Psyllid ID: psy8766


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-----
MTGADLNVLDKEKRSPLLLAASRGGWKTVLTLVRNKANILLKDINRRNILHLLVLNGGGHIKEFAEEVAAVFLGEGEASQGIQNLLNEKDKTGCSPLHYASREGHIISLENLINLGACINLKNNSNESPLHLAAR
ccccccccccccccHHHHHHHHcccHHHHHHHHHcccccccccccccHHHHHHHHHccccccccHHHHHHHHHHccccccccccccccccccccHHHHHHHHHccHHHHHHHHHcccccccccccccHHHHHHcc
cccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHcccHHHHccccHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHH
mtgadlnvldkekrsplllaasrgGWKTVLTLVRNKANILLKDINRRNILHLLVLNGGGHIKEFAEEVAAVFLGEGEASQGIQNLLnekdktgcsplhyasreghIISLENLINlgacinlknnsnesplhlaar
mtgadlnvldkekrsplllaasrggwktvLTLVRNKANillkdinrrnILHLLVLNGGGHIKEFAEEVAAVFLGEGEASQGIQNLLNEKDKTGCSPLHYASREGHIISLENLINLGACInlknnsnesplhlaar
MTGADLNVLDKEKRSPLLLAASRGGWKTVLTLVRNKANILLKDINRRNILHLLVLNGGGHIKEFAEEVAAVFLGEGEASQGIQNLLNEKDKTGCSPLHYASREGHIISLENLINLGACINLKNNSNESPLHLAAR
****************LLLAASRGGWKTVLTLVRNKANILLKDINRRNILHLLVLNGGGHIKEFAEEVAAVFLGEGEASQGIQNLLNEKDKTGCSPLHYASREGHIISLENLINLGACINL**************
MTGADLNVLDKEKRSPLLLAASRGGWKTVLTLVRNKANILLKDINRRNILHLLVLNGGGHIKEFAEEVAAVFLGEGEASQGIQNLLNEKDKTGCSPLHYASREGHIISLENLINLGACINLKNNSNESPLHLAAR
MTGADLNVLDKEKRSPLLLAASRGGWKTVLTLVRNKANILLKDINRRNILHLLVLNGGGHIKEFAEEVAAVFLGEGEASQGIQNLLNEKDKTGCSPLHYASREGHIISLENLINLGACINLKNNSNESPLHLAAR
*****LNVLDKEKRSPLLLAASRGGWKTVLTLVRNKANILLKDINRRNILHLLVLNGGGHIKEFAEEVAAVFLGEGEASQGIQNLLNEKDKTGCSPLHYASREGHIISLENLINLGACINLKNNSNESPLHLAAR
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MTGADLNVLDKEKRSPLLLAASRGGWKTVLTLVRNKANILLKDINRRNILHLLVLNGGGHIKEFAEEVAAVFLGEGEASQGIQNLLNEKDKTGCSPLHYASREGHIISLENLINLGACINLKNNSNESPLHLAAR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query135 2.2.26 [Sep-21-2011]
Q7Z020 1296 Transient receptor potent yes N/A 0.940 0.097 0.639 1e-41
O75762 1119 Transient receptor potent yes N/A 0.911 0.109 0.386 3e-17
Q6RI86 1125 Transient receptor potent yes N/A 0.911 0.109 0.371 4e-17
Q8BLA8 1125 Transient receptor potent yes N/A 0.911 0.109 0.378 9e-17
Q94CT7 446 Probable E3 ubiquitin-pro yes N/A 0.977 0.295 0.328 6e-11
Q65XV2 450 E3 ubiquitin-protein liga no N/A 0.970 0.291 0.333 6e-10
Q94B55 456 Putative E3 ubiquitin-pro no N/A 0.940 0.278 0.305 4e-08
Q5ZLC8 1073 Serine/threonine-protein no N/A 0.977 0.123 0.276 5e-08
O15084 1053 Serine/threonine-protein no N/A 0.874 0.112 0.295 7e-08
Q5BKI6318 Ankyrin repeat domain-con no N/A 0.881 0.374 0.315 1e-07
>sp|Q7Z020|TRPA1_DROME Transient receptor potential cation channel subfamily A member 1 OS=Drosophila melanogaster GN=TrpA1 PE=2 SV=3 Back     alignment and function desciption
 Score =  167 bits (424), Expect = 1e-41,   Method: Composition-based stats.
 Identities = 85/133 (63%), Positives = 100/133 (75%), Gaps = 6/133 (4%)

Query: 3   GADLNVLDKEKRSPLLLAASRGGWKTVLTLVRNKANILLKDINRRNILHLLVLNGGGHIK 62
           GAD+N LDKE RSPLLLAASR GWKTV  L+R  A I +KD   RN+LH +++NGG  + 
Sbjct: 459 GADINALDKEHRSPLLLAASRSGWKTVHLLIRLGACISVKDAAARNVLHFVIMNGG-RLT 517

Query: 63  EFAEEVAAVFLGEGEASQGIQNLLNEKDKTGCSPLHYASREGHIISLENLINLGACINLK 122
           +FAE+VA       +    ++ LLNEKD  GCSPLHYASR+GHI SLENLI LGACINLK
Sbjct: 518 DFAEQVANC-----QTQAQLKLLLNEKDSMGCSPLHYASRDGHIRSLENLIRLGACINLK 572

Query: 123 NNSNESPLHLAAR 135
           NN+NESPLH AAR
Sbjct: 573 NNNNESPLHFAAR 585




Essential for thermotaxis by sensing environmental temperature. Receptor-activated non-selective cation channel involved in detection of sensations such as temperature. Involved in heat nociception by being activated by warm temperature of about 24-29 degrees Celsius.
Drosophila melanogaster (taxid: 7227)
>sp|O75762|TRPA1_HUMAN Transient receptor potential cation channel subfamily A member 1 OS=Homo sapiens GN=TRPA1 PE=2 SV=3 Back     alignment and function description
>sp|Q6RI86|TRPA1_RAT Transient receptor potential cation channel subfamily A member 1 OS=Rattus norvegicus GN=Trpa1 PE=2 SV=1 Back     alignment and function description
>sp|Q8BLA8|TRPA1_MOUSE Transient receptor potential cation channel subfamily A member 1 OS=Mus musculus GN=Trpa1 PE=1 SV=1 Back     alignment and function description
>sp|Q94CT7|XB31_ORYSJ Probable E3 ubiquitin-protein ligase XBOS31 OS=Oryza sativa subsp. japonica GN=XBOS31 PE=2 SV=1 Back     alignment and function description
>sp|Q65XV2|XB3_ORYSJ E3 ubiquitin-protein ligase XB3 OS=Oryza sativa subsp. japonica GN=XB3 PE=1 SV=1 Back     alignment and function description
>sp|Q94B55|XB31_ARATH Putative E3 ubiquitin-protein ligase XBAT31 OS=Arabidopsis thaliana GN=XBAT31 PE=2 SV=1 Back     alignment and function description
>sp|Q5ZLC8|ANR52_CHICK Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit C OS=Gallus gallus GN=ANKRD52 PE=2 SV=1 Back     alignment and function description
>sp|O15084|ANR28_HUMAN Serine/threonine-protein phosphatase 6 regulatory ankyrin repeat subunit A OS=Homo sapiens GN=ANKRD28 PE=1 SV=5 Back     alignment and function description
>sp|Q5BKI6|ANKR1_XENTR Ankyrin repeat domain-containing protein 1 OS=Xenopus tropicalis GN=ankrd1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query135
157123155 894 hypothetical protein AaeL_AAEL009419 [Ae 0.940 0.142 0.676 7e-45
170032246 1345 conserved hypothetical protein [Culex qu 0.940 0.094 0.654 3e-43
242023855 1175 conserved hypothetical protein [Pediculu 0.940 0.108 0.684 4e-43
158293029 1230 AGAP004863-PA [Anopheles gambiae str. PE 0.940 0.103 0.661 2e-42
186694312 1248 TRPA1 channel protein [Anopheles gambiae 0.940 0.101 0.661 2e-42
270004805 1317 hypothetical protein TcasGA2_TC002449 [T 0.940 0.096 0.654 4e-42
198464091 1137 GA28660 [Drosophila pseudoobscura pseudo 0.940 0.111 0.646 9e-41
357622662 1195 hypothetical protein KGM_18654 [Danaus p 0.933 0.105 0.646 1e-40
195428457 1237 GK17464 [Drosophila willistoni] gi|19415 0.933 0.101 0.646 3e-40
195326149 1274 GM24910 [Drosophila sechellia] gi|194118 0.940 0.099 0.639 5e-40
>gi|157123155|ref|XP_001660034.1| hypothetical protein AaeL_AAEL009419 [Aedes aegypti] gi|108874473|gb|EAT38698.1| AAEL009419-PA, partial [Aedes aegypti] Back     alignment and taxonomy information
 Score =  184 bits (468), Expect = 7e-45,   Method: Composition-based stats.
 Identities = 90/133 (67%), Positives = 108/133 (81%), Gaps = 6/133 (4%)

Query: 3   GADLNVLDKEKRSPLLLAASRGGWKTVLTLVRNKANILLKDINRRNILHLLVLNGGGHIK 62
           GAD+N LDKE RSPLLL+ASRGGW+TV+ L+R  ANI LKD+N RN+LHL+++NGG  + 
Sbjct: 51  GADINALDKENRSPLLLSASRGGWRTVMVLIRLGANISLKDVNSRNVLHLVIMNGG-RLD 109

Query: 63  EFAEEVAAVFLGEGEASQGIQNLLNEKDKTGCSPLHYASREGHIISLENLINLGACINLK 122
           EFA+EV+       ++   +  LLNEKD+TGCSPLHYASREGHI SLENLI LGACINLK
Sbjct: 110 EFAKEVSCT-----QSETYLLLLLNEKDETGCSPLHYASREGHIRSLENLIRLGACINLK 164

Query: 123 NNSNESPLHLAAR 135
           NN+NESPLH AAR
Sbjct: 165 NNNNESPLHFAAR 177




Source: Aedes aegypti

Species: Aedes aegypti

Genus: Aedes

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|170032246|ref|XP_001843993.1| conserved hypothetical protein [Culex quinquefasciatus] gi|167872109|gb|EDS35492.1| conserved hypothetical protein [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|242023855|ref|XP_002432346.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212517769|gb|EEB19608.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|158293029|ref|XP_314325.4| AGAP004863-PA [Anopheles gambiae str. PEST] gi|157016910|gb|EAA09726.4| AGAP004863-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|186694312|gb|ACC86138.1| TRPA1 channel protein [Anopheles gambiae] Back     alignment and taxonomy information
>gi|270004805|gb|EFA01253.1| hypothetical protein TcasGA2_TC002449 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|198464091|ref|XP_002135630.1| GA28660 [Drosophila pseudoobscura pseudoobscura] gi|198151534|gb|EDY74257.1| GA28660 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|357622662|gb|EHJ74088.1| hypothetical protein KGM_18654 [Danaus plexippus] Back     alignment and taxonomy information
>gi|195428457|ref|XP_002062289.1| GK17464 [Drosophila willistoni] gi|194158374|gb|EDW73275.1| GK17464 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|195326149|ref|XP_002029792.1| GM24910 [Drosophila sechellia] gi|194118735|gb|EDW40778.1| GM24910 [Drosophila sechellia] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query135
FB|FBgn0035934 1296 TrpA1 "Transient receptor pote 0.940 0.097 0.639 2.2e-37
UNIPROTKB|E1C7Y7 1074 TRPA1 "Uncharacterized protein 0.918 0.115 0.443 5.2e-20
UNIPROTKB|E1BZK9 1075 TRPA1 "Uncharacterized protein 0.918 0.115 0.443 5.2e-20
UNIPROTKB|G5E522 1126 TRPA1 "Uncharacterized protein 0.911 0.109 0.416 4.7e-18
UNIPROTKB|I3LEM4 1089 I3LEM4 "Uncharacterized protei 0.911 0.112 0.401 8.5e-17
UNIPROTKB|F1RWI1 1121 TRPA1 "Uncharacterized protein 0.911 0.109 0.401 8.8e-17
UNIPROTKB|F1Q2M0 1117 TRPA1 "Uncharacterized protein 0.911 0.110 0.393 1.4e-16
RGD|1303284 1125 Trpa1 "transient receptor pote 0.911 0.109 0.386 2.4e-16
UNIPROTKB|H0YAW0 916 TRPA1 "Transient receptor pote 0.911 0.134 0.393 2.9e-16
UNIPROTKB|O75762 1119 TRPA1 "Transient receptor pote 0.911 0.109 0.393 3.9e-16
FB|FBgn0035934 TrpA1 "Transient receptor potential A1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 414 (150.8 bits), Expect = 2.2e-37, P = 2.2e-37
 Identities = 85/133 (63%), Positives = 100/133 (75%)

Query:     3 GADLNVLDKEKRSPLLLAASRGGWKTVLTLVRNKANILLKDINRRNILHLLVLNGGGHIK 62
             GAD+N LDKE RSPLLLAASR GWKTV  L+R  A I +KD   RN+LH +++NGG  + 
Sbjct:   459 GADINALDKEHRSPLLLAASRSGWKTVHLLIRLGACISVKDAAARNVLHFVIMNGG-RLT 517

Query:    63 EFAEEVAAVFLGEGEASQGIQNLLNEKDKTGCSPLHYASREGHIISLENLINLGACINLK 122
             +FAE+VA       +    ++ LLNEKD  GCSPLHYASR+GHI SLENLI LGACINLK
Sbjct:   518 DFAEQVANC-----QTQAQLKLLLNEKDSMGCSPLHYASRDGHIRSLENLIRLGACINLK 572

Query:   123 NNSNESPLHLAAR 135
             NN+NESPLH AAR
Sbjct:   573 NNNNESPLHFAAR 585


GO:0006816 "calcium ion transport" evidence=ISS
GO:0005262 "calcium channel activity" evidence=ISS
GO:0009266 "response to temperature stimulus" evidence=NAS
GO:0005216 "ion channel activity" evidence=IEA
GO:0006811 "ion transport" evidence=IEA
GO:0055085 "transmembrane transport" evidence=IEA
GO:0016020 "membrane" evidence=IEA
GO:0043052 "thermotaxis" evidence=IDA;IMP
GO:0009408 "response to heat" evidence=IMP
GO:0034605 "cellular response to heat" evidence=IDA
GO:0042745 "circadian sleep/wake cycle" evidence=IMP
GO:0007613 "memory" evidence=IMP
GO:0033038 "bitter taste receptor activity" evidence=IDA
GO:0001580 "detection of chemical stimulus involved in sensory perception of bitter taste" evidence=IMP
GO:0040040 "thermosensory behavior" evidence=IMP
GO:0007638 "mechanosensory behavior" evidence=IMP
UNIPROTKB|E1C7Y7 TRPA1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1BZK9 TRPA1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|G5E522 TRPA1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|I3LEM4 I3LEM4 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1RWI1 TRPA1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1Q2M0 TRPA1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|1303284 Trpa1 "transient receptor potential cation channel, subfamily A, member 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|H0YAW0 TRPA1 "Transient receptor potential cation channel subfamily A member 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|O75762 TRPA1 "Transient receptor potential cation channel subfamily A member 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q7Z020TRPA1_DROMENo assigned EC number0.63900.94070.0979yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query135
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 5e-20
PHA03100 422 PHA03100, PHA03100, ankyrin repeat protein; Provis 9e-10
PHA02874 434 PHA02874, PHA02874, ankyrin repeat protein; Provis 4e-07
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 1e-06
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 1e-06
PHA03100 422 PHA03100, PHA03100, ankyrin repeat protein; Provis 5e-06
PHA03095 471 PHA03095, PHA03095, ankyrin-like protein; Provisio 5e-06
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 5e-06
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 6e-06
PHA02874 434 PHA02874, PHA02874, ankyrin repeat protein; Provis 3e-05
pfam0002333 pfam00023, Ank, Ankyrin repeat 6e-05
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 9e-05
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 1e-04
PHA02878 477 PHA02878, PHA02878, ankyrin repeat protein; Provis 7e-04
PHA02874 434 PHA02874, PHA02874, ankyrin repeat protein; Provis 0.001
PHA02876 682 PHA02876, PHA02876, ankyrin repeat protein; Provis 0.001
PLN03192 823 PLN03192, PLN03192, Voltage-dependent potassium ch 0.001
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 0.003
PHA02878 477 PHA02878, PHA02878, ankyrin repeat protein; Provis 0.003
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
 Score = 79.0 bits (195), Expect = 5e-20
 Identities = 45/129 (34%), Positives = 70/129 (54%), Gaps = 14/129 (10%)

Query: 7   NVLDKEKRSPLLLAASRGGWKTVLTLVRNKANILLKDINRRNILHLLVLNGGGHIKEFAE 66
           N  D++ R+PL LAAS G  + V  L+ N A++  KD + R  LHL   NG         
Sbjct: 1   NARDEDGRTPLHLAASNGHLEVVKLLLENGADVNAKDNDGRTPLHLAAKNGH-------L 53

Query: 67  EVAAVFLGEGEASQGIQNLLNEKDKTGCSPLHYASREGHIISLENLINLGACINLKNNSN 126
           E+  + L +G         +N +DK G +PLH A+R G++  ++ L+  GA +N ++   
Sbjct: 54  EIVKLLLEKG-------ADVNARDKDGNTPLHLAARNGNLDVVKLLLKHGADVNARDKDG 106

Query: 127 ESPLHLAAR 135
            +PLHLAA+
Sbjct: 107 RTPLHLAAK 115


The number of ANK repeats in a protein can range from 2 to over 20 (ankyrins, for example). ANK repeats may occur in combinations with other types of domains. The structural repeat unit contains two antiparallel helices and a beta-hairpin, repeats are stacked in a superhelical arrangement; this alignment contains 4 consecutive repeats. Length = 126

>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 135
KOG4412|consensus226 99.98
KOG4412|consensus226 99.96
KOG0509|consensus 600 99.96
PHA02791284 ankyrin-like protein; Provisional 99.95
PHA02946 446 ankyin-like protein; Provisional 99.95
KOG0509|consensus 600 99.95
PHA02878 477 ankyrin repeat protein; Provisional 99.95
PHA02874 434 ankyrin repeat protein; Provisional 99.95
PHA02798 489 ankyrin-like protein; Provisional 99.94
PHA02859209 ankyrin repeat protein; Provisional 99.94
PHA03100 480 ankyrin repeat protein; Provisional 99.94
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 99.94
PLN03192 823 Voltage-dependent potassium channel; Provisional 99.94
PHA02875 413 ankyrin repeat protein; Provisional 99.94
PHA02878 477 ankyrin repeat protein; Provisional 99.94
PHA02874 434 ankyrin repeat protein; Provisional 99.94
PHA02791 284 ankyrin-like protein; Provisional 99.93
PHA02741169 hypothetical protein; Provisional 99.93
PHA03095 471 ankyrin-like protein; Provisional 99.93
PHA02989 494 ankyrin repeat protein; Provisional 99.93
PHA02876 682 ankyrin repeat protein; Provisional 99.93
PHA02743166 Viral ankyrin protein; Provisional 99.93
PHA02876 682 ankyrin repeat protein; Provisional 99.93
PHA02795 437 ankyrin-like protein; Provisional 99.92
PHA02946 446 ankyin-like protein; Provisional 99.92
PHA03095 471 ankyrin-like protein; Provisional 99.92
PHA02875 413 ankyrin repeat protein; Provisional 99.92
KOG0510|consensus 929 99.92
PHA02859209 ankyrin repeat protein; Provisional 99.92
PHA02716 764 CPXV016; CPX019; EVM010; Provisional 99.92
KOG0195|consensus 448 99.92
PHA02743166 Viral ankyrin protein; Provisional 99.91
PHA02884 300 ankyrin repeat protein; Provisional 99.91
KOG0510|consensus 929 99.91
KOG0508|consensus 615 99.91
PHA03100 480 ankyrin repeat protein; Provisional 99.91
PHA02798 489 ankyrin-like protein; Provisional 99.91
KOG0502|consensus296 99.9
KOG0512|consensus228 99.89
PHA02730 672 ankyrin-like protein; Provisional 99.89
PHA02917 661 ankyrin-like protein; Provisional 99.89
PHA02989 494 ankyrin repeat protein; Provisional 99.88
PHA02736154 Viral ankyrin protein; Provisional 99.88
PHA02917 661 ankyrin-like protein; Provisional 99.88
KOG0505|consensus 527 99.88
KOG0514|consensus452 99.87
KOG4177|consensus 1143 99.87
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.87
KOG0512|consensus228 99.87
PLN03192 823 Voltage-dependent potassium channel; Provisional 99.86
KOG4177|consensus 1143 99.86
PHA02741169 hypothetical protein; Provisional 99.86
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.84
PHA02884 300 ankyrin repeat protein; Provisional 99.84
PHA02736154 Viral ankyrin protein; Provisional 99.84
KOG0508|consensus 615 99.84
PHA02730 672 ankyrin-like protein; Provisional 99.83
PHA02792 631 ankyrin-like protein; Provisional 99.82
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.8
KOG0502|consensus296 99.8
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.8
PHA02795 437 ankyrin-like protein; Provisional 99.79
KOG0507|consensus 854 99.78
PHA02792 631 ankyrin-like protein; Provisional 99.78
KOG0505|consensus 527 99.78
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.78
KOG0514|consensus452 99.78
KOG4214|consensus117 99.74
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.73
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.73
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.72
KOG3676|consensus 782 99.68
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.67
KOG0507|consensus 854 99.67
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.67
KOG0195|consensus 448 99.66
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.62
KOG1710|consensus 396 99.62
KOG4214|consensus117 99.6
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.59
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.57
KOG3676|consensus 782 99.56
KOG0515|consensus752 99.56
KOG0515|consensus752 99.51
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.47
KOG1710|consensus 396 99.43
KOG4369|consensus 2131 99.41
PF1360630 Ank_3: Ankyrin repeat 99.41
KOG4369|consensus 2131 99.39
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 99.37
KOG0783|consensus 1267 99.36
PF1360630 Ank_3: Ankyrin repeat 99.3
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 99.26
KOG0506|consensus622 99.19
KOG0782|consensus1004 99.11
KOG0506|consensus622 99.1
KOG0818|consensus 669 99.07
KOG2384|consensus223 99.02
KOG0818|consensus 669 98.97
KOG0782|consensus1004 98.96
KOG0522|consensus 560 98.95
KOG0705|consensus749 98.84
KOG0705|consensus749 98.75
KOG3609|consensus 822 98.74
KOG0522|consensus 560 98.72
KOG0783|consensus 1267 98.71
KOG0521|consensus785 98.5
KOG0520|consensus 975 98.35
KOG0511|consensus 516 98.32
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 98.16
KOG0521|consensus785 98.16
KOG2384|consensus 223 98.0
KOG2505|consensus591 97.98
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 97.97
KOG2505|consensus 591 97.9
KOG0511|consensus 516 97.89
KOG0520|consensus 975 97.72
KOG3609|consensus 822 96.96
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 93.74
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 91.97
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 90.93
KOG3836|consensus605 81.0
>KOG4412|consensus Back     alignment and domain information
Probab=99.98  E-value=1.2e-32  Score=156.85  Aligned_cols=118  Identities=29%  Similarity=0.367  Sum_probs=104.5

Q ss_pred             CCCCccccccCCChHHHHHHHhCCHHHHHHHHHc-CCCccccccCCchHHHHHHHhCCCchHHHHHHHHHHHhcCCcchh
Q psy8766           2 TGADLNVLDKEKRSPLLLAASRGGWKTVLTLVRN-KANILLKDINRRNILHLLVLNGGGHIKEFAEEVAAVFLGEGEASQ   80 (135)
Q Consensus         2 ~g~~~n~~~~~g~tpl~~a~~~~~~~~~~~Ll~~-g~~~~~~~~~g~t~l~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~   80 (135)
                      -+..+|.+|..|+||||.||..|+.++|+.|+.+ |++++..+..|.|+||||+..|..++..+++       +.++.  
T Consensus        61 ~nv~~ddkDdaGWtPlhia~s~g~~evVk~Ll~r~~advna~tn~G~T~LHyAagK~r~eIaqlLl-------e~ga~--  131 (226)
T KOG4412|consen   61 PNVKPDDKDDAGWTPLHIAASNGNDEVVKELLNRSGADVNATTNGGQTCLHYAAGKGRLEIAQLLL-------EKGAL--  131 (226)
T ss_pred             CCCCCCCccccCCchhhhhhhcCcHHHHHHHhcCCCCCcceecCCCcceehhhhcCChhhHHHHHH-------hcCCC--
Confidence            4677888999999999999999999999999977 9999999999999999999999755554444       44444  


Q ss_pred             hhhhhhhccCCCCCcHHHHHHhcCcHHHHHHHHHcCCCeeecCCCCCCcchhc
Q psy8766          81 GIQNLLNEKDKTGCSPLHYASREGHIISLENLINLGACINLKNNSNESPLHLA  133 (135)
Q Consensus        81 ~~~~~~~~~~~~~~t~l~~a~~~~~~~~~~~ll~~g~~~~~~~~~g~tpl~~a  133 (135)
                           ++.+|..|.||||-|+..|..+++++|+..|+.+|..|+.|+||||.|
T Consensus       132 -----i~~kD~~~qtplHRAAavGklkvie~Li~~~a~~n~qDk~G~TpL~~a  179 (226)
T KOG4412|consen  132 -----IRIKDKQGQTPLHRAAAVGKLKVIEYLISQGAPLNTQDKYGFTPLHHA  179 (226)
T ss_pred             -----CcccccccCchhHHHHhccchhhHHHHHhcCCCCCcccccCccHHHHH
Confidence                 788999999999999999999999999999999999999999999987



>KOG4412|consensus Back     alignment and domain information
>KOG0509|consensus Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>KOG0509|consensus Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0510|consensus Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>KOG0195|consensus Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0510|consensus Back     alignment and domain information
>KOG0508|consensus Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0502|consensus Back     alignment and domain information
>KOG0512|consensus Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0505|consensus Back     alignment and domain information
>KOG0514|consensus Back     alignment and domain information
>KOG4177|consensus Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>KOG0512|consensus Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG4177|consensus Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0508|consensus Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG0502|consensus Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0507|consensus Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0505|consensus Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG0514|consensus Back     alignment and domain information
>KOG4214|consensus Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG3676|consensus Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG0507|consensus Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG0195|consensus Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>KOG1710|consensus Back     alignment and domain information
>KOG4214|consensus Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG3676|consensus Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG1710|consensus Back     alignment and domain information
>KOG4369|consensus Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG4369|consensus Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0506|consensus Back     alignment and domain information
>KOG0782|consensus Back     alignment and domain information
>KOG0506|consensus Back     alignment and domain information
>KOG0818|consensus Back     alignment and domain information
>KOG2384|consensus Back     alignment and domain information
>KOG0818|consensus Back     alignment and domain information
>KOG0782|consensus Back     alignment and domain information
>KOG0522|consensus Back     alignment and domain information
>KOG0705|consensus Back     alignment and domain information
>KOG0705|consensus Back     alignment and domain information
>KOG3609|consensus Back     alignment and domain information
>KOG0522|consensus Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>KOG0521|consensus Back     alignment and domain information
>KOG0520|consensus Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG0521|consensus Back     alignment and domain information
>KOG2384|consensus Back     alignment and domain information
>KOG2505|consensus Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>KOG2505|consensus Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>KOG0520|consensus Back     alignment and domain information
>KOG3609|consensus Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>KOG3836|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query135
2xeh_A157 Structural Determinants For Improved Thermal Stabil 1e-13
2xee_A157 Structural Determinants For Improved Thermal Stabil 3e-13
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 7e-13
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 1e-12
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 1e-11
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 5e-11
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 8e-10
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 1e-09
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 2e-09
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 3e-09
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 6e-09
3f6q_A179 Crystal Structure Of Integrin-Linked Kinase Ankyrin 3e-08
2kbx_A171 Solution Structure Of Ilk-Pinch Complex Length = 17 3e-08
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 6e-08
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 7e-08
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 1e-07
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 1e-07
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 1e-07
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 1e-07
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 1e-07
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 8e-06
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 2e-07
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 4e-07
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 4e-07
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 5e-07
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 5e-07
3b7b_A237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 4e-06
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 1e-05
2xzt_G136 Caspase-3 In Complex With Darpin-3.4_i78s Length = 1e-05
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 1e-05
1mx4_A168 Structure Of P18ink4c (F82q) Length = 168 2e-05
2y0b_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4_ 2e-05
1bu9_A168 Solution Structure Of P18-Ink4c, 21 Structures Leng 2e-05
1ihb_A162 Crystal Structure Of P18-Ink4c(Ink6) Length = 162 2e-05
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 2e-05
2xzd_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4 4e-05
1bi8_B166 Mechanism Of G1 Cyclin Dependent Kinase Inhibition 4e-05
1mx2_A168 Structure Of F71n Mutant Of P18ink4c Length = 168 4e-05
1bd8_A156 Structure Of Cdk Inhibitor P19ink4d Length = 156 4e-05
2xen_A91 Structural Determinants For Improved Thermal Stabil 5e-05
1n11_A 437 D34 Region Of Human Ankyrin-R And Linker Length = 4 6e-05
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 8e-05
4grg_A135 Crystal Structure Of Ige Complexed With E2_79, An A 8e-05
1blx_B166 P19ink4dCDK6 COMPLEX Length = 166 8e-05
1ap7_A168 P19-Ink4d From Mouse, Nmr, 20 Structures Length = 1 8e-05
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 1e-04
1mx6_A168 Structure Of P18ink4c (F92n) Length = 168 1e-04
3hg0_D136 Crystal Structure Of A Darpin In Complex With Orf49 2e-04
3c5r_A137 Crystal Structure Of The Bard1 Ankyrin Repeat Domai 2e-04
2jab_A136 A Designed Ankyrin Repeat Protein Evolved To Picomo 3e-04
1awc_B153 Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 1 5e-04
2dvw_A 231 Structure Of The Oncoprotein Gankyrin In Complex Wi 6e-04
3aji_A 231 Structure Of Gankyrin-S6atpase Photo-Cross-Linked S 6e-04
1qym_A 227 X-Ray Structure Of Human Gankyrin Length = 227 6e-04
4b93_B269 Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyri 6e-04
1uoh_A 226 Human Gankyrin Length = 226 6e-04
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure

Iteration: 1

Score = 72.0 bits (175), Expect = 1e-13, Method: Compositional matrix adjust. Identities = 48/133 (36%), Positives = 70/133 (52%), Gaps = 14/133 (10%) Query: 3 GADLNVLDKEKRSPLLLAASRGGWKTVLTLVRNKANILLKDINRRNILHLLVLNGGGHIK 62 GAD+N DK+ +PL LAA G + V L++ A++ KD + LHL G H+ Sbjct: 25 GADVNAKDKDGYTPLHLAAREGHLEIVEVLLKAGADVNAKDKDGYTPLHLAAREG--HL- 81 Query: 63 EFAEEVAAVFLGEGEASQGIQNLLNEKDKTGCSPLHYASREGHIISLENLINLGACINLK 122 E+ V L G +N KDK G +PLH A+REGH+ +E L+ GA +N + Sbjct: 82 ----EIVEVLLKAGAD-------VNAKDKDGYTPLHLAAREGHLEIVEVLLKAGADVNAQ 130 Query: 123 NNSNESPLHLAAR 135 + ++P LA R Sbjct: 131 DKFGKTPFDLAIR 143
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|3F6Q|A Chain A, Crystal Structure Of Integrin-Linked Kinase Ankyrin Repeat Domain In Complex With Pinch1 Lim1 Domain Length = 179 Back     alignment and structure
>pdb|2KBX|A Chain A, Solution Structure Of Ilk-Pinch Complex Length = 171 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|1MX4|A Chain A, Structure Of P18ink4c (F82q) Length = 168 Back     alignment and structure
>pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 Back     alignment and structure
>pdb|1BU9|A Chain A, Solution Structure Of P18-Ink4c, 21 Structures Length = 168 Back     alignment and structure
>pdb|1IHB|A Chain A, Crystal Structure Of P18-Ink4c(Ink6) Length = 162 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 Back     alignment and structure
>pdb|1BI8|B Chain B, Mechanism Of G1 Cyclin Dependent Kinase Inhibition From The Structures Cdk6-P19ink4d Inhibitor Complex Length = 166 Back     alignment and structure
>pdb|1MX2|A Chain A, Structure Of F71n Mutant Of P18ink4c Length = 168 Back     alignment and structure
>pdb|1BD8|A Chain A, Structure Of Cdk Inhibitor P19ink4d Length = 156 Back     alignment and structure
>pdb|2XEN|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module Length = 91 Back     alignment and structure
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure
>pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 Back     alignment and structure
>pdb|1BLX|B Chain B, P19ink4dCDK6 COMPLEX Length = 166 Back     alignment and structure
>pdb|1AP7|A Chain A, P19-Ink4d From Mouse, Nmr, 20 Structures Length = 168 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|1MX6|A Chain A, Structure Of P18ink4c (F92n) Length = 168 Back     alignment and structure
>pdb|3HG0|D Chain D, Crystal Structure Of A Darpin In Complex With Orf49 From Lactococcal Phage Tp901-1 Length = 136 Back     alignment and structure
>pdb|3C5R|A Chain A, Crystal Structure Of The Bard1 Ankyrin Repeat Domain And Its Functional Consequences Length = 137 Back     alignment and structure
>pdb|2JAB|A Chain A, A Designed Ankyrin Repeat Protein Evolved To Picomolar Affinity To Her2 Length = 136 Back     alignment and structure
>pdb|1AWC|B Chain B, Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 153 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure
>pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|4B93|B Chain B, Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyrin Repeat Domain Of Varp Length = 269 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query135
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 3e-23
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 7e-15
1ikn_D 236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-14
1ikn_D 236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-12
1ikn_D 236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 1e-09
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 6e-05
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-04
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-21
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-21
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 6e-21
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-20
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-19
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 4e-19
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 4e-19
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-15
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 7e-12
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 7e-21
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 9e-17
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 4e-16
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 3e-12
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 2e-20
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 4e-18
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-17
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 8e-16
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 5e-14
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 8e-14
3v31_A167 Ankyrin repeat family A protein 2; structural geno 5e-20
3v31_A167 Ankyrin repeat family A protein 2; structural geno 4e-16
3v31_A167 Ankyrin repeat family A protein 2; structural geno 4e-14
3v31_A 167 Ankyrin repeat family A protein 2; structural geno 9e-08
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 7e-20
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-18
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-17
3b7b_A 237 Euchromatic histone-lysine N-methyltransferase 1; 4e-17
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-13
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 7e-20
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-16
1oy3_D 282 Transcription factor inhibitor I-kappa-B-beta; pro 8e-13
1oy3_D 282 Transcription factor inhibitor I-kappa-B-beta; pro 5e-11
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 3e-10
1oy3_D 282 Transcription factor inhibitor I-kappa-B-beta; pro 6e-10
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 4e-05
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-19
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-17
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-15
2dzn_A 228 Probable 26S proteasome regulatory subunit P28; an 2e-14
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-07
2dzn_A 228 Probable 26S proteasome regulatory subunit P28; an 4e-07
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 2e-19
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 1e-13
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 5e-13
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 3e-19
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 7e-19
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-18
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-13
2f8y_A 223 Notch homolog 1, translocation-associated (drosoph 4e-12
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 5e-19
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 3e-16
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 1e-15
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 1e-14
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 1e-11
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 6e-19
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 1e-15
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 9e-14
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 8e-19
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-18
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-17
1yyh_A 253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 4e-14
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 8e-14
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 9e-19
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 7e-17
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 7e-11
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-18
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-18
1k1a_A 241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 4e-14
1k1a_A 241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 4e-12
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 4e-11
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 2e-18
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 5e-11
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-18
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 2e-17
3eu9_A 240 Huntingtin-interacting protein 14; epigenetics, an 1e-14
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 3e-12
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-18
1awc_B153 Protein (GA binding protein beta 1); complex (tran 5e-16
1awc_B153 Protein (GA binding protein beta 1); complex (tran 3e-11
1awc_B 153 Protein (GA binding protein beta 1); complex (tran 3e-07
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-18
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-17
2xai_A 261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-16
2xai_A 261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 7e-14
2xai_A 261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 6e-10
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-09
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-18
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 8e-18
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 1e-15
3ehr_A 222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-14
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-07
1sw6_A327 Regulatory protein SWI6; transcription regulation, 2e-18
1sw6_A327 Regulatory protein SWI6; transcription regulation, 1e-11
1sw6_A327 Regulatory protein SWI6; transcription regulation, 3e-11
1sw6_A 327 Regulatory protein SWI6; transcription regulation, 1e-08
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-18
3hra_A201 Ankyrin repeat family protein; structural protein; 1e-15
3hra_A201 Ankyrin repeat family protein; structural protein; 2e-15
3hra_A 201 Ankyrin repeat family protein; structural protein; 1e-11
3v30_A172 DNA-binding protein rfxank; structural genomics co 6e-18
3v30_A172 DNA-binding protein rfxank; structural genomics co 1e-15
3v30_A172 DNA-binding protein rfxank; structural genomics co 6e-14
3v30_A 172 DNA-binding protein rfxank; structural genomics co 9e-07
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-17
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 2e-17
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-15
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-11
2fo1_E 373 LIN-12 protein; beta-barrel, protein-DNA complex, 7e-09
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-08
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 1e-17
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 1e-16
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-17
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 6e-17
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 6e-13
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 6e-10
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 2e-17
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 6e-17
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 7e-15
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 3e-14
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-13
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 2e-17
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 1e-12
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 2e-09
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 3e-17
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 3e-15
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 4e-17
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 1e-15
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 5e-13
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 6e-17
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-16
3d9h_A 285 CDNA FLJ77766, highly similar to HOMO sapiens anky 4e-15
3d9h_A 285 CDNA FLJ77766, highly similar to HOMO sapiens anky 5e-14
3d9h_A 285 CDNA FLJ77766, highly similar to HOMO sapiens anky 2e-12
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 4e-11
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 1e-16
3kea_A 285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 5e-15
3kea_A 285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 7e-10
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 3e-07
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 5e-06
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 3e-16
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 6e-05
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 4e-16
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 7e-12
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 1e-10
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 4e-08
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 5e-16
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 2e-14
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 6e-12
2vge_A 229 RELA-associated inhibitor; iaspp, nucleus, apoptos 9e-11
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 8e-16
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 8e-10
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 2e-15
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 6e-14
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 2e-06
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 3e-15
1ycs_B 239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-13
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 8e-09
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 1e-14
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-14
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 2e-14
3aji_A 231 26S proteasome non-ATPase regulatory subunit 10; g 6e-12
3aji_A 231 26S proteasome non-ATPase regulatory subunit 10; g 1e-11
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 1e-07
3aji_A 231 26S proteasome non-ATPase regulatory subunit 10; g 4e-07
2rfa_A232 Transient receptor potential cation channel subfa 5e-14
2rfa_A 232 Transient receptor potential cation channel subfa 1e-12
2rfa_A232 Transient receptor potential cation channel subfa 2e-12
2rfa_A 232 Transient receptor potential cation channel subfa 1e-06
2etb_A256 Transient receptor potential cation channel subfam 9e-14
2etb_A256 Transient receptor potential cation channel subfam 5e-11
2etb_A 256 Transient receptor potential cation channel subfam 1e-10
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 1e-13
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-11
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 2e-11
3ui2_A 244 Signal recognition particle 43 kDa protein, chlor; 3e-09
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 4e-06
3deo_A183 Signal recognition particle 43 kDa protein; chloro 1e-13
3deo_A183 Signal recognition particle 43 kDa protein; chloro 7e-13
3deo_A183 Signal recognition particle 43 kDa protein; chloro 3e-10
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 1e-12
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 1e-09
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 3e-08
2pnn_A 273 Transient receptor potential cation channel subfa 5e-12
2pnn_A273 Transient receptor potential cation channel subfa 2e-11
3jxi_A 260 Vanilloid receptor-related osmotically activated p 8e-12
3jxi_A260 Vanilloid receptor-related osmotically activated p 2e-11
3jxi_A260 Vanilloid receptor-related osmotically activated p 3e-07
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 1e-09
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 4e-05
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-07
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 5e-04
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 8e-07
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 3e-06
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 6e-06
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 2e-05
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 2e-04
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 2e-06
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 1e-05
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 7e-04
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 4e-04
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
 Score = 89.5 bits (223), Expect = 3e-23
 Identities = 33/134 (24%), Positives = 55/134 (41%), Gaps = 9/134 (6%)

Query: 3   GADLNVLDKEKRSPLLLAASRGGWKTVLTLVRNKANILLKDINRRNILHLLVLNGGGHIK 62
            A LN  +  +++PL LA      +    L+    +  L+D      LHL    G     
Sbjct: 35  LAFLNFQNNLQQTPLHLAVITNQPEIAEALLGAGCDPELRDFRGNTPLHLACEQG----- 89

Query: 63  EFAEEVAAVFLGEGEASQGIQNLLNEKDKTGCSPLHYASREGHIISLENLINLGACINLK 122
                   V       +  + ++L   +  G + LH AS  G++  +E L++LGA +N +
Sbjct: 90  --CLASVGVLTQSC-TTPHLHSILKATNYNGHTCLHLASIHGYLGIVELLVSLGADVNAQ 146

Query: 123 NNSN-ESPLHLAAR 135
              N  + LHLA  
Sbjct: 147 EPCNGRTALHLAVD 160


>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query135
4gpm_A169 Engineered protein OR264; de novo protein, structu 100.0
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.98
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.97
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.97
1sw6_A327 Regulatory protein SWI6; transcription regulation, 99.97
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 99.97
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.97
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.97
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.97
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.97
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.97
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.97
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.97
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.96
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.96
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 99.96
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.96
2rfa_A232 Transient receptor potential cation channel subfa 99.96
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.96
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.96
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.96
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 99.96
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.96
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.96
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.96
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 99.96
3hra_A201 Ankyrin repeat family protein; structural protein; 99.96
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.96
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.96
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 99.96
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 99.96
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 99.96
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 99.96
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 99.95
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.95
3hra_A201 Ankyrin repeat family protein; structural protein; 99.95
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.95
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.95
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 99.95
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.95
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.95
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.95
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.95
2etb_A256 Transient receptor potential cation channel subfam 99.95
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.95
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 99.95
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.95
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.95
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 99.95
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 99.95
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.95
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.95
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.95
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 99.95
2etb_A256 Transient receptor potential cation channel subfam 99.95
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.95
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 99.95
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 99.95
3kea_A 285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.95
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 99.95
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.94
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.94
2rfa_A232 Transient receptor potential cation channel subfa 99.94
3utm_A 351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 99.94
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.94
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.94
2pnn_A273 Transient receptor potential cation channel subfa 99.94
3ljn_A 364 Hypothetical protein; ankyrin, structural genomics 99.94
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.94
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.94
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 99.94
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.94
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.94
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.94
1wdy_A 285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.94
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.94
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.94
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.93
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.93
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 99.93
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.93
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.93
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 99.93
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 99.93
1s70_B 299 130 kDa myosin-binding subunit of smooth muscle my 99.93
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.93
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.93
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.93
2pnn_A273 Transient receptor potential cation channel subfa 99.93
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.93
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.93
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.92
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.92
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.92
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.91
4g8k_A 337 2-5A-dependent ribonuclease; ankyrin-repeat domain 99.91
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.91
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.91
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.9
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.9
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.9
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.9
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.9
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.88
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.88
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.88
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.88
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.88
1sw6_A 327 Regulatory protein SWI6; transcription regulation, 99.86
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.84
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.82
2aja_A 376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.81
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.76
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.75
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
Probab=100.00  E-value=5.1e-35  Score=171.06  Aligned_cols=119  Identities=34%  Similarity=0.494  Sum_probs=110.2

Q ss_pred             CCCCccccccCCChHHHHHHHhCCHHHHHHHHHcCCCccccccCCchHHHHHHHhCCCchHHHHHHHHHHHhcCCcchhh
Q psy8766           2 TGADLNVLDKEKRSPLLLAASRGGWKTVLTLVRNKANILLKDINRRNILHLLVLNGGGHIKEFAEEVAAVFLGEGEASQG   81 (135)
Q Consensus         2 ~g~~~n~~~~~g~tpl~~a~~~~~~~~~~~Ll~~g~~~~~~~~~g~t~l~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~   81 (135)
                      +|+|+|.+|.+|.||||+|+..++.+++++|++.|++++.+|..|.||||+|+..|+.+++++++       +.+..   
T Consensus        26 ~Gadvn~~d~~g~t~l~~a~~~~~~~~~~~ll~~gad~~~~d~~g~TpLh~A~~~g~~~~v~~Ll-------~~gad---   95 (169)
T 4gpm_A           26 NGADVNASDSDGRTPLHHAAENGHKEVVKLLISKGADVNAKDSDGRTPLHHAAENGHKEVVKLLI-------SKGAD---   95 (169)
T ss_dssp             TTCCTTCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCTTSCCHHHHHHHTTCHHHHHHHH-------HTTCC---
T ss_pred             CCCCCCCcCCCCCCHHHHHHHcCCHHHHHHHHhcccchhhhccCCCCHHHHHHHcCCHHHHHHHH-------HCcCC---
Confidence            69999999999999999999999999999999999999999999999999999999866655554       34444   


Q ss_pred             hhhhhhccCCCCCcHHHHHHhcCcHHHHHHHHHcCCCeeecCCCCCCcchhcc
Q psy8766          82 IQNLLNEKDKTGCSPLHYASREGHIISLENLINLGACINLKNNSNESPLHLAA  134 (135)
Q Consensus        82 ~~~~~~~~~~~~~t~l~~a~~~~~~~~~~~ll~~g~~~~~~~~~g~tpl~~a~  134 (135)
                          ++.++..|+||||+|+..|+.+++++|+++|++++.+|..|+|||++|+
T Consensus        96 ----vn~~d~~G~TpLh~A~~~g~~~~v~~Ll~~gad~~~~d~~G~TpL~~A~  144 (169)
T 4gpm_A           96 ----VNAKDSDGRTPLHHAAENGHKEVVKLLISKGADVNTSDSDGRTPLDLAR  144 (169)
T ss_dssp             ----TTCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCTTSCCHHHHHH
T ss_pred             ----CCCCCCCCCCHHHHHHHcCCHHHHHHHHHcCCCccccCCCCCCHHHHHH
Confidence                7888999999999999999999999999999999999999999999986



>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 135
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-15
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-13
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-10
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 8e-10
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 1e-09
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-09
d1n11a_ 408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-08
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 5e-07
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 5e-14
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-09
d1uoha_ 223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 0.003
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 5e-14
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 4e-06
d1sw6a_ 301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 5e-06
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 0.003
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 8e-11
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 4e-09
d1wdya_ 285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 2e-05
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 3e-05
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 1e-10
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 2e-05
d2fo1e1 277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 2e-04
d2fo1e1 277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 0.004
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 1e-09
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 8e-06
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 8e-06
d1s70b_ 291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 7e-05
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 7e-05
d1oy3d_ 255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 2e-09
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 5e-04
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 7e-04
d1oy3d_ 255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 0.002
d1k1aa_ 228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 6e-08
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 1e-07
d1iknd_ 221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 2e-07
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 1e-04
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 6e-04
d1ixva_ 229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 4e-07
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 6e-06
d2ajaa1 346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 4e-06
d2ajaa1 346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 9e-05
d2ajaa1 346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 1e-04
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 3e-04
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 2e-05
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 4e-05
d1ihba_ 156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 2e-04
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 0.003
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 68.8 bits (167), Expect = 2e-15
 Identities = 35/152 (23%), Positives = 58/152 (38%), Gaps = 19/152 (12%)

Query: 3   GADLNVLDKEKRSPLLLAASRGGWKTVLTLVRNKANILLKDINRRNILHLLVLNGGGHIK 62
           GA  NV + +  +PL +AA  G  +    L++NKA +  K  + +  LH     G  ++ 
Sbjct: 23  GASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMV 82

Query: 63  EFAEEVAA-------------------VFLGEGEASQGIQNLLNEKDKTGCSPLHYASRE 103
           +   E  A                     +    A    +       K G +PLH A++ 
Sbjct: 83  KLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKY 142

Query: 104 GHIISLENLINLGACINLKNNSNESPLHLAAR 135
           G +   E L+   A  N    +  +PLH+A  
Sbjct: 143 GKVRVAELLLERDAHPNAAGKNGLTPLHVAVH 174


>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query135
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.97
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.97
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.97
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.97
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.96
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.96
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.95
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.95
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.95
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.95
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.95
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.94
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.94
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.94
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.94
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 99.93
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 99.93
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.93
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.92
d1n11a_ 408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 99.92
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.9
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.9
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.9
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.9
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.89
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.88
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.88
d2ajaa1 346 Hypothetical protein LPG2416 {Legionella pneumophi 99.88
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.87
d2ajaa1 346 Hypothetical protein LPG2416 {Legionella pneumophi 99.87
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.86
d2fo1e1 277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.86
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 99.86
d1s70b_ 291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 99.86
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.85
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.82
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.8
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.51
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Myotrophin
species: Rat (Rattus norvegicus) [TaxId: 10116]
Probab=99.97  E-value=4.2e-32  Score=148.91  Aligned_cols=107  Identities=24%  Similarity=0.264  Sum_probs=98.1

Q ss_pred             ChHHHHHHHhCCHHHHHHHHHcCCCccccccCCchHHHHHHHhCCCchHHHHHHHHHHHhcCCcchhhhhhhhhccCCCC
Q psy8766          14 RSPLLLAASRGGWKTVLTLVRNKANILLKDINRRNILHLLVLNGGGHIKEFAEEVAAVFLGEGEASQGIQNLLNEKDKTG   93 (135)
Q Consensus        14 ~tpl~~a~~~~~~~~~~~Ll~~g~~~~~~~~~g~t~l~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   93 (135)
                      .|||++|++.|+.+++++|++.|++++.++..|.||||+|+..++.+++.++..       .+..       ++.++..|
T Consensus         3 ~tpL~~A~~~g~~~~v~~Ll~~g~d~n~~~~~g~t~lh~A~~~~~~~~~~~ll~-------~g~d-------in~~d~~g   68 (118)
T d1myoa_           3 DKEFMWALKNGDLDEVKDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLL-------KGAD-------INAPDKHH   68 (118)
T ss_dssp             HHHHHHHHHTTCHHHHHHHHTTTCCCCCCSSSSCCTTHHHHHHSTTTHHHHHHH-------SSCT-------TTCCSSSC
T ss_pred             ChHHHHHHHCCCHHHHHHHHHhhhcccccccccccccccccccccccccccccc-------ccce-------eeeccccc
Confidence            589999999999999999999999999999999999999999999887666554       3333       77889999


Q ss_pred             CcHHHHHHhcCcHHHHHHHHHcCCCeeecCCCCCCcchhcc
Q psy8766          94 CSPLHYASREGHIISLENLINLGACINLKNNSNESPLHLAA  134 (135)
Q Consensus        94 ~t~l~~a~~~~~~~~~~~ll~~g~~~~~~~~~g~tpl~~a~  134 (135)
                      +||||+|+..++.+++++|+++|++++.+|..|.|||++|.
T Consensus        69 ~tpLh~A~~~~~~~~v~~Ll~~Gad~~~~d~~G~t~l~~a~  109 (118)
T d1myoa_          69 ITPLLSAVYEGHVSCVKLLLSKGADKTVKGPDGLTALEATD  109 (118)
T ss_dssp             SCHHHHHHTTTCCHHHHHHHTTCCCSSSSSSSTCCCCCTCS
T ss_pred             ccchhhhhhcCchhhhhhhhcccccceeeCCCCCCHHHHHh
Confidence            99999999999999999999999999999999999999885



>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure