} PDB: 3aej_A* 3ael_A* 3aem_A* 3aen_A* 3aeo_A* 3aep_A* Back     alignment and structure
>3ez1_A Aminotransferase MOCR family; YP_604413.1, struct genomics, joint center for structural genomics, JCSG; 2.60A {Deinococcus geothermalis dsm 11300} Back     alignment and structure
>2ctz_A O-acetyl-L-homoserine sulfhydrylase; crystal, O-acetyl homoserine sulfhydrase, structural genomic structural genomics/proteomics initiative; HET: PLP; 2.60A {Thermus thermophilus} SCOP: c.67.1.3 Back     alignment and structure
>3meb_A Aspartate aminotransferase; pyridoxal PHOS transferase, structural genomics, seattle structural genomi for infectious disease, ssgcid; HET: PLP; 1.90A {Giardia lamblia} Back     alignment and structure
>3ndn_A O-succinylhomoserine sulfhydrylase; seattle structural genomics center for infectious disease, S mycobacterium, PLP, schiff base; HET: LLP; 1.85A {Mycobacterium tuberculosis} Back     alignment and structure
>1ax4_A Tryptophanase; tryptophan biosynthesis, tryptophan indole-lyase, pyridoxal 5'-phosphate, monovalent cation binding site; HET: LLP; 2.10A {Proteus vulgaris} SCOP: c.67.1.2 Back     alignment and structure
>3dxv_A Alpha-amino-epsilon-caprolactam racemase; fold-TYPE1, pyridoxal-5'-phosphate dependent racemase, pyrid phosphate, isomerase; HET: PLP; 2.21A {Achromobacter obae} PDB: 2zuk_A* 3dxw_A* Back     alignment and structure
>7aat_A Aspartate aminotransferase; transferase(aminotransferase); HET: PLP; 1.90A {Gallus gallus} SCOP: c.67.1.1 PDB: 1ivr_A* 1map_A* 1maq_A* 1oxo_A* 1oxp_A* 1ama_A* 1tas_A* 1tat_A* 1tar_A* 8aat_A* 9aat_A* 1aka_A* 1akb_A* 1akc_A* 3pd6_A* 3hlm_A* 3pdb_A* Back     alignment and structure
>1zod_A DGD, 2,2-dialkylglycine decarboxylase; pyridoxal, cesium, lyase; HET: MES PLP; 1.80A {Burkholderia cepacia} SCOP: c.67.1.4 PDB: 1dka_A* 1m0o_A* 1m0p_A* 1m0n_A* 1zc9_A* 1zob_A* 1m0q_A* 2dkb_A* 1dgd_A* 1dge_A* 1d7u_A* 1d7s_A* 1d7r_A* 1d7v_A* 1z3z_A* Back     alignment and structure
>2oqx_A Tryptophanase; lyase, pyridoxal phosphate, tryptophan catabolism; HET: CME EPE; 1.90A {Escherichia coli} SCOP: c.67.1.2 PDB: 2c44_A 2v1p_A* 2v0y_A* Back     alignment and structure
>3i16_A Aluminum resistance protein; YP_878183.1, carbon-sulfur lyase involved in aluminum resist structural genomics; HET: MSE TLA PLP; 2.00A {Clostridium novyi} PDB: 3gwp_A* Back     alignment and structure
>3ppl_A Aspartate aminotransferase; dimer, PLP-dependent transferase-like fold structural genomics, joint center for structural genomics; HET: MSE PLP UNL; 1.25A {Corynebacterium glutamicum} Back     alignment and structure
>3ihj_A Alanine aminotransferase 2; helix, structural genomics, structural genomics consortium, pyridoxal phosphate; HET: PLP; 2.30A {Homo sapiens} Back     alignment and structure
>3ht4_A Aluminum resistance protein; lyase, putative cystathionine BEAT-lyase, aluminium resistance protein, Q81A77_baccr, NESG, BCR213; 2.90A {Bacillus cereus atcc 14579} Back     alignment and structure
>3f6t_A Aspartate aminotransferase; YP_194538.1, STRU genomics, joint center for structural genomics, JCSG, prote structure initiative; HET: LLP; 2.15A {Lactobacillus acidophilus ncfm} Back     alignment and structure
>3hvy_A Cystathionine beta-lyase family protein, YNBB B.S ortholog; NP_348457.1, putative cystathionine beta-lyase involved in A resistance; HET: LLP MSE; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>3ri6_A O-acetylhomoserine sulfhydrylase; PYR 5'-phosphate, gamma-elimination, direct sulfhydrylation, CY metabolism, protein thiocarboxylate, TR; 2.20A {Wolinella succinogenes} Back     alignment and structure
>3pj0_A LMO0305 protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology, lyase; HET: LLP MSE; 1.80A {Listeria monocytogenes} Back     alignment and structure
>1ibj_A CBL, cystathionine beta-lyase; PLP-dependent enzyme, methionine biosynthesis, transsulfurat lyase; HET: PLP; 2.30A {Arabidopsis thaliana} SCOP: c.67.1.3 Back     alignment and structure
>2eo5_A 419AA long hypothetical aminotransferase; PLP enzyme, structural genomics, NPPSFA, N project on protein structural and functional analyses; HET: PLP; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>2cjg_A L-lysine-epsilon aminotransferase; internal aldimine, pyridoxal phosphate, PLP, RV3290C, lysine amino transferase; HET: PMP; 1.95A {Mycobacterium tuberculosis} PDB: 2cjd_A* 2cin_A* 2cjh_A* 2jjg_A* 2jje_A* 2jjh_A* 2jjf_A Back     alignment and structure
>3d6k_A Putative aminotransferase; APC82464, corynebacterium diphthe structural genomics, PSI-2, protein structure initiative; 2.00A {Corynebacterium diphtheriae} Back     alignment and structure
>3lws_A Aromatic amino acid beta-eliminating lyase/threonine aldolase; structural genomics, joint center for structural genomics, JCSG; HET: LLP MSE; 2.00A {Exiguobacterium sibiricum} Back     alignment and structure
>3n75_A LDC, lysine decarboxylase, inducible; pyridoxal-5'-phosphate dependent decarboxylase, acid stress stringent response; HET: LLP G4P P6G; 2.00A {Escherichia coli} PDB: 3q16_A* Back     alignment and structure
>3i4j_A Aminotransferase, class III; structural GENOMICS,NYSGXRC, target 11246C, deino radiodurans, pyridoxal phosphate, transfe PSI-2; 1.70A {Deinococcus radiodurans} Back     alignment and structure
>3fq8_A Glutamate-1-semialdehyde 2,1-aminomutase; drug resistance, microev0lution, integrated approach, chlorophyll biosynthesis; HET: PMP; 2.00A {Synechococcus elongatus pcc 6301} SCOP: c.67.1.4 PDB: 2hp1_A* 2hoz_A* 2hoy_A* 2hp2_A* 3fq7_A* 3usf_A* 2gsa_A* 3gsb_A* 4gsa_A* 3fqa_A* 2cfb_A* Back     alignment and structure
>3n5m_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, csgid; 2.05A {Bacillus anthracis} Back     alignment and structure
>3nmy_A Xometc, cystathionine gamma-lyase-like protein; Cys-Met metabolism PLP-dependent enzyme family, CYST gamma lyase, pyridoxal-phosphate; HET: PLP; 2.07A {Xanthomonas oryzae PV} SCOP: c.67.1.0 PDB: 3e6g_A* 3nnp_A* Back     alignment and structure
>3dod_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; aminotransferase, biotin biosynthesis, pyridoxal phosphate, adenosyl-L-methionine; HET: PLP; 1.90A {Bacillus subtilis} SCOP: c.67.1.0 PDB: 3drd_A 3du4_A* Back     alignment and structure
>3l44_A Glutamate-1-semialdehyde 2,1-aminomutase 1; alpha beta class, PLP-dependent transferase-like, bacillus A csgid, porphyrin biosynthesis; HET: LLP; 2.05A {Bacillus anthracis} SCOP: c.67.1.0 Back     alignment and structure
>2ez2_A Beta-tyrosinase, tyrosine phenol-lyase; PLP-dependent enzyme, pyridoxal-5'-phosphate, domain lyase; 1.85A {Citrobacter freundii} PDB: 2ez1_A 2vlf_A* 2vlh_A* 2yct_A* 1tpl_A 2tpl_A* 2ycn_A* 2yhk_A* 2ycp_A* 1c7g_A* Back     alignment and structure
>3k28_A Glutamate-1-semialdehyde 2,1-aminomutase 2; biosynthesis of cofactors, prosthetic groups, and carriers, csgid, cytoplasm, isomerase; HET: MSE PLP; 1.95A {Bacillus anthracis str} SCOP: c.67.1.4 PDB: 3bs8_A* Back     alignment and structure
>3b1d_A Betac-S lyase; HET: PLP PLS EPE; 1.66A {Streptococcus anginosus} PDB: 3b1c_A* 3b1e_A* Back     alignment and structure
>4e77_A Glutamate-1-semialdehyde 2,1-aminomutase; structural genomics, center for structural genomics of infec diseases, csgid, porphyrin biosynthesis; 2.00A {Yersinia pestis} Back     alignment and structure
>3tfu_A Adenosylmethionine-8-amino-7-oxononanoate aminotr; transferase, transferase-transferase inhibitor complex; HET: PL8; 1.94A {Mycobacterium tuberculosis} PDB: 3tft_A* 3bv0_A* 3lv2_A* Back     alignment and structure
>2zy4_A L-aspartate beta-decarboxylase; pyridoxal 5'-phosphate, aminotransferase, lyase; HET: PLP; 2.00A {Alcaligenes faecalis subsp} PDB: 2zy3_A* 2zy5_A* 3fdd_A* 2zy2_A* Back     alignment and structure
>3gju_A Putative aminotransferase; pyridoxal phosphate, PLP-dependent transferase-like fold, ST genomics, joint center for structural genomics, JCSG; HET: MSE LLP PLP; 1.55A {Mesorhizobium loti} PDB: 3fcr_A* Back     alignment and structure
>3oks_A 4-aminobutyrate transaminase; ssgcid, transferase, seattle structural genomics center for infectious disease; HET: LLP; 1.80A {Mycobacterium smegmatis} PDB: 3r4t_A* 3q8n_A Back     alignment and structure
>4ffc_A 4-aminobutyrate aminotransferase (GABT); structural genomics, niaid, national institute of allergy AN infectious diseases; HET: LLP; 1.80A {Mycobacterium abscessus} Back     alignment and structure
>3hmu_A Aminotransferase, class III; structural genomics, pyridoxal phosphate, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi} Back     alignment and structure
>4a6r_A Omega transaminase; transferase, PLP-binding enzyme, transaminase fold type I; HET: TA8; 1.35A {Chromobacterium violaceum} PDB: 4a6t_A* 4a6u_A 4a72_A* 4ah3_A* Back     alignment and structure
>3i5t_A Aminotransferase; pyridoxal 5'-phosphate, PSI-2, NYSGXRC, ST genomics, protein structure initiative; HET: PLP; 2.00A {Rhodobacter sphaeroides 2} Back     alignment and structure
>2cy8_A D-phgat, D-phenylglycine aminotransferase; structural genomics, NPPSFA, national PROJ protein structural and functional analyses; 2.30A {Pseudomonas stutzeri} Back     alignment and structure
>4eu1_A Mitochondrial aspartate aminotransferase; ssgcid, structural genomics, SEA structural genomics center for infectious disease; HET: LLP; 2.30A {Trypanosoma brucei} Back     alignment and structure
>2hox_A ALLIIN lyase 1; cysteine sulphoxide lyase, ALLIINASE; HET: NAG FUC BMA P1T; 1.40A {Allium sativum} SCOP: c.67.1.1 PDB: 2hor_A* 1lk9_A* Back     alignment and structure
>2c0r_A PSAT, phosphoserine aminotransferase; pyridoxal-5'-phosphate, pyridine serine biosynthesis, amino-acid biosynthesis, pyridoxal phosphate; HET: PLP; 1.2A {Bacillus circulans} SCOP: c.67.1.4 PDB: 1bt4_A* 1w3u_A* Back     alignment and structure
>2epj_A Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzyme, GSA, structural genomics, NPPSFA; HET: PMP; 1.70A {Aeropyrum pernix} PDB: 2zsl_A* 2zsm_A* Back     alignment and structure
>3bc8_A O-phosphoseryl-tRNA(SEC) selenium transferase; disorder-order transition, phosphate-loop, pyridoxal phospha selenocysteine synthase (SECS, sepsecs); HET: LLP; 1.65A {Mus musculus} SCOP: c.67.1.9 PDB: 3bca_A* 3bcb_A* Back     alignment and structure
>2e7u_A Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzyme, GSA, structural genomics, NPPSFA; HET: PMP; 1.90A {Thermus thermophilus} Back     alignment and structure
>4h51_A Aspartate aminotransferase; ssgcid, structural genomics, seattle struc genomics center for infectious disease, aspartate aminotran transferase; HET: LLP; 1.85A {Leishmania major} Back     alignment and structure
>4ao9_A Beta-phenylalanine aminotransferase; HET: PLP; 1.50A {Variovorax paradoxus} PDB: 4aoa_A* Back     alignment and structure
>1w23_A Phosphoserine aminotransferase; pyridoxal-5'-phosphate; HET: PGE PLP EPE; 1.08A {Bacillus alcalophilus} SCOP: c.67.1.4 PDB: 2bhx_A* 2bi1_A* 2bi2_A* 2bi3_A* 2bi5_A* 2bi9_A* 2bia_A* 2bie_A* 2big_A* Back     alignment and structure
>2yky_A Beta-transaminase; transferase; HET: PLP SFE; 1.69A {Mesorhizobium SP} PDB: 2ykv_A* 2yku_A* 2ykx_A* Back     alignment and structure
>3ou5_A Serine hydroxymethyltransferase, mitochondrial; structural genomics, STRU genomics consortium, SGC; 2.04A {Homo sapiens} Back     alignment and structure
>3hl2_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine, sepsecs, protein-RNA complex, alternative splicing, cytoplasm, protein biosynthesis, pyridoxal phosphate, selenium; HET: PLR SEP; 2.81A {Homo sapiens} Back     alignment and structure
>3ffr_A Phosphoserine aminotransferase SERC; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: LLP MSE P33; 1.75A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>2fyf_A PSAT, phosphoserine aminotransferase; PLP-dependent enzyme, dimer, structural genomics; HET: PLP; 1.50A {Mycobacterium tuberculosis} PDB: 3vom_A* Back     alignment and structure
>3k7y_A Aspartate aminotransferase; aminotrans pyridoxal phosphate; HET: PLP; 2.80A {Plasmodium falciparum} SCOP: c.67.1.0 Back     alignment and structure
>1ohv_A 4-aminobutyrate aminotransferase; PLP-dependent enzyme, 4- AMIN acid, antiepileptic drug target; HET: PLP; 2.3A {Sus scrofa} SCOP: c.67.1.4 PDB: 1ohw_A* 1ohy_A* Back     alignment and structure
>3ke3_A Putative serine-pyruvate aminotransferase; structural genomi center for structural genomics, JCSG, protein structure INI PSI-2; HET: LLP; 2.20A {Psychrobacter arcticus 273-4} Back     alignment and structure
>3f0h_A Aminotransferase; RER070207000802, structural genomics, JOIN for structural genomics, JCSG; HET: MSE LLP; 1.70A {Eubacterium rectale} Back     alignment and structure
>4atq_A 4-aminobutyrate transaminase; transferase; HET: PLP; 2.75A {Arthrobacter aurescens} PDB: 4atp_A* Back     alignment and structure
>4e3q_A Pyruvate transaminase; aminotransferase, transferase; HET: PMP; 1.90A {Vibrio fluvialis} PDB: 4e3r_A* 3nui_A Back     alignment and structure
>1ajs_A Aspartate aminotransferase; PIG, in the presence of ligand 2-methylaspartate; HET: LLP PLA; 1.60A {Sus scrofa} SCOP: c.67.1.1 PDB: 1ajr_A* 3ii0_A* 1aat_A 2cst_A* Back     alignment and structure
>1uu1_A Histidinol-phosphate aminotransferase; histidine biosynthesis, pyridoxal phosphate, complete proteome; HET: PMP HSA; 2.38A {Thermotoga maritima} SCOP: c.67.1.1 PDB: 1uu0_A 1h1c_A* 1uu2_A* 2f8j_A* Back     alignment and structure
>2dr1_A PH1308 protein, 386AA long hypothetical serine aminotransferase; PLP, structural genomics, NPPSFA; HET: PLP; 1.90A {Pyrococcus horikoshii} Back     alignment and structure
>1kmj_A Selenocysteine lyase; persulfide perselenide NIFS pyridoxal phosphate, structural PSI, protein structure initiative; HET: PLP; 2.00A {Escherichia coli} SCOP: c.67.1.3 PDB: 1i29_A* 1jf9_A* 1kmk_A* 1c0n_A* Back     alignment and structure
>1m32_A 2-aminoethylphosphonate-pyruvate aminotransferase; PLP-dependent aminotransferase fold; HET: PLP; 2.20A {Salmonella typhimurium} SCOP: c.67.1.3 Back     alignment and structure
>1elu_A L-cysteine/L-cystine C-S lyase; FES cluster biosynthesis, pyridoxal 5'-phosphate, thiocystei aminoacrylate, enzyme-product complex; HET: PDA; 1.55A {Synechocystis SP} SCOP: c.67.1.3 PDB: 1elq_A* 1n2t_A* 1n31_A* Back     alignment and structure
>1yaa_A Aspartate aminotransferase; HET: PLP; 2.05A {Saccharomyces cerevisiae} SCOP: c.67.1.1 Back     alignment and structure
>2huf_A Alanine glyoxylate aminotransferase; alpha and beta protein, PLP-dependent transferase; HET: LLP; 1.75A {Aedes aegypti} PDB: 2hui_A* 2huu_A* Back     alignment and structure
>1t3i_A Probable cysteine desulfurase; PLP-binding enzyme, transferase; HET: 2OS PLP; 1.80A {Synechocystis SP} SCOP: c.67.1.3 Back     alignment and structure
>2q7w_A Aspartate aminotransferase; mechanism-based inhibitor, PLP, sadta, PH dependence; HET: KST PSZ PMP GOL; 1.40A {Escherichia coli} SCOP: c.67.1.1 PDB: 2qa3_A* 2qb2_A* 2qb3_A* 2qbt_A* 3qn6_A* 3pa9_A* 1aaw_A* 1amq_A* 1ams_A* 1arg_A* 1amr_A* 1art_A* 1asa_A* 1asd_A* 1ase_A* 1asl_A* 1asm_A* 1asn_A* 1c9c_A* 1cq6_A* ... Back     alignment and structure
>2yrr_A Aminotransferase, class V; structural genomics, NPPSFA, national PROJ protein structural and functional analyses; HET: PLP; 1.86A {Thermus thermophilus} PDB: 2yri_A* Back     alignment and structure
>2bkw_A Alanine-glyoxylate aminotransferase 1; analine-glyoxylate aminotransferase, pyridoxal-5-phosphate, SAD, glycolate pathway; HET: LLP; 2.57A {Saccharomyces cerevisiae} SCOP: c.67.1.3 Back     alignment and structure
>2ch1_A 3-hydroxykynurenine transaminase; PLP-enzyme, kynurenine pathway, transferase; HET: LLP; 2.4A {Anopheles gambiae} SCOP: c.67.1.3 PDB: 2ch2_A* Back     alignment and structure
>2z9v_A Aspartate aminotransferase; pyridoxamine, pyruvate; HET: PXM; 1.70A {Mesorhizobium loti} PDB: 2z9u_A* 2z9w_A* 2z9x_A* Back     alignment and structure
>3zrp_A Serine-pyruvate aminotransferase (AGXT); HET: PLP; 1.75A {Sulfolobus solfataricus} PDB: 3zrq_A* 3zrr_A* Back     alignment and structure
>3lvm_A Cysteine desulfurase; structural genomics, montreal-kingston bacterial structural genomics initiative, BSGI, transferase; HET: PLP; 2.05A {Escherichia coli} PDB: 3lvk_A* 3lvl_B* 3lvj_A* 1p3w_B* Back     alignment and structure
>3b46_A Aminotransferase BNA3; kynurenine aminotransferase, LLP, PLP, cytoplasm, mitochondrion, pyridoxal phosphate; HET: LLP; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2o1b_A Aminotransferase, class I; aminotrasferase; HET: PLP; 1.95A {Staphylococcus aureus} Back     alignment and structure
>3kgw_A Alanine-glyoxylate aminotransferase; AAH25799.1, putative aminotransferase, structural genomics, center for structural genomics, JCSG; HET: PLP; 1.65A {Mus musculus} SCOP: c.67.1.3 PDB: 3kgx_A 3imz_A* 3r9a_A* 1h0c_A* 1j04_A* Back     alignment and structure
>1iug_A Putative aspartate aminotransferase; wild type, pyridoxal-5'-phosphate form, riken structural genomics/proteomics initiative, RSGI; HET: LLP; 2.20A {Thermus thermophilus} SCOP: c.67.1.3 Back     alignment and structure
>4hvk_A Probable cysteine desulfurase 2; transferase and ISCS, transferase; HET: PMP PG4; 1.43A {Archaeoglobus fulgidus} PDB: 4eb7_A* 4eb5_A* Back     alignment and structure
>3nnk_A Ureidoglycine-glyoxylate aminotransferase; PLP-dependent; HET: LLP; 2.58A {Klebsiella pneumoniae} Back     alignment and structure
>4eb5_A Probable cysteine desulfurase 2; scaffold, transferase-metal binding protein complex; HET: PLP EPE; 2.53A {Archaeoglobus fulgidus} PDB: 4eb7_A* Back     alignment and structure
>3isl_A Purine catabolism protein PUCG; pyridoxalphosphate, PLP dependent enzymes, purine metabolism transaminases, aminotransferases; HET: PLP; 2.06A {Bacillus subtilis} Back     alignment and structure
>3vax_A Putative uncharacterized protein DNDA; desulfurase, transferase; HET: PLP; 2.40A {Streptomyces lividans} Back     alignment and structure
>1eg5_A Aminotransferase; PLP-dependent enzymes, iron-sulfur-cluster synthesis, C-S BE transferase; HET: PLP; 2.00A {Thermotoga maritima} SCOP: c.67.1.3 PDB: 1ecx_A* Back     alignment and structure
>3fsl_A Aromatic-amino-acid aminotransferase; tyrosine aminotransferase, pyridoxal phosphate, internal ALD schiff base, amino-acid biosynthesis; HET: PLR; 2.35A {Escherichia coli k-12} SCOP: c.67.1.1 PDB: 3tat_A* Back     alignment and structure
>3e9k_A Kynureninase; kynurenine-L-hydrolase, kynurenine hydrolase, pyridoxal-5'-phosphate, inhibitor complex, 3-hydroxy hippur hydroxyhippuric acid, PLP; HET: PLP 3XH; 1.70A {Homo sapiens} PDB: 2hzp_A* Back     alignment and structure
>1d2f_A MALY protein; aminotransferase fold, large PLP-binding domain, small C-TER domain, open alpha-beta structure., transferase; HET: PLP; 2.50A {Escherichia coli} SCOP: c.67.1.3 Back     alignment and structure
>1vjo_A Alanine--glyoxylate aminotransferase; 17130350, ALR1004, STR genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: PLP; 1.70A {Nostoc SP} SCOP: c.67.1.3 Back     alignment and structure
>2z67_A O-phosphoseryl-tRNA(SEC) selenium transferase; selenocysteine biosynthesis, seven-stranded BETE-strand, PYR 5'-phosphate; HET: PLP; 2.50A {Methanococcus maripaludis} SCOP: c.67.1.9 Back     alignment and structure
>3cai_A Possible aminotransferase; RV3778C; 1.80A {Mycobacterium tuberculosis} Back     alignment and structure
>4f4e_A Aromatic-amino-acid aminotransferase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: LLP; 1.80A {Burkholderia pseudomallei} PDB: 4eff_A* Back     alignment and structure
>3meb_A Aspartate aminotransferase; pyridoxal PHOS transferase, structural genomics, seattle structural genomi for infectious disease, ssgcid; HET: PLP; 1.90A {Giardia lamblia} Back     alignment and structure
>1qz9_A Kynureninase; kynurenine, tryptophan, PLP, vitamin B6, pyridoxal-5'-phosph hydrolase; HET: PLP P3G; 1.85A {Pseudomonas fluorescens} SCOP: c.67.1.3 Back     alignment and structure
>2vi8_A Serine hydroxymethyltransferase; SHMT, E53Q, FTHF, enzyme memory, pyridoxal phosphate, one-carbon metabolism, PLP-dependent enzymes; HET: PLP; 1.67A {Bacillus stearothermophilus} PDB: 2vi9_A* 2via_A* 2vib_A* 1kkj_A* 1kkp_A* 1kl1_A* 1kl2_A* 1yjs_A* 2w7f_A* 2w7d_A* 2w7e_A* 2w7g_A* 2w7h_A* 1yjz_A* 1yjy_A* 2vgu_A* 2vgs_A* 2vgt_A* 2vgv_A* 2vgw_A* ... Back     alignment and structure
>2epj_A Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzyme, GSA, structural genomics, NPPSFA; HET: PMP; 1.70A {Aeropyrum pernix} PDB: 2zsl_A* 2zsm_A* Back     alignment and structure
>2hox_A ALLIIN lyase 1; cysteine sulphoxide lyase, ALLIINASE; HET: NAG FUC BMA P1T; 1.40A {Allium sativum} SCOP: c.67.1.1 PDB: 2hor_A* 1lk9_A* Back     alignment and structure
>3lws_A Aromatic amino acid beta-eliminating lyase/threonine aldolase; structural genomics, joint center for structural genomics, JCSG; HET: LLP MSE; 2.00A {Exiguobacterium sibiricum} Back     alignment and structure
>4eu1_A Mitochondrial aspartate aminotransferase; ssgcid, structural genomics, SEA structural genomics center for infectious disease; HET: LLP; 2.30A {Trypanosoma brucei} Back     alignment and structure
>3b1d_A Betac-S lyase; HET: PLP PLS EPE; 1.66A {Streptococcus anginosus} PDB: 3b1c_A* 3b1e_A* Back     alignment and structure
>3a9z_A Selenocysteine lyase; PLP, cytoplasm, pyridoxal phosphate, transferase; HET: PLP SLP; 1.55A {Rattus norvegicus} PDB: 3a9x_A* 3a9y_A* 3gzd_A* 3gzc_A* 2hdy_A* Back     alignment and structure
>7aat_A Aspartate aminotransferase; transferase(aminotransferase); HET: PLP; 1.90A {Gallus gallus} SCOP: c.67.1.1 PDB: 1ivr_A* 1map_A* 1maq_A* 1oxo_A* 1oxp_A* 1ama_A* 1tas_A* 1tat_A* 1tar_A* 8aat_A* 9aat_A* 1aka_A* 1akb_A* 1akc_A* 3pd6_A* 3hlm_A* 3pdb_A* Back     alignment and structure
>2e7u_A Glutamate-1-semialdehyde 2,1-aminomutase; PLP enzyme, GSA, structural genomics, NPPSFA; HET: PMP; 1.90A {Thermus thermophilus} Back     alignment and structure
>2rfv_A Methionine gamma-lyase; pyridoxal-5'-phosphate, PLP-dependent enzyme; HET: LLP; 1.35A {Citrobacter freundii} PDB: 1y4i_A* 3jwa_A* 3jw9_A* 3jwb_A* 3mkj_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 621
d2c0ra1361 c.67.1.4 (A:2-362) Phosphoserine aminotransferase, 8e-36
d2c0ra1361 c.67.1.4 (A:2-362) Phosphoserine aminotransferase, 4e-19
d1w23a_360 c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT 7e-35
d1w23a_360 c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT 1e-22
d1bjna_360 c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT 2e-28
d1bjna_360 c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT 3e-20
d1h0ca_388 c.67.1.3 (A:) Alanine-glyoxylate aminotransferase 5e-13
d1m32a_361 c.67.1.3 (A:) 2-aminoethylphosphonate transaminase 8e-13
d1vjoa_377 c.67.1.3 (A:) Alanine-glyoxylate aminotransferase 1e-12
d2ch1a1388 c.67.1.3 (A:2-389) 3-hydroxykynurenine transaminas 4e-12
d2bkwa1382 c.67.1.3 (A:3-384) Alanine-glyoxylate aminotransfe 8e-12
d1iuga_348 c.67.1.3 (A:) Subgroup IV putative aspartate amino 2e-11
>d2c0ra1 c.67.1.4 (A:2-362) Phosphoserine aminotransferase, PSAT {Bacillus circulans, subsp. alkalophilus [TaxId: 1397]} Length = 361 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: PLP-dependent transferase-like
superfamily: PLP-dependent transferases
family: GABA-aminotransferase-like
domain: Phosphoserine aminotransferase, PSAT
species: Bacillus circulans, subsp. alkalophilus [TaxId: 1397]
 Score =  135 bits (341), Expect = 8e-36
 Identities = 131/381 (34%), Positives = 188/381 (49%), Gaps = 84/381 (22%)

Query: 52  VINFGAGPAKLPREVLEEVKETLLDYESTGISVMEMSHRSADYTKINNDTQAALRELLNV 111
             NF AGPA LP EVLE  +   +DY+ TG+S+MEMSHR A Y  ++N+ QA L  LL  
Sbjct: 4   AYNFNAGPAALPLEVLERAQAEFVDYQHTGMSIMEMSHRGAVYEAVHNEAQARLLALLGN 63

Query: 112 PNNYKILFLQGGGTGMFAAVAMNLISSSMNVPNNYKILFLQGGGTGMFAAVAMNLIGRTG 171
           P  YK+LF+QGG                                +  FA + MN +    
Sbjct: 64  PTGYKVLFIQGG-------------------------------ASTQFAMIPMNFLKEGQ 92

Query: 172 KADYVVTGSWSKKAAAEAEKYGKVNLVIPKVSKYVSIPDQSTWNRDPEASYLYYCDNETV 231
            A+YV+TGSW+ KA  EA+  G                                      
Sbjct: 93  TANYVMTGSWASKALKEAKLIGDT------------------------------------ 116

Query: 232 DGSWSKKAAAEAEKYGKVNLVIPKVSKYVSIPDQSTWNRDPEASYLYYCDNETVDGVEFN 291
                                  + S Y+++P          A+YL+   NET++G +F 
Sbjct: 117 -----------------HVAASSEASNYMTLPKLQEIQLQDNAAYLHLTSNETIEGAQFK 159

Query: 292 YIPDSQGIPLVSDMSSNFLSRKFDVSKFGVIIAGAQKNIGPAGITVVIVREDLLEYALPI 351
             PD+  +PL+ DMSS+ LSR FD+++FG++ AGAQKN+GP+G+TVVIVREDL+  +   
Sbjct: 160 AFPDTGSVPLIGDMSSDILSRPFDLNQFGLVYAGAQKNLGPSGVTVVIVREDLVAESPKH 219

Query: 352 TPTVFHFKINADNNSVYNTPPTFVVHVIQRVFAWIKRQGGLAKMEQNSLQKSVLLYQEID 411
            PT+  +     NNS+YNTPP+F ++++  V  WI+ +GGL  ++Q + +K+ L+Y  ID
Sbjct: 220 LPTMLRYDTYVKNNSLYNTPPSFGIYMVNEVLKWIEERGGLEGVQQANRKKASLIYDAID 279

Query: 412 NSDKFYECPVQAGCRSRMNVT 432
            S  FY   V    RS MN+T
Sbjct: 280 QSGGFYRGCVDVDSRSDMNIT 300


>d2c0ra1 c.67.1.4 (A:2-362) Phosphoserine aminotransferase, PSAT {Bacillus circulans, subsp. alkalophilus [TaxId: 1397]} Length = 361 Back     information, alignment and structure
>d1w23a_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Bacillus alcalophilus [TaxId: 1445]} Length = 360 Back     information, alignment and structure
>d1w23a_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Bacillus alcalophilus [TaxId: 1445]} Length = 360 Back     information, alignment and structure
>d1bjna_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Escherichia coli [TaxId: 562]} Length = 360 Back     information, alignment and structure
>d1bjna_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Escherichia coli [TaxId: 562]} Length = 360 Back     information, alignment and structure
>d1h0ca_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Human (Homo sapiens) [TaxId: 9606]} Length = 388 Back     information, alignment and structure
>d1m32a_ c.67.1.3 (A:) 2-aminoethylphosphonate transaminase {Salmonella typhimurium [TaxId: 90371]} Length = 361 Back     information, alignment and structure
>d1vjoa_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Cyanobacteria (Nostoc sp. pcc 7120) [TaxId: 103690]} Length = 377 Back     information, alignment and structure
>d2ch1a1 c.67.1.3 (A:2-389) 3-hydroxykynurenine transaminase {Malaria mosquito (Anopheles gambiae) [TaxId: 7165]} Length = 388 Back     information, alignment and structure
>d2bkwa1 c.67.1.3 (A:3-384) Alanine-glyoxylate aminotransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 382 Back     information, alignment and structure
>d1iuga_ c.67.1.3 (A:) Subgroup IV putative aspartate aminotransferase {Thermus thermophilus [TaxId: 274]} Length = 348 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query621
d2c0ra1361 Phosphoserine aminotransferase, PSAT {Bacillus cir 100.0
d1w23a_360 Phosphoserine aminotransferase, PSAT {Bacillus alc 100.0
d1bjna_360 Phosphoserine aminotransferase, PSAT {Escherichia 100.0
d1iuga_348 Subgroup IV putative aspartate aminotransferase {T 100.0
d1h0ca_388 Alanine-glyoxylate aminotransferase {Human (Homo s 100.0
d2ch1a1388 3-hydroxykynurenine transaminase {Malaria mosquito 100.0
d2bkwa1382 Alanine-glyoxylate aminotransferase {Baker's yeast 100.0
d1vjoa_377 Alanine-glyoxylate aminotransferase {Cyanobacteria 100.0
d1m32a_361 2-aminoethylphosphonate transaminase {Salmonella t 100.0
d1jf9a_405 NifS-like protein/selenocysteine lyase {Escherichi 100.0
d1t3ia_408 Probable cysteine desulfurase SufS {Synechocystis 100.0
d1elua_381 Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 100.0
d1p3wa_391 Cysteine desulfurase IscS {Escherichia coli [TaxId 99.95
d1eg5a_376 NifS-like protein/selenocysteine lyase {Thermotoga 99.94
d1qz9a_404 Kynureninase {Pseudomonas fluorescens [TaxId: 294] 99.93
d2e7ja1364 Selenocysteinyl-tRNA synthase (SepSecS) {Archaeogl 99.73
d1pmma_450 Glutamate decarboxylase beta, GadB {Escherichia co 99.53
d1c4ka2462 Ornithine decarboxylase major domain {Lactobacillu 99.33
d1mdoa_376 Aminotransferase ArnB {Salmonella typhimurium [Tax 99.26
d1v72a1345 Phenylserine aldolase PSALD {Pseudomonas putida [T 99.14
d1j32a_388 Aspartate aminotransferase, AAT {Phormidium lapide 99.05
d1gdea_388 Aromatic aminoacid aminotransferase, AroAT {Archae 99.01
d1js3a_476 DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823] 98.98
d3bc8a1445 Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mu 98.97
d1bs0a_383 PLP-dependent acyl-CoA synthase (8-amino-7-oxonano 98.96
d1svva_340 Low-specificity threonine aldolase {Leishmania maj 98.96
d1lc5a_355 L-threonine-O-3-phosphate decarboxylase CobD {Salm 98.9
d1d2fa_361 Modulator in mal gene expression, MalY {Escherichi 98.89
d1bw0a_412 Tyrosine aminotransferase (TAT) {Trypanosoma cruzi 98.86
d1fc4a_401 2-amino-3-ketobutyrate CoA ligase {Escherichia col 98.86
d1b5pa_382 Aspartate aminotransferase, AAT {Thermus thermophi 98.84
d1v2da_368 Glutamine aminotransferase {Thermus thermophilus [ 98.84
d2z67a1434 Selenocysteinyl-tRNA synthase (SepSecS) {Methanoco 98.83
d1wsta1403 Multiple substrate aminotransferase, MSAT {Thermoc 98.81
d1iuga_348 Subgroup IV putative aspartate aminotransferase {T 98.79
d2fnua1371 Spore coat polysaccharide biosynthesis protein C { 98.79
d1xi9a_395 Putative alanine aminotransferase {Pyrococcus furi 98.78
d1vp4a_420 Putative aminotransferase TM1131 {Thermotoga marit 98.75
d1b9ha_384 3-amino-5-hydroxybenzoic acid synthase (AHBA synth 98.72
d1o4sa_375 Aspartate aminotransferase, AAT {Thermotoga mariti 98.71
d1fg7a_354 Histidinol-phosphate aminotransferase HisC {Escher 98.7
d2bwna1396 5-aminolevulinate synthase {Rhodobacter capsulatus 98.56
d2f8ja1334 Histidinol-phosphate aminotransferase HisC {Thermo 98.55
d2r5ea1418 Kynurenine--oxoglutarate transaminase I {Yellowfev 98.54
d1w7la_418 Kynurenine--oxoglutarate transaminase I {Human (Ho 98.52
d1m6sa_343 Low-specificity threonine aldolase {Thermotoga mar 98.46
d2gb3a1389 AAT homologue TM1698 {Thermotoga maritima [TaxId: 98.45
d1kl1a_405 Serine hydroxymethyltransferase {Bacillus stearoth 98.43
d1o69a_374 Aminotransferase homolog WlaK (PglE, Cj1121c) {Cam 98.43
d1m7ya_431 1-aminocyclopropane-1-carboxylate synthase (ACC sy 98.41
d1c7na_394 Cystalysin {Treponema denticola [TaxId: 158]} 98.35
d1rv3a_470 Serine hydroxymethyltransferase {Rabbit (Oryctolag 98.33
d2bkwa1382 Alanine-glyoxylate aminotransferase {Baker's yeast 98.33
d7aata_401 Aspartate aminotransferase, AAT {Chicken (Gallus g 98.32
d1u08a_382 Putative methionine aminotransferase YdbL {Escheri 98.28
d1wyua1437 Glycine dehydrogenase (decarboxylating) subunit 1 98.24
d1iaya_428 1-aminocyclopropane-1-carboxylate synthase (ACC sy 98.23
d1dfoa_416 Serine hydroxymethyltransferase {Escherichia coli 98.22
d2aeua1366 Hypothetical protein MJ0158 {Archaeon Methanococcu 98.03
d2a7va1463 Serine hydroxymethyltransferase {Human (Homo sapie 97.98
d1ax4a_465 Tryptophan indol-lyase (tryptophanase) {Proteus vu 97.97
d1ajsa_412 Aspartate aminotransferase, AAT {Pig (Sus scrofa), 97.95
d1yaaa_412 Aspartate aminotransferase, AAT {Baker's yeast (Sa 97.93
d1wyub1471 Glycine dehydrogenase subunit 2 (P-protein) {Therm 97.91
d2ay1a_394 Aromatic aminoacid aminotransferase, AroAT {Paraco 97.83
d1gc0a_392 Methionine gamma-lyase, MGL {Pseudomonas putida [T 97.78
d1pffa_331 Methionine gamma-lyase, MGL {Trichomonas vaginalis 97.72
d1y4ia1397 Methionine gamma-lyase, MGL {Citrobacter freundii 97.67
d1m32a_361 2-aminoethylphosphonate transaminase {Salmonella t 97.59
d2c0ra1361 Phosphoserine aminotransferase, PSAT {Bacillus cir 97.54
d1c7ga_456 Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 5 97.47
d2hoxa1425 Alliinase {Garlic (Allium sativum) [TaxId: 4682]} 97.4
d1vjoa_377 Alanine-glyoxylate aminotransferase {Cyanobacteria 97.38
d1e5ea_394 Methionine gamma-lyase, MGL {Trichomonas vaginalis 97.31
d2q7wa1396 Aspartate aminotransferase, AAT {Escherichia coli 97.26
d1ibja_380 Cystathionine beta-lyase, CBL {Thale cress (Arabid 97.22
d1sffa_425 4-aminobutyrate aminotransferase, GABA-aminotransf 97.19
d1h0ca_388 Alanine-glyoxylate aminotransferase {Human (Homo s 97.13
d2v1pa1467 Tryptophan indol-lyase (tryptophanase) {Escherichi 97.05
d1cl1a_391 Cystathionine beta-lyase, CBL {Escherichia coli [T 97.05
d1bjna_360 Phosphoserine aminotransferase, PSAT {Escherichia 97.04
d2ch1a1388 3-hydroxykynurenine transaminase {Malaria mosquito 97.03
d1w23a_360 Phosphoserine aminotransferase, PSAT {Bacillus alc 96.98
d1cs1a_384 Cystathionine gamma-synthase, CGS {Escherichia col 96.88
d1qgna_398 Cystathionine gamma-synthase, CGS {Common tobacco 96.75
d3tata_397 Aromatic aminoacid aminotransferase, AroAT {Escher 96.71
d1elua_381 Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 96.66
d2ctza1421 O-acetyl-L-homoserine sulfhydrylase {Thermus therm 96.65
d1s0aa_429 Adenosylmethionine-8-amino-7-oxononanoate aminotra 96.43
d1z7da1404 Ornithine aminotransferase {Plasmodium yoelii yoel 96.31
d2byla1404 Ornithine aminotransferase {Human (Homo sapiens) [ 96.13
d2gsaa_427 Glutamate-1-semialdehyde aminomutase (aminotransfe 96.0
d1vefa1387 Acetylornithine/acetyl-lysine aminotransferase Arg 95.69
d1n8pa_393 Cystathionine gamma-lyase (CYS3) {Baker's yeast (S 95.1
d1jf9a_405 NifS-like protein/selenocysteine lyase {Escherichi 95.08
d1t3ia_408 Probable cysteine desulfurase SufS {Synechocystis 94.61
d1zoda1431 Dialkylglycine decarboxylase {Pseudomonas cepacia 94.33
>d2c0ra1 c.67.1.4 (A:2-362) Phosphoserine aminotransferase, PSAT {Bacillus circulans, subsp. alkalophilus [TaxId: 1397]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: PLP-dependent transferase-like
superfamily: PLP-dependent transferases
family: GABA-aminotransferase-like
domain: Phosphoserine aminotransferase, PSAT
species: Bacillus circulans, subsp. alkalophilus [TaxId: 1397]
Probab=100.00  E-value=8.6e-50  Score=418.41  Aligned_cols=355  Identities=41%  Similarity=0.710  Sum_probs=280.3

Q ss_pred             CCceeccCCCCCCCHHHHHHHHHHHHhhccCCCcccccccccHHHHHHHHHHHHHHHHHhCCCCCCEEEEEcCCcchhhh
Q psy8733          50 HPVINFGAGPAKLPREVLEEVKETLLDYESTGISVMEMSHRSADYTKINNDTQAALRELLNVPNNYKILFLQGGGTGMFA  129 (621)
Q Consensus        50 ~~~~lf~aGPs~~P~~Vlea~~~~l~~~~~~g~sv~e~shrs~~f~~i~~~ar~~La~Ll~~p~~yeI~f~~gggT~~~~  129 (621)
                      .|.|||+|||+++|++|+++|++++.+|.+.|+|+++++|||++|.++++++|++|++||++|++|+|+|++||||.   
T Consensus         2 ~~~~~F~pGP~~vp~~V~eam~~~~~~~~~~~~~~~~~sHRs~ef~~~~~~~r~~l~~l~~~~~~~~i~~~~gs~t~---   78 (361)
T d2c0ra1           2 ERAYNFNAGPAALPLEVLERAQAEFVDYQHTGMSIMEMSHRGAVYEAVHNEAQARLLALLGNPTGYKVLFIQGGAST---   78 (361)
T ss_dssp             CCCEECCSSSCCCCHHHHHHHHHTSSSSTTSSSCGGGSCTTSHHHHHHHHHHHHHHHHHTTCCSSEEEEEESSHHHH---
T ss_pred             CCCcccCCCCcCCCHHHHHHHHHHHhhhcccCccccccCcCCHHHHHHHHHHHHHHHHHhCCCCCCEEEEECCCchH---
Confidence            47899999999999999999999999999999999999999999999999999999999999999999999887777   


Q ss_pred             HHHHHHhhhccCCCCCceeEeecCCcchhHHHHHHHhhCCCCcEEEEEcChHHHHHHHHHHHhCCceeeecccccccccC
Q psy8733         130 AVAMNLISSSMNVPNNYKILFLQGGGTGMFAAVAMNLIGRTGKADYVVTGSWSKKAAAEAEKYGKVNLVIPKVSKYVSIP  209 (621)
Q Consensus       130 a~alNlla~~~~~~~gd~Il~~~~~~~~~feav~~NL~~~g~~~~~v~tG~~~~~~~~~a~~~G~~~~~~~~~~~~~~~~  209 (621)
                                                  .++++..|+.+++++++++.+|.|+++|.+.++++|.....           
T Consensus        79 ----------------------------~~ea~~~~l~~~~~~~l~~~~g~~~~~~~~~~~~~g~~~~~-----------  119 (361)
T d2c0ra1          79 ----------------------------QFAMIPMNFLKEGQTANYVMTGSWASKALKEAKLIGDTHVA-----------  119 (361)
T ss_dssp             ----------------------------HHHHHHHHHCCTTCEEEEEECSHHHHHHHHHHHHHSCEEEE-----------
T ss_pred             ----------------------------HHHHHHhccccCCCceEEEeechhhhhhhhhhhhcCceeee-----------
Confidence                                        56667888888899999999999999999999999975433           


Q ss_pred             CCCCCCCCCCccccccccCccccCccchhhhHHHhhhcccccccccCCCccCCCCccccCCCCCceEEEEeccccccccc
Q psy8733         210 DQSTWNRDPEASYLYYCDNETVDGSWSKKAAAEAEKYGKVNLVIPKVSKYVSIPDQSTWNRDPEASYLYYCDNETVDGVE  289 (621)
Q Consensus       210 ~~~~~~~~~~v~~v~~~~~~~v~~~w~~~v~~e~~~~~~~~~~~~~~~~~~~ip~~~~l~i~~~t~~V~~thnET~tGv~  289 (621)
                                           +..+|+..++++.                     .++. +..+ +   ++|++|+||..
T Consensus       120 ---------------------~~~~~~~~~~~~~---------------------~~~~-~~~~-~---~~~v~~~tg~~  152 (361)
T d2c0ra1         120 ---------------------ASSEASNYMTLPK---------------------LQEI-QLQD-N---AAYLHLTSNET  152 (361)
T ss_dssp             ---------------------EECGGGTTCSCCC---------------------GGGC-CCCT-T---EEEEEEESEET
T ss_pred             ---------------------eccccccccchhh---------------------hhhh-cccC-c---ceEEEEecccc
Confidence                                 2333443332111                     1111 1111 1   23444556777


Q ss_pred             ccc-----ccccCCCcEEEecccccCCCcccccccceEEeccccccCCCccEEEEEchhHHhhhCCCCCceeeccccccC
Q psy8733         290 FNY-----IPDSQGIPLVSDMSSNFLSRKFDVSKFGVIIAGAQKNIGPAGITVVIVREDLLEYALPITPTVFHFKINADN  364 (621)
Q Consensus       290 ~p~-----i~~~~g~llvvDavSs~G~~pIDv~~~gvl~asaqK~lGP~Glg~livr~~ll~~~~~~~P~~ld~~~~~~~  364 (621)
                      +|.     +++++|++++||++|++|+.|+|+++||+.++++||++||+|.+.+++..+.+.+..+..+.+.+|....+.
T Consensus       153 ~~~~~i~~~~~~~~al~~vDavss~g~~~id~~~~di~~~s~~k~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  232 (361)
T d2c0ra1         153 IEGAQFKAFPDTGSVPLIGDMSSDILSRPFDLNQFGLVYAGAQKNLGPSGVTVVIVREDLVAESPKHLPTMLRYDTYVKN  232 (361)
T ss_dssp             TTTEECSSCCCCTTSCEEEECTTTTTSSCCCGGGCSEEEEETTTTTCCSSCEEEEEEGGGSSSCCTTSCGGGCHHHHHHT
T ss_pred             eecceEEEeeccCCceEEEEeeccccccccccccceeEEEecccccccccCcEEEEEhHHhhhCcccccccccccccccc
Confidence            664     567899999999999999999999999999999999999555555555555444433334444455444455


Q ss_pred             CCccCCchHHHHHHHHHHHHHHHhhCCHHHHHHHHHHHHHHHHHHHHccCCcccCccCCCCCCCCcccccccccccccCC
Q psy8733         365 NSVYNTPPTFVVHVIQRVFAWIKRQGGLAKMEQNSLQKSVLLYQEIDNSDKFYECPVQAGCRSRMNVTDIFFTFSHVQTG  444 (621)
Q Consensus       365 ~s~~~TP~v~~I~aL~~aL~~i~~~gGl~~i~~r~~~la~~L~e~L~~~~g~~~~~~~~~~RS~~nv~~~~~t~~~~~~~  444 (621)
                      ...+.|+++..++++..++.+....|+...+.++++.++..+++.......+......++.||++++|            
T Consensus       233 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~rS~~~~~------------  300 (361)
T d2c0ra1         233 NSLYNTPPSFGIYMVNEVLKWIEERGGLEGVQQANRKKASLIYDAIDQSGGFYRGCVDVDSRSDMNIT------------  300 (361)
T ss_dssp             TTCSSCCCHHHHHHHHHHHHHHHHTTHHHHHHHHHHHHHHHHHHHHHTSTTSSEESSCGGGBCSSEEE------------
T ss_pred             ccccccccceeeehhhhHHHhhhhccchHHHHHHHHHHHHHhhhhhhhcccccccCCChhhccceEEE------------
Confidence            66777888888888888888888887888899999999999888888876565566678889988765            


Q ss_pred             chhhHHHHHhhcccccccCCcEEeeecHhHhhhcCCCCCceeeeeecccCCCccCCCchhHHHHHHHHHHHHHhcCChHH
Q psy8733         445 SAFFFGVIIAGAQKNIGPAGITVVIVREDLLEYALPITPTVFHFKINADNNSVYNTPPTFVVHVIQRVFAWIKRQGGLAK  524 (621)
Q Consensus       445 ~~~~~~~~~a~~qk~~GpaGl~v~iv~~~~l~~~~~~~p~~~~y~~~~~~~s~~nTP~~~~iy~~~~vl~~~~~~gg~~~  524 (621)
                                                                 +..          |+                      
T Consensus       301 -------------------------------------------~~~----------~~----------------------  305 (361)
T d2c0ra1         301 -------------------------------------------FRL----------AS----------------------  305 (361)
T ss_dssp             -------------------------------------------EEC----------SC----------------------
T ss_pred             -------------------------------------------EEC----------CC----------------------
Confidence                                                       111          00                      


Q ss_pred             HHHHHHHHHHHHHHHHhccCCcccccCCCCCcccHHHHHHHHHccCccccCCCCCCccceeeccCCCHHHHHHHHHHHHH
Q psy8733         525 MEQNSLQKSVLLYQEIDNSDKFYECPVQAGFPLDELFLKEAKAHNMIQLKGHRLVGGIRASIYNAITVDEAVILVKFMKE  604 (621)
Q Consensus       525 ~~~~~~~ka~~lY~~id~~~~~~~~~v~~~~~~~~~~~~~~~~~~i~~~~g~~~~~~~r~~~~~a~~~~~~~~l~~~~~~  604 (621)
                                                    ....++|.+.++++||+..+|||+.|+||||+|++++.||+++|+++|++
T Consensus       306 ------------------------------~~~~~~~~~~L~~~GI~~~~G~~~~g~~RIs~~~~~~~edv~~Lv~~l~~  355 (361)
T d2c0ra1         306 ------------------------------EELEKEFVKASEQEGFVGLKGHRSVGGLRASIYNAVPYESCEALVQFMEH  355 (361)
T ss_dssp             ------------------------------HHHHHHHHHHHHHTTEESCBCCTTTCSEEEECCTTSCHHHHHHHHHHHHH
T ss_pred             ------------------------------cccHHHHHHHHHHCCCEEecCCCcCCeEEEEecCCCCHHHHHHHHHHHHH
Confidence                                          01235688899999999999999999999999999999999999999999


Q ss_pred             HHHHcC
Q psy8733         605 FRHKHS  610 (621)
Q Consensus       605 ~~~~~~  610 (621)
                      |.++++
T Consensus       356 ~~~~~~  361 (361)
T d2c0ra1         356 FKRSRG  361 (361)
T ss_dssp             HHHHHC
T ss_pred             HHHhcC
Confidence            999874



>d1w23a_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Bacillus alcalophilus [TaxId: 1445]} Back     information, alignment and structure
>d1bjna_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iuga_ c.67.1.3 (A:) Subgroup IV putative aspartate aminotransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1h0ca_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ch1a1 c.67.1.3 (A:2-389) 3-hydroxykynurenine transaminase {Malaria mosquito (Anopheles gambiae) [TaxId: 7165]} Back     information, alignment and structure
>d2bkwa1 c.67.1.3 (A:3-384) Alanine-glyoxylate aminotransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vjoa_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Cyanobacteria (Nostoc sp. pcc 7120) [TaxId: 103690]} Back     information, alignment and structure
>d1m32a_ c.67.1.3 (A:) 2-aminoethylphosphonate transaminase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1jf9a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t3ia_ c.67.1.3 (A:) Probable cysteine desulfurase SufS {Synechocystis sp. PCC 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1elua_ c.67.1.3 (A:) Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 1143]} Back     information, alignment and structure
>d1p3wa_ c.67.1.3 (A:) Cysteine desulfurase IscS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1eg5a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1qz9a_ c.67.1.3 (A:) Kynureninase {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d2e7ja1 c.67.1.9 (A:8-371) Selenocysteinyl-tRNA synthase (SepSecS) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1pmma_ c.67.1.6 (A:) Glutamate decarboxylase beta, GadB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1c4ka2 c.67.1.5 (A:108-569) Ornithine decarboxylase major domain {Lactobacillus sp., strain 30a [TaxId: 1591]} Back     information, alignment and structure
>d1mdoa_ c.67.1.4 (A:) Aminotransferase ArnB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1v72a1 c.67.1.1 (A:6-350) Phenylserine aldolase PSALD {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1j32a_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1gdea_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1js3a_ c.67.1.6 (A:) DOPA decarboxylase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d3bc8a1 c.67.1.9 (A:23-467) Selenocysteinyl-tRNA synthase (SepSecS) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bs0a_ c.67.1.4 (A:) PLP-dependent acyl-CoA synthase (8-amino-7-oxonanoate synthase, AONS) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1svva_ c.67.1.1 (A:) Low-specificity threonine aldolase {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1lc5a_ c.67.1.1 (A:) L-threonine-O-3-phosphate decarboxylase CobD {Salmonella enterica [TaxId: 28901]} Back     information, alignment and structure
>d1d2fa_ c.67.1.3 (A:) Modulator in mal gene expression, MalY {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bw0a_ c.67.1.1 (A:) Tyrosine aminotransferase (TAT) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1fc4a_ c.67.1.4 (A:) 2-amino-3-ketobutyrate CoA ligase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b5pa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1v2da_ c.67.1.1 (A:) Glutamine aminotransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2z67a1 c.67.1.9 (A:1-434) Selenocysteinyl-tRNA synthase (SepSecS) {Methanococcus maripaludis [TaxId: 39152]} Back     information, alignment and structure
>d1wsta1 c.67.1.1 (A:13-415) Multiple substrate aminotransferase, MSAT {Thermococcus profundus [TaxId: 49899]} Back     information, alignment and structure
>d1iuga_ c.67.1.3 (A:) Subgroup IV putative aspartate aminotransferase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2fnua1 c.67.1.4 (A:2-372) Spore coat polysaccharide biosynthesis protein C {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1xi9a_ c.67.1.1 (A:) Putative alanine aminotransferase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1vp4a_ c.67.1.1 (A:) Putative aminotransferase TM1131 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1b9ha_ c.67.1.4 (A:) 3-amino-5-hydroxybenzoic acid synthase (AHBA synthase) {Amycolatopsis mediterranei [TaxId: 33910]} Back     information, alignment and structure
>d1o4sa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1fg7a_ c.67.1.1 (A:) Histidinol-phosphate aminotransferase HisC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bwna1 c.67.1.4 (A:2-397) 5-aminolevulinate synthase {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d2f8ja1 c.67.1.1 (A:1-334) Histidinol-phosphate aminotransferase HisC {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2r5ea1 c.67.1.1 (A:12-429) Kynurenine--oxoglutarate transaminase I {Yellowfever mosquito (Aedes aegypti) [TaxId: 7159]} Back     information, alignment and structure
>d1w7la_ c.67.1.1 (A:) Kynurenine--oxoglutarate transaminase I {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m6sa_ c.67.1.1 (A:) Low-specificity threonine aldolase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2gb3a1 c.67.1.1 (A:4-392) AAT homologue TM1698 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1kl1a_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1o69a_ c.67.1.4 (A:) Aminotransferase homolog WlaK (PglE, Cj1121c) {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1m7ya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Apple (Malus domestica) [TaxId: 3750]} Back     information, alignment and structure
>d1c7na_ c.67.1.3 (A:) Cystalysin {Treponema denticola [TaxId: 158]} Back     information, alignment and structure
>d1rv3a_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d2bkwa1 c.67.1.3 (A:3-384) Alanine-glyoxylate aminotransferase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d7aata_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Chicken (Gallus gallus), mitochondria [TaxId: 9031]} Back     information, alignment and structure
>d1u08a_ c.67.1.1 (A:) Putative methionine aminotransferase YdbL {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wyua1 c.67.1.7 (A:1-437) Glycine dehydrogenase (decarboxylating) subunit 1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1iaya_ c.67.1.4 (A:) 1-aminocyclopropane-1-carboxylate synthase (ACC synthase) {Tomato (Lycopersicon esculentum) [TaxId: 4081]} Back     information, alignment and structure
>d1dfoa_ c.67.1.4 (A:) Serine hydroxymethyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2aeua1 c.67.1.8 (A:9-374) Hypothetical protein MJ0158 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2a7va1 c.67.1.4 (A:26-488) Serine hydroxymethyltransferase {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Back     information, alignment and structure
>d1ax4a_ c.67.1.2 (A:) Tryptophan indol-lyase (tryptophanase) {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d1ajsa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Pig (Sus scrofa), cytosolic form [TaxId: 9823]} Back     information, alignment and structure
>d1yaaa_ c.67.1.1 (A:) Aspartate aminotransferase, AAT {Baker's yeast (Saccharomyces cerevisiae), cytosolic form [TaxId: 4932]} Back     information, alignment and structure
>d1wyub1 c.67.1.7 (B:2-472) Glycine dehydrogenase subunit 2 (P-protein) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2ay1a_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1gc0a_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1pffa_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Trichomonas vaginalis, MGL2 [TaxId: 5722]} Back     information, alignment and structure
>d1y4ia1 c.67.1.3 (A:2-398) Methionine gamma-lyase, MGL {Citrobacter freundii [TaxId: 546]} Back     information, alignment and structure
>d1m32a_ c.67.1.3 (A:) 2-aminoethylphosphonate transaminase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2c0ra1 c.67.1.4 (A:2-362) Phosphoserine aminotransferase, PSAT {Bacillus circulans, subsp. alkalophilus [TaxId: 1397]} Back     information, alignment and structure
>d1c7ga_ c.67.1.2 (A:) Tyrosine phenol-lyase {Erwinia herbicola [TaxId: 549]} Back     information, alignment and structure
>d2hoxa1 c.67.1.1 (A:1-425) Alliinase {Garlic (Allium sativum) [TaxId: 4682]} Back     information, alignment and structure
>d1vjoa_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Cyanobacteria (Nostoc sp. pcc 7120) [TaxId: 103690]} Back     information, alignment and structure
>d1e5ea_ c.67.1.3 (A:) Methionine gamma-lyase, MGL {Trichomonas vaginalis, MGL1 [TaxId: 5722]} Back     information, alignment and structure
>d2q7wa1 c.67.1.1 (A:1-396) Aspartate aminotransferase, AAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ibja_ c.67.1.3 (A:) Cystathionine beta-lyase, CBL {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1sffa_ c.67.1.4 (A:) 4-aminobutyrate aminotransferase, GABA-aminotransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h0ca_ c.67.1.3 (A:) Alanine-glyoxylate aminotransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2v1pa1 c.67.1.2 (A:5-471) Tryptophan indol-lyase (tryptophanase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cl1a_ c.67.1.3 (A:) Cystathionine beta-lyase, CBL {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bjna_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ch1a1 c.67.1.3 (A:2-389) 3-hydroxykynurenine transaminase {Malaria mosquito (Anopheles gambiae) [TaxId: 7165]} Back     information, alignment and structure
>d1w23a_ c.67.1.4 (A:) Phosphoserine aminotransferase, PSAT {Bacillus alcalophilus [TaxId: 1445]} Back     information, alignment and structure
>d1cs1a_ c.67.1.3 (A:) Cystathionine gamma-synthase, CGS {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qgna_ c.67.1.3 (A:) Cystathionine gamma-synthase, CGS {Common tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d3tata_ c.67.1.1 (A:) Aromatic aminoacid aminotransferase, AroAT {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1elua_ c.67.1.3 (A:) Cystine C-S lyase C-des {Synechocystis sp. [TaxId: 1143]} Back     information, alignment and structure
>d2ctza1 c.67.1.3 (A:1-421) O-acetyl-L-homoserine sulfhydrylase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1s0aa_ c.67.1.4 (A:) Adenosylmethionine-8-amino-7-oxononanoate aminotransferase, BioA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z7da1 c.67.1.4 (A:7-410) Ornithine aminotransferase {Plasmodium yoelii yoelii [TaxId: 73239]} Back     information, alignment and structure
>d2byla1 c.67.1.4 (A:36-439) Ornithine aminotransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gsaa_ c.67.1.4 (A:) Glutamate-1-semialdehyde aminomutase (aminotransferase) {Synechococcus sp., strain GR6 [TaxId: 1131]} Back     information, alignment and structure
>d1vefa1 c.67.1.4 (A:9-395) Acetylornithine/acetyl-lysine aminotransferase ArgD {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1n8pa_ c.67.1.3 (A:) Cystathionine gamma-lyase (CYS3) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jf9a_ c.67.1.3 (A:) NifS-like protein/selenocysteine lyase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t3ia_ c.67.1.3 (A:) Probable cysteine desulfurase SufS {Synechocystis sp. PCC 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1zoda1 c.67.1.4 (A:3-433) Dialkylglycine decarboxylase {Pseudomonas cepacia [TaxId: 292]} Back     information, alignment and structure