Psyllid ID: psy8877

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180
MHWTVHLTGGPRRVNHAAVLNDNKIFTFGGYCSGEDYVKRRPMDGEPPSYRDFHTANIIDGRMYIWGGRGDESSLYHSGSEVYCPDLVYLDLKYFTWIRPNTTGSVPVGRRSHSAFVYGDGLYIFGGYNGLVEEHYNDIYRYCTRRQEWARVIPHGAPPTKRRRQSCIIKGDTLIMFGGS
cEEEEEccccccccccEEEEEccEEEEEccccccccEEEEccccccccccccccEEEEEccEEEEEccccccccccccccccccccEEEEEccccEEEEEcccccccccccccEEEEEccEEEEEcccccccccEEcEEEEEEccccEEEEEcccccccccccccEEEEEccEEEEEccc
cccEEEccccccccccEEEEEccEEEEEEcccccccEEEcccccccccccccccEEEEEccEEEEEEcccccccccccccccEcccEEEEEccccEEEEccccccccccccccEEEEEccEEEEEEccccccccccccEEEEcccccEEEEEcccccccccccccEEEEEccEEEEEccc
mhwtvhltggprrvnhaavlndnkiftfggycsgedyvkrrpmdgeppsyrdfhtaniidgrmyiwggrgdesslyhsgsevycpdlvyldlkyftwirpnttgsvpvgrrshsafvygdgLYIFGGYNGLVEEHYNDIYRYCTRRQewarviphgapptkrrrqsciikgdtlimfggs
mhwtvhltggprrvnhaavlndnkiftfggyCSGEDYVKRRpmdgeppsyrdfhtaNIIDGRMYIWGGRGDESSLYHSGSEVYCPDLVYLDLKYFTWIRPnttgsvpvgrrSHSAFVYGDGLYIFGGYNGLVEEHYNDIYRYCTRRQEWarviphgapptkrrrqsciikgdtlimfggs
MHWTVHLTGGPRRVNHAAVLNDNKIFTFGGYCSGEDYVKRRPMDGEPPSYRDFHTANIIDGRMYIWGGRGDESSLYHSGSEVYCPDLVYLDLKYFTWIRPNTTGSVPVGRRSHSAFVYGDGLYIFGGYNGLVEEHYNDIYRYCTRRQEWARVIPHGAPPTKRRRQSCIIKGDTLIMFGGS
**WTVHLTGGPRRVNHAAVLNDNKIFTFGGYCSGEDYVK**********YRDFHTANIIDGRMYIWGGRGDESSLYHSGSEVYCPDLVYLDLKYFTWIRPNTTGSVPVGRRSHSAFVYGDGLYIFGGYNGLVEEHYNDIYRYCTRRQEWARVIPHGA*******QSCIIKGDTLIMF***
MHWTV**TGGPRRVNHAAVLNDNKIFTFGGYCSGEDYVKRRPMDGEPPSYRDFHTANIIDGRMYIWGGRGDESSLYHSGSEVYCPDLVYLDLKYFTWIRPNTTGSVPVGRRSHSAFVYGDGLYIFGGYNGLVEEHYNDIYRYCTRRQEWARVIPHGAPPTKRRRQSCIIKGDTLIMFGGS
MHWTVHLTGGPRRVNHAAVLNDNKIFTFGGYCSGEDYVKRRPMDGEPPSYRDFHTANIIDGRMYIWGGRGDESSLYHSGSEVYCPDLVYLDLKYFTWIRPNTTGSVPVGRRSHSAFVYGDGLYIFGGYNGLVEEHYNDIYRYCTRRQEWARVIPHG********QSCIIKGDTLIMFGGS
MHWTVHLTGGPRRVNHAAVLNDNKIFTFGGYCSGEDYVKRRPMDGEPPSYRDFHTANIIDGRMYIWGGRGDESSLYHSGSEVYCPDLVYLDLKYFTWIRPNTTGSVPVGRRSHSAFVYGDGLYIFGGYNGLVEEHYNDIYRYCTRRQEWARVIPHGAPPTKRRRQSCIIKGDTLIMFGGS
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MHWTVHLTGGPRRVNHAAVLNDNKIFTFGGYCSGEDYVKRRPMDGEPPSYRDFHTANIIDGRMYIWGGRGDESSLYHSGSEVYCPDLVYLDLKYFTWIRPNTTGSVPVGRRSHSAFVYGDGLYIFGGYNGLVEEHYNDIYRYCTRRQEWARVIPHGAPPTKRRRQSCIIKGDTLIMFGGS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query180 2.2.26 [Sep-21-2011]
Q58CV6382 Kelch domain-containing p yes N/A 0.933 0.439 0.362 3e-29
Q9BQ90382 Kelch domain-containing p yes N/A 0.933 0.439 0.362 5e-29
Q8VEM9382 Kelch domain-containing p yes N/A 0.933 0.439 0.362 8e-29
Q6AYI2382 Kelch domain-containing p yes N/A 0.933 0.439 0.362 8e-29
P80197 737 Actin-fragmin kinase OS=P N/A N/A 0.877 0.214 0.318 4e-15
P87061 1147 Tip elongation aberrant p yes N/A 0.888 0.139 0.271 4e-12
Q86L99 1523 Rho GTPase-activating pro no N/A 0.716 0.084 0.281 5e-12
Q9CQ33 837 Leucine-zipper-like trans no N/A 0.911 0.195 0.274 1e-11
Q8N653 840 Leucine-zipper-like trans no N/A 0.805 0.172 0.276 2e-11
Q5R4Q7 840 Leucine-zipper-like trans no N/A 0.805 0.172 0.276 2e-11
>sp|Q58CV6|KLDC3_BOVIN Kelch domain-containing protein 3 OS=Bos taurus GN=KLHDC3 PE=2 SV=2 Back     alignment and function desciption
 Score =  127 bits (320), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 66/182 (36%), Positives = 96/182 (52%), Gaps = 14/182 (7%)

Query: 13  RVNHAAVLNDNKIFTFGGY-----CSGEDYVKRRP---------MDGEPPSYRDFHTANI 58
           R  H+A +    ++ FGGY     C   D  K              G P  +RDFH+A +
Sbjct: 128 RDGHSACVLGKTMYIFGGYEQLADCFSNDIHKLDTSTMTWTLICTKGNPARWRDFHSATM 187

Query: 59  IDGRMYIWGGRGDESSLYHSGSEVYCPDLVYLDLKYFTWIRPNTTGSVPVGRRSHSAFVY 118
           +   MY++GGR D    +HS +E+YC  +   D +   W+    T  +P GRRSHSAF Y
Sbjct: 188 LGSHMYVFGGRADRFGPFHSNNEIYCNRIRVFDTRTEAWLDCPPTPVLPEGRRSHSAFGY 247

Query: 119 GDGLYIFGGYNGLVEEHYNDIYRYCTRRQEWARVIPHGAPPTKRRRQSCIIKGDTLIMFG 178
              LYIFGGYN  +  H++D++++      W ++ P G  P  RRRQ C I GD +++FG
Sbjct: 248 NGELYIFGGYNARLNRHFHDLWKFNPVSFTWKKIEPKGKGPCPRRRQCCCIVGDKIVLFG 307

Query: 179 GS 180
           G+
Sbjct: 308 GT 309
May be involved in meiotic recombination process.
Bos taurus (taxid: 9913)
>sp|Q9BQ90|KLDC3_HUMAN Kelch domain-containing protein 3 OS=Homo sapiens GN=KLHDC3 PE=2 SV=1 Back     alignment and function description
>sp|Q8VEM9|KLDC3_MOUSE Kelch domain-containing protein 3 OS=Mus musculus GN=Klhdc3 PE=2 SV=1 Back     alignment and function description
>sp|Q6AYI2|KLDC3_RAT Kelch domain-containing protein 3 OS=Rattus norvegicus GN=Klhdc3 PE=2 SV=1 Back     alignment and function description
>sp|P80197|AFK_PHYPO Actin-fragmin kinase OS=Physarum polycephalum PE=1 SV=2 Back     alignment and function description
>sp|P87061|TEA1_SCHPO Tip elongation aberrant protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tea1 PE=1 SV=1 Back     alignment and function description
>sp|Q86L99|GACHH_DICDI Rho GTPase-activating protein gacHH OS=Dictyostelium discoideum GN=gacHH PE=3 SV=1 Back     alignment and function description
>sp|Q9CQ33|LZTR1_MOUSE Leucine-zipper-like transcriptional regulator 1 OS=Mus musculus GN=Lztr1 PE=2 SV=2 Back     alignment and function description
>sp|Q8N653|LZTR1_HUMAN Leucine-zipper-like transcriptional regulator 1 OS=Homo sapiens GN=LZTR1 PE=2 SV=2 Back     alignment and function description
>sp|Q5R4Q7|LZTR1_PONAB Leucine-zipper-like transcriptional regulator 1 OS=Pongo abelii GN=LZTR1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query180
289739545 381 uncharacterized conserved protein [Gloss 0.933 0.440 0.483 8e-42
158288323 381 AGAP009495-PA [Anopheles gambiae str. PE 0.933 0.440 0.456 3e-41
321472431 392 hypothetical protein DAPPUDRAFT_301972 [ 0.933 0.428 0.445 8e-38
194767241 413 GF22299 [Drosophila ananassae] gi|190619 0.933 0.406 0.469 1e-37
195049318 399 GH24899 [Drosophila grimshawi] gi|193893 0.994 0.448 0.446 2e-37
157113584 376 kelch repeat protein [Aedes aegypti] gi| 0.983 0.470 0.415 2e-37
427777935 408 Hypothetical protein [Rhipicephalus pulc 0.933 0.411 0.439 2e-37
427789807 381 Hypothetical protein [Rhipicephalus pulc 0.933 0.440 0.439 2e-37
427778411 408 Hypothetical protein [Rhipicephalus pulc 0.933 0.411 0.439 2e-37
312381684 940 hypothetical protein AND_05953 [Anophele 0.933 0.178 0.375 3e-36
>gi|289739545|gb|ADD18520.1| uncharacterized conserved protein [Glossina morsitans morsitans] Back     alignment and taxonomy information
 Score =  175 bits (443), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 88/182 (48%), Positives = 117/182 (64%), Gaps = 14/182 (7%)

Query: 13  RVNHAAVLNDNKIFTFGGYCSGED-------YVKRRPMD-------GEPPSYRDFHTANI 58
           R  H+A +  N ++ FGG+    +        +    M+       G PPS+RDFH A  
Sbjct: 128 RDGHSACVIGNYMYIFGGFVEEINEFSCDVHALNFETMEWRYVQTFGVPPSFRDFHAAEH 187

Query: 59  IDGRMYIWGGRGDESSLYHSGSEVYCPDLVYLDLKYFTWIRPNTTGSVPVGRRSHSAFVY 118
           I GRMYI+GGRGD+ S YHS  E+YCP++V+LDLK   W RP+ TG VPVGRRSHS F+Y
Sbjct: 188 IHGRMYIFGGRGDKHSPYHSQEEMYCPEIVFLDLKTKVWHRPSITGKVPVGRRSHSMFIY 247

Query: 119 GDGLYIFGGYNGLVEEHYNDIYRYCTRRQEWARVIPHGAPPTKRRRQSCIIKGDTLIMFG 178
            D +Y+FGGYNGL+++H+ND+Y +  +   W  V PHG PPT RRRQ  I+K   L +FG
Sbjct: 248 NDLIYVFGGYNGLLDKHFNDLYTFDPKTNCWNLVKPHGKPPTPRRRQVGIVKDARLFLFG 307

Query: 179 GS 180
           G+
Sbjct: 308 GT 309

Source: Glossina morsitans morsitans

Species: Glossina morsitans

Genus: Glossina

Family: Glossinidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|158288323|ref|XP_310200.4| AGAP009495-PA [Anopheles gambiae str. PEST] gi|157019195|gb|EAA05915.4| AGAP009495-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|321472431|gb|EFX83401.1| hypothetical protein DAPPUDRAFT_301972 [Daphnia pulex] Back     alignment and taxonomy information
>gi|194767241|ref|XP_001965727.1| GF22299 [Drosophila ananassae] gi|190619718|gb|EDV35242.1| GF22299 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|195049318|ref|XP_001992696.1| GH24899 [Drosophila grimshawi] gi|193893537|gb|EDV92403.1| GH24899 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|157113584|ref|XP_001652008.1| kelch repeat protein [Aedes aegypti] gi|108877654|gb|EAT41879.1| AAEL006525-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|427777935|gb|JAA54419.1| Hypothetical protein [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|427789807|gb|JAA60355.1| Hypothetical protein [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|427778411|gb|JAA54657.1| Hypothetical protein [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|312381684|gb|EFR27374.1| hypothetical protein AND_05953 [Anopheles darlingi] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query180
UNIPROTKB|Q7T0L8378 klhdc3 "Klhdc3-prov protein" [ 0.983 0.468 0.378 1.1e-32
ZFIN|ZDB-GENE-040426-2426310 zgc:85727 "zgc:85727" [Danio r 0.933 0.541 0.373 9.8e-32
UNIPROTKB|Q58CV6382 KLHDC3 "Kelch domain-containin 0.933 0.439 0.368 2.1e-29
MGI|MGI:2651568382 Klhdc3 "kelch domain containin 0.933 0.439 0.368 3.4e-29
RGD|1307105382 Klhdc3 "kelch domain containin 0.933 0.439 0.368 3.4e-29
UNIPROTKB|A5GFR1 410 KLHDC3 "Uncharacterized protei 0.933 0.409 0.368 2.1e-29
UNIPROTKB|E1BSD7 551 LOC100858699 "Uncharacterized 0.933 0.304 0.373 1.1e-29
UNIPROTKB|Q58D25 550 KLHDC3 "Kelch domain-containin 0.933 0.305 0.368 6.8e-29
UNIPROTKB|E2RCI2 553 KLHDC3 "Uncharacterized protei 0.933 0.303 0.368 7e-29
UNIPROTKB|Q9BQ90382 KLHDC3 "Kelch domain-containin 0.933 0.439 0.368 3.4e-29
UNIPROTKB|Q7T0L8 klhdc3 "Klhdc3-prov protein" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
 Score = 357 (130.7 bits), Expect = 1.1e-32, P = 1.1e-32
 Identities = 73/193 (37%), Positives = 107/193 (55%)

Query:     4 TVHLTGG-P-RRVNHAAVLNDNKIFTFGGY-----CSGEDYVK--RRPMD-------GEP 47
             T  +TG  P  R  H+A + +  ++ FGGY     C   +  K   R M+       G  
Sbjct:   113 TPQVTGQIPGARDGHSACVYERTMYIFGGYEQLADCFSNEIHKLDTRSMNWALVRAKGNA 172

Query:    48 PSYRDFHTANIIDGRMYIWGGRGDESSLYHSGSEVYCPDLVYLDLKYFTWIRPNTTGSVP 107
               +RDFH+A +I  RMY++GGR D +  +HS +E+YC  +   DL+  TW+ P  + + P
Sbjct:   173 ARWRDFHSATVIGSRMYVFGGRADRAGPFHSNNEIYCNQIRVFDLQIETWLDPPESTNPP 232

Query:   108 VGRRSHSAFVYGDGLYIFGGYNGLVEEHYNDIYRYCTRRQEWARVIPHGAPPTKRRRQSC 167
              GRRSHSAF Y   LY+FGGYN  +  H+ D++++      W RV   G  P  RRRQ C
Sbjct:   233 EGRRSHSAFAYQGELYVFGGYNARLNRHFQDLWKFTPESGRWQRVEVQGKGPCARRRQCC 292

Query:   168 IIKGDTLIMFGGS 180
              + GD +++FGG+
Sbjct:   293 CVVGDKILLFGGT 305
GO:0000790 "nuclear chromatin" evidence=ISS
GO:0003682 "chromatin binding" evidence=ISS
GO:0005737 "cytoplasm" evidence=ISS
ZFIN|ZDB-GENE-040426-2426 zgc:85727 "zgc:85727" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q58CV6 KLHDC3 "Kelch domain-containing protein 3" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:2651568 Klhdc3 "kelch domain containing 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1307105 Klhdc3 "kelch domain containing 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|A5GFR1 KLHDC3 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E1BSD7 LOC100858699 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q58D25 KLHDC3 "Kelch domain-containing protein 3" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RCI2 KLHDC3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q9BQ90 KLHDC3 "Kelch domain-containing protein 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query180
pfam1385442 pfam13854, Kelch_5, Kelch motif 4e-07
PLN02193 470 PLN02193, PLN02193, nitrile-specifier protein 4e-05
pfam0134446 pfam01344, Kelch_1, Kelch motif 4e-04
COG3055 381 COG3055, COG3055, Uncharacterized protein conserve 6e-04
PRK14131 376 PRK14131, PRK14131, N-acetylneuraminic acid mutaro 8e-04
pfam1396450 pfam13964, Kelch_6, Kelch motif 0.002
TIGR03547 346 TIGR03547, muta_rot_YjhT, mutatrotase, YjhT family 0.003
>gnl|CDD|222419 pfam13854, Kelch_5, Kelch motif Back     alignment and domain information 
 Score = 44.5 bits (106), Expect = 4e-07
 Identities = 13/40 (32%), Positives = 21/40 (52%)

Query: 106 VPVGRRSHSAFVYGDGLYIFGGYNGLVEEHYNDIYRYCTR 145
           +PV R +H A V G  +Y++GGY     +  +D+Y     
Sbjct: 1   LPVPRANHCAVVVGGEIYLYGGYTSGNGQSSDDVYVLSLP 40

The kelch motif was initially discovered in Kelch. In this protein there are six copies of the motif. It has been shown that the Drosophila ring canal kelch protein is related to Galactose Oxidase for which a structure has been solved. The kelch motif forms a beta sheet. Several of these sheets associate to form a beta propeller structure as found in pfam00064, pfam00400 and pfam00415. Length = 42
>gnl|CDD|177844 PLN02193, PLN02193, nitrile-specifier protein Back     alignment and domain information
>gnl|CDD|201739 pfam01344, Kelch_1, Kelch motif Back     alignment and domain information
>gnl|CDD|225597 COG3055, COG3055, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>gnl|CDD|237617 PRK14131, PRK14131, N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>gnl|CDD|206134 pfam13964, Kelch_6, Kelch motif Back     alignment and domain information
>gnl|CDD|234253 TIGR03547, muta_rot_YjhT, mutatrotase, YjhT family Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 180
KOG4693|consensus 392 100.0
KOG4441|consensus571 100.0
KOG4693|consensus392 100.0
KOG4441|consensus571 100.0
PHA02713557 hypothetical protein; Provisional 100.0
PHA02713557 hypothetical protein; Provisional 100.0
PLN02153341 epithiospecifier protein 100.0
PLN02153 341 epithiospecifier protein 100.0
PLN02193470 nitrile-specifier protein 99.98
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 99.98
PLN02193 470 nitrile-specifier protein 99.98
PHA03098534 kelch-like protein; Provisional 99.97
KOG0379|consensus 482 99.97
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 99.97
PHA02790480 Kelch-like protein; Provisional 99.97
KOG0379|consensus 482 99.97
KOG1230|consensus 521 99.97
PHA03098534 kelch-like protein; Provisional 99.96
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 99.96
TIGR03547 346 muta_rot_YjhT mutatrotase, YjhT family. Members of 99.96
PRK14131 376 N-acetylneuraminic acid mutarotase; Provisional 99.95
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 99.95
KOG1230|consensus 521 99.95
KOG4152|consensus 830 99.95
PHA02790480 Kelch-like protein; Provisional 99.94
KOG4152|consensus 830 99.92
KOG2437|consensus 723 99.68
COG3055 381 Uncharacterized protein conserved in bacteria [Fun 99.63
PF1396450 Kelch_6: Kelch motif 99.48
KOG2437|consensus 723 99.42
PF1396450 Kelch_6: Kelch motif 99.4
COG3055 381 Uncharacterized protein conserved in bacteria [Fun 99.36
PF1341549 Kelch_3: Galactose oxidase, central domain 99.32
PLN02772 398 guanylate kinase 99.31
PF0764649 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is 99.29
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 99.28
PF1341549 Kelch_3: Galactose oxidase, central domain 99.27
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 99.27
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 99.23
PF03089 337 RAG2: Recombination activating protein 2; InterPro 99.21
PF0764649 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is 99.19
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 99.17
PLN02772 398 guanylate kinase 99.15
PF1385442 Kelch_5: Kelch motif 99.1
smart0061247 Kelch Kelch domain. 99.04
PF1385442 Kelch_5: Kelch motif 98.99
smart0061247 Kelch Kelch domain. 98.88
PF03089 337 RAG2: Recombination activating protein 2; InterPro 98.72
PF07250 243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 98.09
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 97.74
TIGR01640230 F_box_assoc_1 F-box protein interaction domain. Th 96.9
PF12768 281 Rax2: Cortical protein marker for cell polarity 96.21
PF07893342 DUF1668: Protein of unknown function (DUF1668); In 95.44
PF08268129 FBA_3: F-box associated domain; InterPro: IPR01318 93.09
TIGR01640230 F_box_assoc_1 F-box protein interaction domain. Th 92.17
PF08268129 FBA_3: F-box associated domain; InterPro: IPR01318 91.98
PF12217367 End_beta_propel: Catalytic beta propeller domain o 91.39
PF07893 342 DUF1668: Protein of unknown function (DUF1668); In 90.0
PF03178 321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 88.19
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 86.66
PRK11138 394 outer membrane biogenesis protein BamB; Provisiona 85.38
KOG0649|consensus 325 84.85
PF05096 264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 83.2
cd00094194 HX Hemopexin-like repeats.; Hemopexin is a heme-bi 82.88
PF12768 281 Rax2: Cortical protein marker for cell polarity 80.65
>KOG4693|consensus Back     alignment and domain information 
Probab=100.00  E-value=6.7e-34  Score=195.33  Aligned_cols=172  Identities=39%  Similarity=0.721  Sum_probs=155.1

Q ss_pred             CceEEeccCCCCCcCeeEEEeCCEEEEEccccCCCCCc-----eeeecC----------------------CCCCCccee
Q psy8877           1 MHWTVHLTGGPRRVNHAAVLNDNKIFTFGGYCSGEDYV-----KRRPMD----------------------GEPPSYRDF   53 (180)
Q Consensus         1 ~~W~~~~~~~~~r~~~~~~~~~~~iy~~GG~~~~~~~~-----~~~~~~----------------------~~~p~~r~~   53 (180)
                      ++|....+..|+|..|+++.++++||-|||+.+.+.+.     +++.++                      +-.|-.|+.
T Consensus         2 ~~WTVHLeGGPrRVNHAavaVG~riYSFGGYCsGedy~~~~piDVH~lNa~~~RWtk~pp~~~ka~i~~~yp~VPyqRYG   81 (392)
T KOG4693|consen    2 ATWTVHLEGGPRRVNHAAVAVGSRIYSFGGYCSGEDYDAKDPIDVHVLNAENYRWTKMPPGITKATIESPYPAVPYQRYG   81 (392)
T ss_pred             ceEEEEecCCcccccceeeeecceEEecCCcccccccccCCcceeEEeeccceeEEecCcccccccccCCCCccchhhcC
Confidence            57999999999999999999999999999987665543     344444                      445778999


Q ss_pred             eeEEEECCEEEEEcCCCCCCCcccCCCceecCcEEEEECCCCeEEeecCCCCCCCCceeeEEEEECCEEEEEcCccCCcc
Q psy8877          54 HTANIIDGRMYIWGGRGDESSLYHSGSEVYCPDLVYLDLKYFTWIRPNTTGSVPVGRRSHSAFVYGDGLYIFGGYNGLVE  133 (180)
Q Consensus        54 ~~~~~~~~~lyv~GG~~~~~~~~~~~~~~~~~~~~~~d~~~~~w~~~~~~~~~~~~r~~~~~~~~~~~i~v~GG~~~~~~  133 (180)
                      |..+.+++++|++||+++.        ....+.++.||+++++|.+++.+|..|.+|-+|+++++++.+|||||+.++.+
T Consensus        82 HtvV~y~d~~yvWGGRND~--------egaCN~Ly~fDp~t~~W~~p~v~G~vPgaRDGHsAcV~gn~MyiFGGye~~a~  153 (392)
T KOG4693|consen   82 HTVVEYQDKAYVWGGRNDD--------EGACNLLYEFDPETNVWKKPEVEGFVPGARDGHSACVWGNQMYIFGGYEEDAQ  153 (392)
T ss_pred             ceEEEEcceEEEEcCccCc--------ccccceeeeeccccccccccceeeecCCccCCceeeEECcEEEEecChHHHHH
Confidence            9999999999999999873        45679999999999999999988999999999999999999999999998888


Q ss_pred             ceeceeeEEEcCCCcEEEeecCCCCCCCCcceeEEEECCEEEEEcCC
Q psy8877         134 EHYNDIYRYCTRRQEWARVIPHGAPPTKRRRQSCIIKGDTLIMFGGS  180 (180)
Q Consensus       134 ~~~~~~~~~d~~~~~W~~~~~~~~~~~~r~~~~~~~~~~~i~~~GG~  180 (180)
                      +++.++.++|++|.+|+.+...+.+|.-|.+|+++++++.+|||||.
T Consensus       154 ~FS~d~h~ld~~TmtWr~~~Tkg~PprwRDFH~a~~~~~~MYiFGGR  200 (392)
T KOG4693|consen  154 RFSQDTHVLDFATMTWREMHTKGDPPRWRDFHTASVIDGMMYIFGGR  200 (392)
T ss_pred             hhhccceeEeccceeeeehhccCCCchhhhhhhhhhccceEEEeccc
Confidence            99999999999999999999999999999999999999999999983

>KOG4441|consensus Back     alignment and domain information
>KOG4693|consensus Back     alignment and domain information
>KOG4441|consensus Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>KOG0379|consensus Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>KOG0379|consensus Back     alignment and domain information
>KOG1230|consensus Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>KOG1230|consensus Back     alignment and domain information
>KOG4152|consensus Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>KOG4152|consensus Back     alignment and domain information
>KOG2437|consensus Back     alignment and domain information
>COG3055 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>KOG2437|consensus Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>COG3055 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PF13415 Kelch_3: Galactose oxidase, central domain Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF13415 Kelch_3: Galactose oxidase, central domain Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF03089 RAG2: Recombination activating protein 2; InterPro: IPR004321 The variable portion of the genes encoding immunoglobulins and T cell receptors are assembled from component V, D, and J DNA segments by a site-specific recombination reaction termed V(D)J recombination Back     alignment and domain information
>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>PF13854 Kelch_5: Kelch motif Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>PF13854 Kelch_5: Kelch motif Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>PF03089 RAG2: Recombination activating protein 2; InterPro: IPR004321 The variable portion of the genes encoding immunoglobulins and T cell receptors are assembled from component V, D, and J DNA segments by a site-specific recombination reaction termed V(D)J recombination Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function Back     alignment and domain information
>PF08268 FBA_3: F-box associated domain; InterPro: IPR013187 This domain occurs in a diverse superfamily of genes in plants Back     alignment and domain information
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information
>PF08268 FBA_3: F-box associated domain; InterPro: IPR013187 This domain occurs in a diverse superfamily of genes in plants Back     alignment and domain information
>PF12217 End_beta_propel: Catalytic beta propeller domain of bacteriophage endosialidase; InterPro: IPR024428 This entry represents the beta propeller domain of endosialidases, which consists of catalytically active part of the enzymes Back     alignment and domain information
>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>KOG0649|consensus Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>cd00094 HX Hemopexin-like repeats Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query180
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 4e-20
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 6e-19
2zwa_A 695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 4e-17
2uvk_A 357 YJHT; unknown function, hypothetical protein, sial 5e-17
2uvk_A 357 YJHT; unknown function, hypothetical protein, sial 4e-13
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 2e-12
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 1e-10
2uvk_A 357 YJHT; unknown function, hypothetical protein, sial 1e-06
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 5e-05
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 3e-14
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 6e-13
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 2e-12
2xn4_A 302 Kelch-like protein 2; structural protein, cytoskel 3e-10
2xn4_A 302 Kelch-like protein 2; structural protein, cytoskel 5e-07
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 5e-14
4asc_A 315 Kelch repeat and BTB domain-containing protein 5; 8e-13
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 2e-06
2woz_A 318 Kelch repeat and BTB domain-containing protein 10; 6e-14
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 1e-12
2woz_A 318 Kelch repeat and BTB domain-containing protein 10; 2e-09
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 1e-13
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 1e-13
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 8e-12
3ii7_A 306 Kelch-like protein 7; protein-binding, kelch-repea 1e-07
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 5e-13
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 2e-12
1zgk_A 308 Kelch-like ECH-associated protein 1; beta-propelle 2e-10
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 1e-11
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 1e-11
2vpj_A 301 Kelch-like protein 12; adaptor protein, WNT signal 4e-11
2vpj_A 301 Kelch-like protein 12; adaptor protein, WNT signal 8e-06
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
 Score = 86.0 bits (212), Expect = 4e-20
 Identities = 25/199 (12%), Positives = 49/199 (24%), Gaps = 23/199 (11%)

Query: 1   MHWTVHLTGGPRRVNHAAV-LNDNKIFTFGGYCSGEDYV---------KRRPMDGEPPSY 50
             W++  +    R  H+A  L D  +   GG   G   +         K      E    
Sbjct: 478 REWSMIKSLSHTRFRHSACSLPDGNVLILGGVTEGPAMLLYNVTEEIFKDVTPKDEFFQN 537

Query: 51  RDFHTA---NIIDGRMYIWGGRGDESSLYHSGSEVYCPDLVYLDLKYFTWIRPNTTGSVP 107
                    + +  +  I GG   + +     + ++  D    +                
Sbjct: 538 SLVSAGLEFDPVSKQGIILGGGFMDQTTVSDKAIIFKYDA---ENATEPITVIKKLQHPL 594

Query: 108 VGRRSHSA-FVYGDGLYIFGGYNG-LVEEHYNDIYRYCTRRQEWARVIPHGAPPTKRRRQ 165
             R      ++    L I GG +   + +  N I       +    +             
Sbjct: 595 FQRYGSQIKYITPRKLLIVGGTSPSGLFDRTNSIISLDPLSETLTSIPISRRIWEDHSLM 654

Query: 166 -----SCIIKGDTLIMFGG 179
                       T+ + GG
Sbjct: 655 LAGFSLVSTSMGTIHIIGG 673
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query180
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 100.0
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 100.0
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 100.0
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 100.0
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 100.0
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 100.0
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 100.0
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 100.0
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 100.0
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 100.0
4asc_A 315 Kelch repeat and BTB domain-containing protein 5; 100.0
2woz_A 318 Kelch repeat and BTB domain-containing protein 10; 99.98
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 99.97
2uvk_A 357 YJHT; unknown function, hypothetical protein, sial 99.97
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 99.97
2zwa_A 695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 99.96
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 99.91
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 99.89
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 97.16
3mbr_X 243 Glutamine cyclotransferase; beta-propeller; 1.44A 96.73
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 96.51
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 96.51
3nol_A 262 Glutamine cyclotransferase; beta-propeller, glutam 95.84
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 93.7
3nok_A 268 Glutaminyl cyclase; beta-propeller, cyclotransfera 93.67
3ju4_A 670 Endo-N-acetylneuraminidase; endonf, polysia, high- 93.64
3dsm_A 328 Uncharacterized protein bacuni_02894; seven_blated 92.71
2iwa_A 266 Glutamine cyclotransferase; pyroglutamate, acyltra 90.95
3q7m_A 376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 86.34
3g4e_A 297 Regucalcin; six bladed beta-propeller, gluconolcat 86.27
3dsm_A 328 Uncharacterized protein bacuni_02894; seven_blated 86.22
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=5.8e-34  Score=207.03  Aligned_cols=165  Identities=20%  Similarity=0.310  Sum_probs=146.9

Q ss_pred             CceEEeccCCCCCcCeeEEEeCCEEEEEccccCCCCCceeeecC---------CCCCCcceeeeEEEECCEEEEEcCCCC
Q psy8877           1 MHWTVHLTGGPRRVNHAAVLNDNKIFTFGGYCSGEDYVKRRPMD---------GEPPSYRDFHTANIIDGRMYIWGGRGD   71 (180)
Q Consensus         1 ~~W~~~~~~~~~r~~~~~~~~~~~iy~~GG~~~~~~~~~~~~~~---------~~~p~~r~~~~~~~~~~~lyv~GG~~~   71 (180)
                      .+|..++++|.+|..|++++++++||++||.......++++.||         .++|.+|..|+++.++++||++||...
T Consensus        40 ~~W~~~~~~p~~r~~~~~~~~~~~lyv~GG~~~~~~~~~~~~~d~~~~~W~~~~~~p~~r~~~~~~~~~~~iyv~GG~~~  119 (302)
T 2xn4_A           40 ERWHQVAELPSRRCRAGMVYMAGLVFAVGGFNGSLRVRTVDSYDPVKDQWTSVANMRDRRSTLGAAVLNGLLYAVGGFDG  119 (302)
T ss_dssp             TEEEEECCCSSCCBSCEEEEETTEEEEESCBCSSSBCCCEEEEETTTTEEEEECCCSSCCBSCEEEEETTEEEEEEEECS
T ss_pred             CcEeEcccCCcccccceEEEECCEEEEEeCcCCCccccceEEECCCCCceeeCCCCCccccceEEEEECCEEEEEcCCCC
Confidence            37999999999999999999999999999987666667788887         778999999999999999999999865


Q ss_pred             CCCcccCCCceecCcEEEEECCCCeEEeecCCCCCCCCceeeEEEEECCEEEEEcCccCCccceeceeeEEEcCCCcEEE
Q psy8877          72 ESSLYHSGSEVYCPDLVYLDLKYFTWIRPNTTGSVPVGRRSHSAFVYGDGLYIFGGYNGLVEEHYNDIYRYCTRRQEWAR  151 (180)
Q Consensus        72 ~~~~~~~~~~~~~~~~~~~d~~~~~w~~~~~~~~~~~~r~~~~~~~~~~~i~v~GG~~~~~~~~~~~~~~~d~~~~~W~~  151 (180)
                               ....+++++||+.+++|++++   .+|.+|..|+++.++++||++||.........+++++||+.+++|+.
T Consensus       120 ---------~~~~~~~~~~d~~~~~W~~~~---~~p~~r~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~~yd~~~~~W~~  187 (302)
T 2xn4_A          120 ---------STGLSSVEAYNIKSNEWFHVA---PMNTRRSSVGVGVVGGLLYAVGGYDVASRQCLSTVECYNATTNEWTY  187 (302)
T ss_dssp             ---------SCEEEEEEEEETTTTEEEEEC---CCSSCCBSCEEEEETTEEEEECCEETTTTEECCCEEEEETTTTEEEE
T ss_pred             ---------CccCceEEEEeCCCCeEeecC---CCCCcccCceEEEECCEEEEEeCCCCCCCccccEEEEEeCCCCcEEE
Confidence                     345689999999999999986   48899999999999999999999976533567899999999999999


Q ss_pred             eecCCCCCCCCcceeEEEECCEEEEEcCC
Q psy8877         152 VIPHGAPPTKRRRQSCIIKGDTLIMFGGS  180 (180)
Q Consensus       152 ~~~~~~~~~~r~~~~~~~~~~~i~~~GG~  180 (180)
                      ++.   .|.+|..|+++.++++||++||.
T Consensus       188 ~~~---~p~~r~~~~~~~~~~~iyv~GG~  213 (302)
T 2xn4_A          188 IAE---MSTRRSGAGVGVLNNLLYAVGGH  213 (302)
T ss_dssp             ECC---CSSCCBSCEEEEETTEEEEECCB
T ss_pred             CCC---CccccccccEEEECCEEEEECCC
Confidence            976   45889999999999999999984
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3ju4_A Endo-N-acetylneuraminidase; endonf, polysia, high-resolution, glycosidase, hydrolase; HET: SLB; 0.98A {Enterobacteria phage K1F} PDB: 3gvl_A* 3gvj_A* 3gvk_A* 1v0e_A 1v0f_A* Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 180
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 5e-04
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure

class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: Kelch motif
family: Kelch motif
domain: Kelch-like ECH-associated protein 1, KEAP1
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 37.2 bits (84), Expect = 5e-04
 Identities = 23/151 (15%), Positives = 45/151 (29%), Gaps = 5/151 (3%)

Query: 2   HWTVHLTGGPRRVNHAAVLNDNKIFTFGGYCSGEDYVKRRPMDGEPPSYRDFHTANIIDG 61
            W +      RR+     + +  ++  GG+              E   +R     N I  
Sbjct: 128 EWHLVAPMLTRRIGVGVAVLNRLLYAVGGFDGTNRLNSAECYYPERNEWRMITAMNTIRS 187

Query: 62  RMYIWGGRGDESSLYHSGSEVYCPDLVYLDLKYFTWIRPNTTGSVPVGRRSHSAFVYGDG 121
                G     + +Y +G       L  ++              +   R +    V+   
Sbjct: 188 GA---GVCVLHNCIYAAGGYDGQDQLNSVERYDVETETWTFVAPMKHRRSALGITVHQGR 244

Query: 122 LYIFGGYNGLVEEHYNDIYRYCTRRQEWARV 152
           +Y+ GGY+G      + +  Y      W+ V
Sbjct: 245 IYVLGGYDG--HTFLDSVECYDPDTDTWSEV 273

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query180
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 99.95
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 99.95
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 99.87
d1k3ia3 387 Galactose oxidase, central domain {Fungi (Fusarium 99.83
d2ghsa1 295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 91.57
d1itva_195 Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 90.88
d1v0ea1516 Endo-alpha-sialidase {Bacteriophage K1F [TaxId: 34 88.94
d1su3a2195 Collagenase (MMP1), C-terminal domain {Human (Homo 87.02
d1pexa_192 Collagenase-3 (MMP-13), C-terminal domain {Human ( 86.05
d1kb0a2 573 Quinoprotein alcohol dehydrogenase, N-terminal dom 80.24
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: Kelch motif
family: Kelch motif
domain: Kelch-like ECH-associated protein 1, KEAP1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.95  E-value=1.7e-26  Score=164.46  Aligned_cols=163  Identities=17%  Similarity=0.243  Sum_probs=141.4

Q ss_pred             CceEEeccCCCCCcCeeEEEeCCEEEEEccccCCCCCceeeecC---------CCCCCcceeeeEEEECCEEEEEcCCCC
Q psy8877           1 MHWTVHLTGGPRRVNHAAVLNDNKIFTFGGYCSGEDYVKRRPMD---------GEPPSYRDFHTANIIDGRMYIWGGRGD   71 (180)
Q Consensus         1 ~~W~~~~~~~~~r~~~~~~~~~~~iy~~GG~~~~~~~~~~~~~~---------~~~p~~r~~~~~~~~~~~lyv~GG~~~   71 (180)
                      .+|+.++++|.+|..|+++++++++|++||.......++.+.++         ...+.+|..++++..++.+|++||...
T Consensus        80 ~~w~~~~~~p~~r~~~~~~~~~~~i~~~gg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~GG~~~  159 (288)
T d1zgka1          80 NQWSPCAPMSVPRNRIGVGVIDGHIYAVGGSHGCIHHNSVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGFDG  159 (288)
T ss_dssp             TEEEECCCCSSCCBTCEEEEETTEEEEECCEETTEECCCEEEEETTTTEEEECCCCSSCCBSCEEEEETTEEEEECCBCS
T ss_pred             ccccccccccceecceeccccceeeEEecceecccccceeeeeccccCccccccccccccccceeeeeeecceEecCccc
Confidence            47999999999999999999999999999976655555555544         778889999999999999999999876


Q ss_pred             CCCcccCCCceecCcEEEEECCCCeEEeecCCCCCCCCceeeEEEEECCEEEEEcCccCCccceeceeeEEEcCCCcEEE
Q psy8877          72 ESSLYHSGSEVYCPDLVYLDLKYFTWIRPNTTGSVPVGRRSHSAFVYGDGLYIFGGYNGLVEEHYNDIYRYCTRRQEWAR  151 (180)
Q Consensus        72 ~~~~~~~~~~~~~~~~~~~d~~~~~w~~~~~~~~~~~~r~~~~~~~~~~~i~v~GG~~~~~~~~~~~~~~~d~~~~~W~~  151 (180)
                               .....++++||+.+++|.....   .+..+..++++..+++++++||....  ....+.+.||+.+++|+.
T Consensus       160 ---------~~~~~~~~~~d~~~~~~~~~~~---~~~~~~~~~~~~~~~~i~i~GG~~~~--~~~~~~~~~~~~~~~~~~  225 (288)
T d1zgka1         160 ---------TNRLNSAECYYPERNEWRMITA---MNTIRSGAGVCVLHNCIYAAGGYDGQ--DQLNSVERYDVETETWTF  225 (288)
T ss_dssp             ---------SCBCCCEEEEETTTTEEEECCC---CSSCCBSCEEEEETTEEEEECCBCSS--SBCCCEEEEETTTTEEEE
T ss_pred             ---------ccccceEEEeeccccccccccc---cccccccccccceeeeEEEecCcccc--ccccceeeeeecceeeec
Confidence                     3456789999999999999753   77788899999999999999998764  567899999999999999


Q ss_pred             eecCCCCCCCCcceeEEEECCEEEEEcCC
Q psy8877         152 VIPHGAPPTKRRRQSCIIKGDTLIMFGGS  180 (180)
Q Consensus       152 ~~~~~~~~~~r~~~~~~~~~~~i~~~GG~  180 (180)
                      +++   .|.+|..|+++.++++|||+||.
T Consensus       226 ~~~---~p~~r~~~~~~~~~~~l~v~GG~  251 (288)
T d1zgka1         226 VAP---MKHRRSALGITVHQGRIYVLGGY  251 (288)
T ss_dssp             CCC---CSSCCBSCEEEEETTEEEEECCB
T ss_pred             ccC---ccCcccceEEEEECCEEEEEecC
Confidence            876   45889999999999999999984
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1itva_ b.66.1.1 (A:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v0ea1 b.68.1.2 (A:245-760) Endo-alpha-sialidase {Bacteriophage K1F [TaxId: 344021]} Back     information, alignment and structure
>d1su3a2 b.66.1.1 (A:271-465) Collagenase (MMP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pexa_ b.66.1.1 (A:) Collagenase-3 (MMP-13), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure