Psyllid ID: psy8809

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-
MERSPMISYIFHIRIIVLLTVLGLLDLYFVVGAYQTTVTKGASVMIVFGFEYAILLTVCVNILIKYALHTIDLNREIFWESKAVFFLYMELVMSFVKVIMYIVFVLIMMRVYTLPLFAFRPMYYAARSFRKALKDVNKLLIMNAYSSPLFIGFVKVIMYIVFVLIMMRVYTLPLFAFRPMYYAARSFRKALKDVINSRRAIHHLNNSFPDATSDELTEADNVCIICREEMQSASKKLPCNHIFHTSCLRSWFQRHQTCPTE
ccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHcccccccccHHHHcccccccccccccccHHHHHHHHHcccccccc
cccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHEHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHcHHcHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHcccEEEEEcHHccccccccccccHHHHHHHHHHHHHHcccccc
MERSPMISYIFHIRIIVLLTVLGLLDLYFVVGAYQTTVTKGASVMIVFGFEYAILLTVCVNILIKYALHTIDLNREIFWESKAVFFLYMELVMSFVKVIMYIVFVLIMMRVYtlplfafrpmYYAARSFRKALKDVNKLLIMNayssplfiGFVKVIMYIVFVLIMMRVYtlplfafrpmYYAARSFRKALKDVINSRraihhlnnsfpdatsdelteadNVCIICREEMqsaskklpcnhifhtsCLRSWfqrhqtcpte
MERSPMISYIFHIRIIVLLTVLGLLDLYFVVGAYQTTVTKGASVMIVFGFEYAILLTVCVNILIKYALHTIDLNREIFWESKAVFFLYMELVMSFVKVIMYIVFVLIMMRVYTLPLFAFRPMYYAARSFRKALKDVNKLLIMNAYSSPLFIGFVKVIMYIVFVLIMMRVYTLPLFAFRPMYYAARSFRKALKDVINSRRAIHHlnnsfpdatsdeLTEADNVCIICREEMQSASKKLPCNHIFHTSCLRSWFQRHQTCPTE
MERSPMISYIFHIRIIVlltvlglldlYFVVGAYQTTVTKGASVMIVFGFEYAILLTVCVNILIKYALHTIDLNREIFWESKAVFFLYMELVMSFVKVIMYIVFVLIMMRVYTLPLFAFRPMYYAARSFRKALKDVNKLLIMNAYSSPLFIGFVKVIMYIVFVLIMMRVYTLPLFAFRPMYYAARSFRKALKDVINSRRAIHHLNNSFPDATSDELTEADNVCIICREEMQSASKKLPCNHIFHTSCLRSWFQRHQTCPTE
*****MISYIFHIRIIVLLTVLGLLDLYFVVGAYQTTVTKGASVMIVFGFEYAILLTVCVNILIKYALHTIDLNREIFWESKAVFFLYMELVMSFVKVIMYIVFVLIMMRVYTLPLFAFRPMYYAARSFRKALKDVNKLLIMNAYSSPLFIGFVKVIMYIVFVLIMMRVYTLPLFAFRPMYYAARSFRKALKDVINSRRAIHHLNNSFPDAT*DELTEADNVCIICREEMQSASKKLPCNHIFHTSCLRSWFQR*******
***SPMISYIFHIRIIVLLTVLGLLDLYFVVGAYQTTVTKGASVMIVFGFEYAILLTVCVNILIKYALHTIDLNREIFWESKAVFFLYMELVMSFVKVIMYIVFVLIMMRVYTLPLFAFRPMYYAARSFRKALKDVNKLLIMNAYSSPLFIGFVKVIMYIVFVLIMMRVYTLPLFAFRPMYYAARSFRKALKDVINSRRAIHHLNNS************DNVCIICREEMQSASKKLPCNHIFHTSCLRSWFQRHQTCPT*
MERSPMISYIFHIRIIVLLTVLGLLDLYFVVGAYQTTVTKGASVMIVFGFEYAILLTVCVNILIKYALHTIDLNREIFWESKAVFFLYMELVMSFVKVIMYIVFVLIMMRVYTLPLFAFRPMYYAARSFRKALKDVNKLLIMNAYSSPLFIGFVKVIMYIVFVLIMMRVYTLPLFAFRPMYYAARSFRKALKDVINSRRAIHHLNNSFPDATSDELTEADNVCIICREEMQSASKKLPCNHIFHTSCLRSWF*********
****PMISYIFHIRIIVLLTVLGLLDLYFVVGAYQTTVTKGASVMIVFGFEYAILLTVCVNILIKYALHTIDLNREIFWESKAVFFLYMELVMSFVKVIMYIVFVLIMMRVYTLPLFAFRPMYYAARSFRKALKDVNKLLIMNAYSSPLFIGFVKVIMYIVFVLIMMRVYTLPLFAFRPMYYAARSFRKALKDVINSRRAIHHLNNSFPDATSDELTEADNVCIICREEMQSASKKLPCNHIFHTSCLRSWFQRHQTCPT*
iiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MERSPMISYIFHIRIIVLLTVLGLLDLYFVVGAYQTTVTKGASVMIVFGFEYAILLTVCVNILIKYALHTIDLNREIFWESKAVFFLYMELVMSFVKVIMYIVFVLIMMRVYTLPLFAFRPMYYAARSFRKALKDVNKLLIMNAYSSPLFIGFVKVIMYIVFVLIMMRVYTLPLFAFRPMYYAARSFRKALKDVINSRRAIHHLNNSFPDATSDELTEADNVCIICREEMQSASKKLPCNHIFHTSCLRSWFQRHQTCPTE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query261 2.2.26 [Sep-21-2011]
Q95SP2 626 E3 ubiquitin-protein liga yes N/A 0.773 0.322 0.457 3e-63
Q5XHH7 595 E3 ubiquitin-protein liga N/A N/A 0.773 0.339 0.465 4e-60
Q6NRL6 605 E3 ubiquitin-protein liga N/A N/A 0.773 0.333 0.465 5e-60
Q803I8 625 E3 ubiquitin-protein liga yes N/A 0.773 0.323 0.407 2e-46
Q86TM6 617 E3 ubiquitin-protein liga yes N/A 0.773 0.327 0.415 4e-43
Q9DBY1 612 E3 ubiquitin-protein liga yes N/A 0.773 0.330 0.415 5e-43
A8Y4B2 622 E3 ubiquitin-protein liga N/A N/A 0.513 0.215 0.5 4e-34
Q20798 610 E3 ubiquitin-protein liga yes N/A 0.513 0.219 0.492 1e-33
Q9R049 643 E3 ubiquitin-protein liga no N/A 0.777 0.315 0.229 8e-15
Q9UKV5 643 E3 ubiquitin-protein liga no N/A 0.758 0.307 0.223 1e-14
>sp|Q95SP2|HRD1_DROME E3 ubiquitin-protein ligase HRD1 OS=Drosophila melanogaster GN=sip3 PE=1 SV=1 Back     alignment and function desciption
 Score =  241 bits (616), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 119/260 (45%), Positives = 160/260 (61%), Gaps = 58/260 (22%)

Query: 1   MERSPMISYIFHIRIIVLLTVLGLLDLYFVVGAYQTTVTKGASVMIVFGFEYAILLTVCV 60
           MERSP++ ++FHIR+  LLTVLG+LD   ++ AY +T+ +G +V +VFGFEYAILLTV  
Sbjct: 125 MERSPVLGWLFHIRVGSLLTVLGILDYVLLIHAYNSTLVRGPTVQLVFGFEYAILLTVIA 184

Query: 61  NILIKYALHTIDLNREIFWESKAVFFLYMELVMSFVKVIMYIVFVLIMMRVYTLPLFAFR 120
           +  IKY LH  ++  +  WE+KAVF LY ELV+  +KV++YI+FV+IM ++Y LP+F FR
Sbjct: 185 STAIKYVLHAAEMRTDTPWENKAVFLLYTELVIGLIKVVLYILFVVIMAKIYALPMFVFR 244

Query: 121 PMYYAARSFRKALKDVNKLLIMNAYSSPLFIGFVKVIMYIVFVLIMMRVYTLPLFAFRPM 180
           PM++  R+FRKAL DV                            IM R            
Sbjct: 245 PMFFTIRNFRKALNDV----------------------------IMSR------------ 264

Query: 181 YYAARSFRKALKDVINSRRAIHHLNNSFPDATSDELTEADNVCIICREEMQSASKKLPCN 240
               R+ R              ++N  +PDAT +EL ++DN+CIICRE+M + SKKLPC 
Sbjct: 265 ----RAIR--------------NMNTLYPDATPEELRQSDNICIICREDMVNHSKKLPCG 306

Query: 241 HIFHTSCLRSWFQRHQTCPT 260
           HIFHT+CLRSWFQR QTCPT
Sbjct: 307 HIFHTTCLRSWFQRQQTCPT 326
Acts as an E3 ubiquitin-protein ligase which accepts ubiquitin specifically from endoplasmic reticulum-associated UBC7 E2 ligase and transfers it to substrates, promoting their degradation. Component of the endoplasmic reticulum quality control (ERQC) system also called ER-associated degradation (ERAD) involved in ubiquitin-dependent degradation of misfolded endoplasmic reticulum proteins. Also promotes the degradation of normal but naturally short-lived proteins. Protects cells from ER stress-induced apoptosis. Sequesters p53 in the cytoplasm and promotes its degradation, thereby negatively regulating its biological function in transcription, cell cycle regulation and apoptosis.
Drosophila melanogaster (taxid: 7227)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|Q5XHH7|SYVNB_XENLA E3 ubiquitin-protein ligase synoviolin B OS=Xenopus laevis GN=syvn1-b PE=2 SV=1 Back     alignment and function description
>sp|Q6NRL6|SYVNA_XENLA E3 ubiquitin-protein ligase synoviolin A OS=Xenopus laevis GN=syvn1-a PE=2 SV=1 Back     alignment and function description
>sp|Q803I8|SYVN1_DANRE E3 ubiquitin-protein ligase synoviolin OS=Danio rerio GN=syvn1 PE=2 SV=2 Back     alignment and function description
>sp|Q86TM6|SYVN1_HUMAN E3 ubiquitin-protein ligase synoviolin OS=Homo sapiens GN=SYVN1 PE=1 SV=2 Back     alignment and function description
>sp|Q9DBY1|SYVN1_MOUSE E3 ubiquitin-protein ligase synoviolin OS=Mus musculus GN=Syvn1 PE=1 SV=3 Back     alignment and function description
>sp|A8Y4B2|HRD1_CAEBR E3 ubiquitin-protein ligase hrd-1 OS=Caenorhabditis briggsae GN=sel-11 PE=3 SV=2 Back     alignment and function description
>sp|Q20798|HRD1_CAEEL E3 ubiquitin-protein ligase hrd-1 OS=Caenorhabditis elegans GN=sel-11 PE=3 SV=1 Back     alignment and function description
>sp|Q9R049|AMFR_MOUSE E3 ubiquitin-protein ligase AMFR OS=Mus musculus GN=Amfr PE=1 SV=2 Back     alignment and function description
>sp|Q9UKV5|AMFR_HUMAN E3 ubiquitin-protein ligase AMFR OS=Homo sapiens GN=AMFR PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query261
328707681 646 PREDICTED: e3 ubiquitin-protein ligase s 0.773 0.312 0.482 5e-65
241630759 580 E3 ubiquitin ligase, putative [Ixodes sc 0.773 0.348 0.498 2e-64
149062128 639 synovial apoptosis inhibitor 1, synoviol 0.831 0.339 0.466 4e-64
345492634 584 PREDICTED: E3 ubiquitin-protein ligase H 0.773 0.345 0.488 4e-64
148701247 639 synovial apoptosis inhibitor 1, synoviol 0.831 0.339 0.463 7e-64
427789049 629 Putative e3 ubiquitin-protein ligase syn 0.773 0.321 0.486 9e-64
291240670 553 PREDICTED: E3 ubiquitin-protein ligase s 0.773 0.365 0.469 2e-62
328788399 600 PREDICTED: e3 ubiquitin-protein ligase s 0.773 0.336 0.473 3e-62
380025918 531 PREDICTED: E3 ubiquitin-protein ligase s 0.773 0.380 0.473 3e-62
380025916 601 PREDICTED: E3 ubiquitin-protein ligase s 0.773 0.336 0.473 3e-62
>gi|328707681|ref|XP_003243468.1| PREDICTED: e3 ubiquitin-protein ligase synoviolin-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  253 bits (646), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 126/261 (48%), Positives = 165/261 (63%), Gaps = 59/261 (22%)

Query: 1   MERSPMISYIFHIRIIVLLTVLGLLDLYFVVGAYQTTVTKGASVMIVFGFEYAILLTVCV 60
           MER+P+ISYIFH+RI +LL +L L D+YFV  AY TT+ KG SV +VFGFEYA+L+T+  
Sbjct: 137 MERTPVISYIFHLRIWLLLVILTLGDVYFVHDAYTTTMAKGPSVQLVFGFEYALLITLAA 196

Query: 61  NILIKYALHTIDLNREIFWESKAVFFLYMELVMSFVKVIMYIVFVLIMMRVYTLPLFAFR 120
           N   KY LH +D++ + FWESKAV             +++Y+ F                
Sbjct: 197 NATFKYILHAVDVHSDTFWESKAV-------------LLLYLEF---------------- 227

Query: 121 PMYYAARSFRKALKDVNKLLIMNAYSSPLFIGFVKVIMYIVFVLIMMRVYTLPLFAFRPM 180
                                        FIG  K +MY+VF++IM+R YT+PLFAFRPM
Sbjct: 228 -----------------------------FIGLCKAVMYVVFLIIMVRTYTIPLFAFRPM 258

Query: 181 YYAARSFRKALKDVINSRRAIHHLNNSFPDATSDELTEADNVCIICREEMQ-SASKKLPC 239
           Y+  R+F+K  +D++ SRRAIH++N  +PDAT  +L   +NVCIICRE+M  +A+KKLPC
Sbjct: 259 YHTLRNFKKVFQDLVLSRRAIHNMNTLYPDATLQDLQAIENVCIICREDMTAAAAKKLPC 318

Query: 240 NHIFHTSCLRSWFQRHQTCPT 260
           NHIFHTSCLRSWFQRHQTCPT
Sbjct: 319 NHIFHTSCLRSWFQRHQTCPT 339

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|241630759|ref|XP_002410197.1| E3 ubiquitin ligase, putative [Ixodes scapularis] gi|215503341|gb|EEC12835.1| E3 ubiquitin ligase, putative [Ixodes scapularis] Back     alignment and taxonomy information
>gi|149062128|gb|EDM12551.1| synovial apoptosis inhibitor 1, synoviolin, isoform CRA_a [Rattus norvegicus] Back     alignment and taxonomy information
>gi|345492634|ref|XP_001600783.2| PREDICTED: E3 ubiquitin-protein ligase HRD1-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|148701247|gb|EDL33194.1| synovial apoptosis inhibitor 1, synoviolin, isoform CRA_a [Mus musculus] Back     alignment and taxonomy information
>gi|427789049|gb|JAA59976.1| Putative e3 ubiquitin-protein ligase synoviolin [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|291240670|ref|XP_002740241.1| PREDICTED: E3 ubiquitin-protein ligase synoviolin-like, partial [Saccoglossus kowalevskii] Back     alignment and taxonomy information
>gi|328788399|ref|XP_003251123.1| PREDICTED: e3 ubiquitin-protein ligase synoviolin A-like isoform 1 [Apis mellifera] Back     alignment and taxonomy information
>gi|380025918|ref|XP_003696710.1| PREDICTED: E3 ubiquitin-protein ligase synoviolin A-like isoform 2 [Apis florea] Back     alignment and taxonomy information
>gi|380025916|ref|XP_003696709.1| PREDICTED: E3 ubiquitin-protein ligase synoviolin A-like isoform 1 [Apis florea] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query261
FB|FBgn0039875 626 sip3 "septin interacting prote 0.467 0.194 0.612 1.9e-40
UNIPROTKB|Q6NRL6 605 syvn1-a "E3 ubiquitin-protein 0.467 0.201 0.629 2e-40
UNIPROTKB|Q5XHH7 595 syvn1-b "E3 ubiquitin-protein 0.467 0.205 0.629 2e-40
UNIPROTKB|I3LGG8 610 SYVN1 "Uncharacterized protein 0.467 0.2 0.629 3.3e-40
MGI|MGI:1921376 612 Syvn1 "synovial apoptosis inhi 0.467 0.199 0.629 4.2e-40
UNIPROTKB|E1BAK9 611 SYVN1 "Uncharacterized protein 0.467 0.199 0.629 5.3e-40
UNIPROTKB|Q86TM6 617 SYVN1 "E3 ubiquitin-protein li 0.467 0.197 0.629 6.2e-40
ZFIN|ZDB-GENE-030131-7166 625 syvn1 "synovial apoptosis inhi 0.467 0.195 0.620 1.7e-39
UNIPROTKB|E2RSJ2 776 SYVN1 "Uncharacterized protein 0.467 0.157 0.629 3.2e-39
UNIPROTKB|E9PMA1236 SYVN1 "E3 ubiquitin-protein li 0.517 0.572 0.518 3.6e-34
FB|FBgn0039875 sip3 "septin interacting protein 3" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 431 (156.8 bits), Expect = 1.9e-40, P = 1.9e-40
 Identities = 76/124 (61%), Positives = 100/124 (80%)

Query:   137 NKLLIMNAYSSPLFIGFVKVIMYIVFVLIMMRVYTLPLFAFRPMYYAARSFRKALKDVIN 196
             NK + +  Y+  L IG +KV++YI+FV+IM ++Y LP+F FRPM++  R+FRKAL DVI 
Sbjct:   205 NKAVFL-LYTE-LVIGLIKVVLYILFVVIMAKIYALPMFVFRPMFFTIRNFRKALNDVIM 262

Query:   197 SRRAIHHLNNSFPDATSDELTEADNVCIICREEMQSASKKLPCNHIFHTSCLRSWFQRHQ 256
             SRRAI ++N  +PDAT +EL ++DN+CIICRE+M + SKKLPC HIFHT+CLRSWFQR Q
Sbjct:   263 SRRAIRNMNTLYPDATPEELRQSDNICIICREDMVNHSKKLPCGHIFHTTCLRSWFQRQQ 322

Query:   257 TCPT 260
             TCPT
Sbjct:   323 TCPT 326
GO:0008270 "zinc ion binding" evidence=IEA
GO:0016881 "acid-amino acid ligase activity" evidence=ISS
GO:0005783 "endoplasmic reticulum" evidence=ISS
GO:0030433 "ER-associated protein catabolic process" evidence=ISS
GO:0005515 "protein binding" evidence=IPI
GO:0016021 "integral to membrane" evidence=ISM
GO:0004842 "ubiquitin-protein ligase activity" evidence=ISS
GO:0030968 "endoplasmic reticulum unfolded protein response" evidence=IGI
UNIPROTKB|Q6NRL6 syvn1-a "E3 ubiquitin-protein ligase synoviolin A" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
UNIPROTKB|Q5XHH7 syvn1-b "E3 ubiquitin-protein ligase synoviolin B" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
UNIPROTKB|I3LGG8 SYVN1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
MGI|MGI:1921376 Syvn1 "synovial apoptosis inhibitor 1, synoviolin" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E1BAK9 SYVN1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q86TM6 SYVN1 "E3 ubiquitin-protein ligase synoviolin" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-7166 syvn1 "synovial apoptosis inhibitor 1, synoviolin" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E2RSJ2 SYVN1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E9PMA1 SYVN1 "E3 ubiquitin-protein ligase synoviolin" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query261
COG5243 491 COG5243, HRD1, HRD ubiquitin ligase complex, ER me 2e-20
pfam1363946 pfam13639, zf-RING_2, Ring finger domain 5e-13
cd0016245 cd00162, RING, RING-finger (Really Interesting New 1e-09
pfam1267873 pfam12678, zf-rbx1, RING-H2 zinc finger 2e-09
smart0018440 smart00184, RING, Ring finger 2e-09
pfam1392345 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI 1e-07
pfam0009740 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING 2e-07
COG5540374 COG5540, COG5540, RING-finger-containing ubiquitin 3e-04
pfam1344555 pfam13445, zf-RING_LisH, RING-type zinc-finger, Li 3e-04
pfam1290647 pfam12906, RINGv, RING-variant domain 0.003
COG519488 COG5194, APC11, Component of SCF ubiquitin ligase 0.003
>gnl|CDD|227568 COG5243, HRD1, HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
 Score = 89.6 bits (222), Expect = 2e-20
 Identities = 36/118 (30%), Positives = 58/118 (49%), Gaps = 12/118 (10%)

Query: 154 VKVIMYIVFVLIMMRVYTLPLFAFRPMYYAARSFRKALKDVINSRRAIHHLNNSFPDATS 213
           + ++ Y +  +       +P++  R MY    +  + +++    RRA   LN  +P AT 
Sbjct: 221 LTLLAYSLLFMYQFPYVRVPIYLIRQMYTCFYALFRRIREHARFRRATKDLNAMYPTATE 280

Query: 214 DELTEADNVCIICREEM------------QSASKKLPCNHIFHTSCLRSWFQRHQTCP 259
           ++LT +D  C IC +EM                K+LPC HI H  CL++W +R QTCP
Sbjct: 281 EQLTNSDRTCTICMDEMFHPDHEPLPRGLDMTPKRLPCGHILHLHCLKNWLERQQTCP 338

Length = 491
>gnl|CDD|222279 pfam13639, zf-RING_2, Ring finger domain Back     alignment and domain information
>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>gnl|CDD|221705 pfam12678, zf-rbx1, RING-H2 zinc finger Back     alignment and domain information
>gnl|CDD|214546 smart00184, RING, Ring finger Back     alignment and domain information
>gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|227827 COG5540, COG5540, RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|222135 pfam13445, zf-RING_LisH, RING-type zinc-finger, LisH dimerisation motif Back     alignment and domain information
>gnl|CDD|221845 pfam12906, RINGv, RING-variant domain Back     alignment and domain information
>gnl|CDD|227521 COG5194, APC11, Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 261
COG5243 491 HRD1 HRD ubiquitin ligase complex, ER membrane com 99.95
KOG0802|consensus 543 99.88
KOG4628|consensus348 99.6
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 99.46
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 99.26
PHA02929238 N1R/p28-like protein; Provisional 99.14
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 99.0
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 98.95
cd0016245 RING RING-finger (Really Interesting New Gene) dom 98.83
KOG1734|consensus328 98.82
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.8
KOG0317|consensus293 98.78
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.77
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 98.71
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 98.66
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 98.56
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 98.54
smart0050463 Ubox Modified RING finger domain. Modified RING fi 98.54
KOG0823|consensus 230 98.4
PF1463444 zf-RING_5: zinc-RING finger domain 98.31
PHA02926242 zinc finger-like protein; Provisional 98.28
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 98.28
KOG0320|consensus187 98.25
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 98.18
KOG2930|consensus114 98.08
KOG0828|consensus636 98.06
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 98.04
KOG1493|consensus84 98.04
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 97.95
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 97.9
COG52191525 Uncharacterized conserved protein, contains RING Z 97.65
KOG0287|consensus 442 97.53
KOG2164|consensus 513 97.4
PF13705508 TRC8_N: TRC8 N-terminal domain 97.37
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 97.33
KOG0804|consensus 493 97.24
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 97.08
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 97.03
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 96.93
KOG0825|consensus 1134 96.8
KOG1039|consensus 344 96.7
KOG1814|consensus 445 96.65
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 96.6
KOG2879|consensus298 96.52
KOG1941|consensus 518 96.52
KOG4265|consensus349 96.36
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 96.32
KOG0297|consensus 391 96.29
KOG2114|consensus933 95.96
KOG0801|consensus205 95.86
KOG0978|consensus698 95.83
KOG4159|consensus 398 95.68
KOG0311|consensus 381 95.63
KOG2034|consensus911 95.24
PF1290647 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. 94.98
KOG0826|consensus357 94.92
COG5152259 Uncharacterized conserved protein, contains RING a 94.8
KOG1785|consensus 563 94.77
KOG1428|consensus 3738 94.45
KOG0309|consensus1081 94.32
KOG1952|consensus 950 94.21
KOG0802|consensus543 94.2
KOG1813|consensus313 93.98
KOG4692|consensus489 93.74
COG5222 427 Uncharacterized conserved protein, contains RING Z 93.18
PHA03096284 p28-like protein; Provisional 92.54
KOG4445|consensus 368 92.17
KOG1002|consensus 791 92.07
PF0874643 zf-RING-like: RING-like domain; InterPro: IPR01485 91.41
KOG4172|consensus62 91.36
KOG3970|consensus 299 90.74
KOG1571|consensus355 90.6
KOG3039|consensus303 89.85
KOG0827|consensus 465 89.47
KOG2932|consensus 389 89.42
KOG1940|consensus276 89.17
KOG0298|consensus 1394 89.08
KOG0269|consensus839 86.89
PF1057126 UPF0547: Uncharacterised protein family UPF0547; I 86.5
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 83.43
KOG1812|consensus 384 82.46
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information 
Probab=99.95  E-value=1.2e-27  Score=214.73  Aligned_cols=194  Identities=26%  Similarity=0.538  Sum_probs=158.0

Q ss_pred             cchHHHH--HHHHHHHHHHHHHHHHHHHHHHHhhccCchHHHHHHHHHHHHHHHHHHHHHhhheeecccccccccchhHH
Q psy8809           7 ISYIFHI--RIIVLLTVLGLLDLYFVVGAYQTTVTKGASVMIVFGFEYAILLTVCVNILIKYALHTIDLNREIFWESKAV   84 (261)
Q Consensus         7 ~~~~~h~--Rl~~~l~~l~~~d~~~~~~~~~~~~~~~~~~~~~f~fE~~il~~~~~~~~~ky~~~~~d~~~~~~we~k~~   84 (261)
                      +...+|.  |+...+.++.++|.-++..|+.+.+-.+.+..-+|..||-.++....+..-|-.+-.+|.+.+.  ++|..
T Consensus       132 t~~~~~ifSrfS~~~~lL~ild~~li~~CiSs~~liD~~~lfL~~c~F~~~ll~l~s~~n~~cV~n~~~~ddD--d~rs~  209 (491)
T COG5243         132 TDQRFHIFSRFSCAYFLLSILDASLIYLCISSEHLIDKSTLFLFVCEFSVLLLNLTSEANKLCVYNYEARDDD--DERST  209 (491)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHhHHHHHHHhhhHhhhhhhHHHHHHHHHHHHHHHHHHhhcccceeeccccccc--cccee
Confidence            3455665  9999999999999999999999876544455555566776666666666667777777777665  67888


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHhcCCcccchhhHHHhhhhhhhhhchhHHHhhhhchhhHHHHHHHHHHHHHHHH
Q psy8809          85 FFLYMELVMSFVKVIMYIVFVLIMMRVYTLPLFAFRPMYYAARSFRKALKDVNKLLIMNAYSSPLFIGFVKVIMYIVFVL  164 (261)
Q Consensus        85 ~~~y~el~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~a~~s~~~~~~~~~~~~~~n~~~~~l~~~~~~~~l~~~f~~  164 (261)
                      |.||.|+.-+=+.+                                                          +.|.+++.
T Consensus       210 ~~f~~~v~y~g~tl----------------------------------------------------------lays~l~~  231 (491)
T COG5243         210 YLFRLEVCYDGLTL----------------------------------------------------------LAYSLLFM  231 (491)
T ss_pred             eeeeeehHHHHHHH----------------------------------------------------------HHHHHHHH
Confidence            99999977666555                                                          34555555


Q ss_pred             HHHHHhhhhhhhhHHHHHHHHHHHHHHHHHHhhHHHHHhhhhcCCCCCccccccCCccccccccccccC-----------
Q psy8809         165 IMMRVYTLPLFAFRPMYYAARSFRKALKDVINSRRAIHHLNNSFPDATSDELTEADNVCIICREEMQSA-----------  233 (261)
Q Consensus       165 i~~~~~~~p~~~~~~~~~~~~~~~~~~~~~~~~r~~~~~l~~~~~~~~~e~l~~~~~~C~IClee~~~~-----------  233 (261)
                      ..+..+-+|++.+|++|.-+-+..++++.+.+++|+.|+++..+|.+++|++.++|+.|+||+|||-.+           
T Consensus       232 ~~~~~~r~Pi~l~r~~~t~~~AL~~~i~~~~~~~r~~kdl~~~~~t~t~eql~n~D~~C~ICmde~~h~~~~~~~~~~~~  311 (491)
T COG5243         232 YQFPYVRVPIYLIRQMYTCFYALFRRIREHARFRRATKDLNAMYPTATEEQLTNSDRTCTICMDEMFHPDHEPLPRGLDM  311 (491)
T ss_pred             hhccchhchHHHHHHHHHHHHHHHHHHHHHHHHHHHhhHHHhhcchhhhhhhcCCCCeEEEecccccCCCCccCcccccC
Confidence            555667788999999999999999999999999999999999999999999999999999999995432           


Q ss_pred             -CEEeccCCcccHhhHHHHhhcCCCCCC
Q psy8809         234 -SKKLPCNHIFHTSCLRSWFQRHQTCPT  260 (261)
Q Consensus       234 -~r~LpC~H~FH~~CL~~WL~~~~tCP~  260 (261)
                       +|+|||||++|.+|++.|+||||+||+
T Consensus       312 ~pKrLpCGHilHl~CLknW~ERqQTCPI  339 (491)
T COG5243         312 TPKRLPCGHILHLHCLKNWLERQQTCPI  339 (491)
T ss_pred             CcccccccceeeHHHHHHHHHhccCCCc
Confidence             289999999999999999999999996

>KOG0802|consensus Back     alignment and domain information
>KOG4628|consensus Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>KOG1734|consensus Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG0317|consensus Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>KOG0823|consensus Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG0320|consensus Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>KOG2930|consensus Back     alignment and domain information
>KOG0828|consensus Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>KOG1493|consensus Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG0287|consensus Back     alignment and domain information
>KOG2164|consensus Back     alignment and domain information
>PF13705 TRC8_N: TRC8 N-terminal domain Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>KOG0804|consensus Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>KOG0825|consensus Back     alignment and domain information
>KOG1039|consensus Back     alignment and domain information
>KOG1814|consensus Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>KOG2879|consensus Back     alignment and domain information
>KOG1941|consensus Back     alignment and domain information
>KOG4265|consensus Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>KOG0297|consensus Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>KOG0801|consensus Back     alignment and domain information
>KOG0978|consensus Back     alignment and domain information
>KOG4159|consensus Back     alignment and domain information
>KOG0311|consensus Back     alignment and domain information
>KOG2034|consensus Back     alignment and domain information
>PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A Back     alignment and domain information
>KOG0826|consensus Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG1785|consensus Back     alignment and domain information
>KOG1428|consensus Back     alignment and domain information
>KOG0309|consensus Back     alignment and domain information
>KOG1952|consensus Back     alignment and domain information
>KOG0802|consensus Back     alignment and domain information
>KOG1813|consensus Back     alignment and domain information
>KOG4692|consensus Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>KOG4445|consensus Back     alignment and domain information
>KOG1002|consensus Back     alignment and domain information
>PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) Back     alignment and domain information
>KOG4172|consensus Back     alignment and domain information
>KOG3970|consensus Back     alignment and domain information
>KOG1571|consensus Back     alignment and domain information
>KOG3039|consensus Back     alignment and domain information
>KOG0827|consensus Back     alignment and domain information
>KOG2932|consensus Back     alignment and domain information
>KOG1940|consensus Back     alignment and domain information
>KOG0298|consensus Back     alignment and domain information
>KOG0269|consensus Back     alignment and domain information
>PF10571 UPF0547: Uncharacterised protein family UPF0547; InterPro: IPR018886 This domain may well be a type of zinc-finger as it carries two pairs of highly conserved cysteine residues though with no accompanying histidines Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>KOG1812|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query261
2ect_A78 Solution Structure Of The Zinc Finger, C3hc4 Type ( 4e-07
1x4j_A75 Solution Structure Of Ring Finger In Ring Finger Pr 5e-05
>pdb|2ECT|A Chain A, Solution Structure Of The Zinc Finger, C3hc4 Type (Ring Finger) Domain Of Ring Finger Protein 126 Length = 78 Back     alignment and structure 
Iteration: 1

 Score = 52.0 bits (123), Expect = 4e-07,   Method: Composition-based stats.
 Identities = 16/39 (41%), Positives = 28/39 (71%), Gaps = 2/39 (5%)
Query: 223 CIICREE--MQSASKKLPCNHIFHTSCLRSWFQRHQTCP 259
           C +C+E+  +  + ++LPCNH+FH SC+  W ++H +CP
Sbjct: 18  CPVCKEDYALGESVRQLPCNHLFHDSCIVPWLEQHDSCP 56
>pdb|1X4J|A Chain A, Solution Structure Of Ring Finger In Ring Finger Protein 38 Length = 75 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query261
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 2e-15
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 1e-14
2ect_A78 Ring finger protein 126; metal binding protein, st 2e-14
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 4e-14
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 3e-13
2ecm_A55 Ring finger and CHY zinc finger domain- containing 3e-13
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 1e-12
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 3e-12
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 3e-12
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 8e-12
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 2e-11
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 3e-11
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 3e-11
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 9e-11
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 3e-10
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 7e-10
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 1e-09
4epo_C149 E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 3e-09
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 3e-09
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 5e-09
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 1e-08
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 3e-08
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 9e-08
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 8e-06
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 2e-07
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 3e-07
3nw0_A238 Non-structural maintenance of chromosomes element 3e-07
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 2e-05
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 3e-05
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 4e-05
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 2e-04
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 4e-04
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 6e-04
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Length = 68 Back     alignment and structure
 Score = 68.2 bits (167), Expect = 2e-15
 Identities = 15/44 (34%), Positives = 22/44 (50%)

Query: 216 LTEADNVCIICREEMQSASKKLPCNHIFHTSCLRSWFQRHQTCP 259
           +      C IC E+  + S  LPC H F   C+  W +++ TCP
Sbjct: 1   MATVAERCPICLEDPSNYSMALPCLHAFCYVCITRWIRQNPTCP 44
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 78 Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Length = 55 Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Length = 114 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Length = 69 Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Length = 71 Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Length = 64 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 72 Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>4epo_C E3 ubiquitin-protein ligase RNF8; coiled-coil, E3 ubiquitin ligase, protein binding complex; 4.80A {Homo sapiens} Length = 149 Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 71 Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Length = 117 Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Length = 106 Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Length = 133 Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Length = 55 Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Length = 108 Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Length = 238 Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Length = 381 Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 80 Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Length = 99 Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Length = 74 Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Length = 124 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, chromosomal protein, DNA repair, metal-binding; 2.12A {Homo sapiens} Length = 115 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query261
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 99.4
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 99.37
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 99.37
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 99.36
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 99.36
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 99.33
2ect_A78 Ring finger protein 126; metal binding protein, st 99.33
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 99.31
2ecm_A55 Ring finger and CHY zinc finger domain- containing 99.3
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 99.29
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 99.26
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 99.24
2ysj_A63 Tripartite motif-containing protein 31; ring-type 99.23
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 99.22
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 99.21
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 99.2
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 99.2
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 99.16
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 99.16
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 99.14
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 99.14
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 99.13
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 99.13
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 99.1
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 99.09
2ysl_A73 Tripartite motif-containing protein 31; ring-type 99.08
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 99.06
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 99.03
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 99.02
2ecw_A85 Tripartite motif-containing protein 30; metal bind 99.0
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 98.99
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 98.98
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 98.98
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.98
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 98.96
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 98.95
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 98.94
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 98.92
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 98.86
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 98.85
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 98.84
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 98.82
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 98.81
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 98.8
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 98.79
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 98.78
1z6u_A150 NP95-like ring finger protein isoform B; structura 98.74
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 98.68
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 98.65
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 98.61
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 98.6
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 98.6
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 98.59
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 98.59
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 98.58
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 98.51
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 98.47
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 98.46
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 98.41
3hcs_A 170 TNF receptor-associated factor 6; cross-brace, bet 98.37
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 98.34
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 98.32
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 98.3
2f42_A179 STIP1 homology and U-box containing protein 1; cha 98.26
2ea5_A68 Cell growth regulator with ring finger domain prot 98.21
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 98.19
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 98.1
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 98.05
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 97.96
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 97.75
3nw0_A238 Non-structural maintenance of chromosomes element 97.45
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 97.31
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 94.33
1wil_A89 KIAA1045 protein; ring finger domain, structural g 92.24
3m62_A968 Ubiquitin conjugation factor E4; armadillo-like re 91.12
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 82.71
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
Probab=99.40  E-value=1.3e-13  Score=102.47  Aligned_cols=43  Identities=37%  Similarity=0.950  Sum_probs=38.4

Q ss_pred             cCCccccccccccccCC--EEeccCCcccHhhHHHHhhcCCCCCC
Q psy8809         218 EADNVCIICREEMQSAS--KKLPCNHIFHTSCLRSWFQRHQTCPT  260 (261)
Q Consensus       218 ~~~~~C~IClee~~~~~--r~LpC~H~FH~~CL~~WL~~~~tCP~  260 (261)
                      +.+.+|+||++++.++.  +.+||||.||..||++|++++.+||+
T Consensus        38 ~~~~~C~IC~~~~~~~~~~~~l~C~H~Fh~~Ci~~wl~~~~~CP~   82 (91)
T 2l0b_A           38 GQEMCCPICCSEYVKGDVATELPCHHYFHKPCVSIWLQKSGTCPV   82 (91)
T ss_dssp             SSCSEETTTTEECCTTCEEEEETTTEEEEHHHHHHHHTTTCBCTT
T ss_pred             CCCCCCcccChhhcCCCcEEecCCCChHHHHHHHHHHHcCCcCcC
Confidence            34678999999998754  67999999999999999999999996
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure
>3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 261
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 5e-13
d1iyma_55 g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sati 2e-11
d3dplr188 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of S 2e-10
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 2e-10
d1bora_56 g.44.1.1 (A:) Acute promyelocytic leukaemia proto- 6e-09
d1v87a_114 g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mou 9e-08
d1ur6b_52 g.44.1.1 (B:) Not-4 N-terminal RING finger domain 2e-07
d1vyxa_60 g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal do 8e-07
d1g25a_65 g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapi 2e-06
d1jm7b_97 g.44.1.1 (B:) bard1 RING domain {Human (Homo sapie 6e-06
d1jm7a_103 g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie 6e-05
d1rmda286 g.44.1.1 (A:1-86) V(D)J recombination activating p 2e-04
d2baya156 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 { 3e-04
d1weva_88 g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus mu 0.002
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure

class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: Immediate early protein, IEEHV
species: Equine herpesvirus 1 [TaxId: 10326]

 Score = 60.3 bits (146), Expect = 5e-13
 Identities = 17/44 (38%), Positives = 24/44 (54%), Gaps = 1/44 (2%)

Query: 217 TEADNVCIICREEMQSASKKLPCNHIFHTSCLRSWFQRHQTCPT 260
           T A+  C IC E+  + S  LPC H F   C+  W +++ TCP 
Sbjct: 3   TVAER-CPICLEDPSNYSMALPCLHAFCYVCITRWIRQNPTCPL 45
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Length = 55 Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 114 Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Length = 52 Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Length = 60 Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 65 Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 97 Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 56 Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Length = 88 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query261
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 99.51
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 99.44
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 99.34
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.23
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 99.22
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 99.2
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 99.14
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 99.01
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 98.92
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 98.91
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 98.9
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 98.85
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 98.71
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 98.69
d2c2la280 STIP1 homology and U box-containing protein 1, STU 98.64
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 98.33
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 98.3
d1wila_89 Hypothetical protein KIAA1045 {Human (Homo sapiens 95.7
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 81.74
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
class: Small proteins
fold: RING/U-box
superfamily: RING/U-box
family: RING finger domain, C3HC4
domain: EL5 RING-H2 domain
species: Rice (Oryza sativa) [TaxId: 4530]

Probab=99.51  E-value=2.9e-15  Score=99.76  Aligned_cols=42  Identities=36%  Similarity=0.947  Sum_probs=37.0

Q ss_pred             CCccccccccccccCC--EEec-cCCcccHhhHHHHhhcCCCCCC
Q psy8809         219 ADNVCIICREEMQSAS--KKLP-CNHIFHTSCLRSWFQRHQTCPT  260 (261)
Q Consensus       219 ~~~~C~IClee~~~~~--r~Lp-C~H~FH~~CL~~WL~~~~tCP~  260 (261)
                      .+.+|+||++++++++  +++| |||.||.+||++|++++++||+
T Consensus         4 d~~~C~ICl~~~~~~~~~~~l~~C~H~Fh~~Ci~~Wl~~~~~CP~   48 (55)
T d1iyma_           4 DGVECAVCLAELEDGEEARFLPRCGHGFHAECVDMWLGSHSTCPL   48 (55)
T ss_dssp             CSCCCTTTCCCCCTTSCCEECSSSCCEECTTHHHHTTTTCCSCSS
T ss_pred             CCCCCeEECccccCCCEEEEeCCCCCcccHHHHHHHHHhCCcCCC
Confidence            3568999999998764  5675 9999999999999999999996
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure