Psyllid ID: psy8879


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690----
MSLIAYLMRDILRDGMSQYCLVLLLTIYSYVTATSSPSTPTSTLPSSPSTPTPWSCPSIKNDLCACDLPHTLRCTANKSDLYAISESLRGLEPDERVSLLDCTLSNVTVLPGKFLEGVTLHGLVISSGELKNISDGAFIGLSSPLQALGLPNNLLSVVPTSALAPLAPNLDRLDLSHNQLYKLENTSFKGLSSLNFLDLSYNKLMTLSQDCLAPLVTLRVLRLQGNRLTVSVVAALQGLRSVTDLDLSHNLLAGPLGPSTVPRLSSLKVLSIAHNQFSSVRRGALAGLDKLTSLSCHHNQIDVLEDHSFRALSTLSHLDLAHNRIVAVSGASLAHLSNLTTLDLSHNFLRALTQDLITPLKSLQELRLDDNDISMEPECIYVGFNTMDLELIYSGVWRHSTLLIPVMLSLCTRSSVVTRYRYCVVLIEGSNILDQSALVLGCSEILALVPTLTSQPLSYVTSLRANVTGLGTVQVYVQLWTNYDPNCLLTITLYIDGDVIVQKNTNCSRPWVSLKQLPWSPKYQVCATLGEFPTDKPLLHCITITNPFPSPPALPLAGPSTPTHSSHYTSLINLSNVLSLCLVLLCVLIVILICVLVRKICRTPRNSTIHHHACFIPVAQQEDDINRNNSDSRYVKLQATTILLSSLKVLSIAHNQFSSVRRGALAGLDKLTSLSCHHNQIDVLEDHSFSNVIG
ccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccEEEEcccccccccccccccccccccccEEEccccccccccccccccccccEEEccccccccccccccccccccccEEEccccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccHHHccccccccEEEccccccccccHHHHcccccccEEcccccccccccccccccccccccEEEccccccccccHHHccccccccEEEccccccccccHHHHcccccccEEEcccccccccccccccccccccEEEccccccccccHHHHcccccccEEEccccccccccHHHHcccccccHHHccccccccccccHHHHHHHcccccccHHHccccccccccccccccccccccccccccccccccccccccHHcccccccccEEEEccccccccccccccccccccccccccccccccccccHHccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccHHHHHHHHHHHcccccEEEcccccccccccccccccccccEEEccccccccccccccccccc
ccHHHHHHHccccccccccccHHHHHHHHHcEEEcccccccccccHHccccccccEEEcccccccccccHHHHHHHccccccccccccHHHcccccccEEEccccccccccHHHcccccccEEEcccccccccccHHHHcHHHcccEEEcccccccccccHHcccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccEEccccccccccccEEEccccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccEEccccccccccccEEEcccccccEEccccccccccccEEEcccccccccccHHHHccccccEEEccccccccEEccccccccccccHHHccccccEEEEcccccccccccHHcccHHHHHHHHHHcccccccccHHHcccccccEEEcccccccccccHHHHHHHHHHHcccccccccHHccccccccEEEcccccccccccccccccHHHHHHHHHcccccccccccccccccHcccHHHHHHHcccccccccccHHHHHHHHHHHccccccccccHHHccccccEEEEccccccccccccHccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHHcccc
MSLIAYLMRDILRDGMSQYCLVLLLTIYSYVtatsspstptstlpsspstptpwscpsikndlcacdlphtlrctanksDLYAISEslrglepdervslldctlsnvtvlpgkflegvTLHGLVissgelknisdgafiglssplqalglpnnllsvvptsalaplapnldrldlshnqlyklentsfkglsslnflDLSYNKLMTLSQDCLAPLVTLRVLRLQGNRLTVSVVAALQGlrsvtdldlshnllagplgpstvprlsslKVLSIAHNQFSSVRRGALagldkltslschhnqidvledhsfralstlshldlahNRIVAVSGAslahlsnlttldLSHNFLRALTQDLITPLkslqelrlddndismepeciyvgFNTMDLELIYSGVWRHSTLLIPVMLSLctrssvvtRYRYCVVLIEgsnildqsALVLGCSEILAlvptltsqplsyvTSLRANVTGLGTVQVYVQLWtnydpncllTITLYIDGDVIvqkntncsrpwvslkqlpwspkyqvcatlgefptdkpllhcititnpfpsppalplagpstpthsshyTSLINLSNVLSLCLVLLCVLIVILICVLVRKicrtprnstihhhacfipvaqqeddinrnnsdsrYVKLQATTILLSSLKVLSIAHNQFSSVRRGALagldkltslschhnqidvledhsfsnvig
MSLIAYLMRDILRDGMSQYCLVLLLTIYSYVTATSSPSTPTSTLPSSPSTPTPWSCPSIKNDLCACDLPHTLRCTANKSDLYAISESLRGLEPDERVSLLDCTLSNVTVLPGKFLEGVTLHGLVISSGELKNISDGAFIGLSSPLQALGLPNNLLSVVPTSALAPLAPNLDRLDLSHNQLYKLENTSFKGLSSLNFLDLSYNKLMTLSQDCLAPLVTLRVLRLQGNRLTVSVVAALQGLRSVTDLDLSHNLLAGPLGPSTVPRLSSLKVLSIAHNQFSSVRRGALAGLDKLTSLSCHHNQIDVLEDHSFRALSTLSHLDLAHNRIVAVSGASLAHLSNLTTLDLSHNFLRALTQDLITPLKSLqelrlddndisMEPECIYVGFNTMDLELIYSGVWRHSTLLIPVMLSLCTRSSVVTRYRYCVVLIEGSNILDQSALVLGCSEILALVPTLTSQPLSYVTSLRANVTGLGTVQVYVQLWTNYDPNCLLTITLYIDGDVIVQKNTNCSRPWVSLKQLPWSPKYQVCATLGEFPTDKPLLHCITITNPFPSPPALPLAGPSTPTHSSHYTSLINLSNVLSLCLVLLCVLIVILICVLVRKICRTPRNSTIHHHACFIPVAQQEDDINRNNSDSRYVKLQATTILLSSLKVLSIAHNQFSSVRRGALAGLDKLTSLSCHHNqidvledhsfsnvig
MSLIAYLMRDILRDGMSQYCLVLLLTIYSYVtatsspstptstlpsspstptpwscpsIKNDLCACDLPHTLRCTANKSDLYAISESLRGLEPDERVSLLDCTLSNVTVLPGKFLEGVTLHGLVISSGELKNISDGAFIGLSSPLQALGLPNNLLSVVPTSALAPLAPNLDRLDLSHNQLYKLENTSFKGLSSLNFLDLSYNKLMTLSQDCLAPLVTLRVLRLQGNRLTVSVVAALQGLRSVTDLDLSHNLLAGPLGPSTVPRLSSLKVLSIAHNQFSSVRRGALAGLDKLTSLSCHHNQIDVLEDHSFRALSTLSHLDLAHNRIVAVSGASLAHLSNLTTLDLSHNFLRALTQDLITPLKSLQELRLDDNDISMEPECIYVGFNTMDLELIYSGVWRHSTLLIPVMLSLCTRSSVVTRYRYCVVLIEGSNILDQSALVLGCSEILALVPTLTSQPLSYVTSLRANVTGLGTVQVYVQLWTNYDPNCLLTITLYIDGDVIVQKNTNCSRPWVSLKQLPWSPKYQVCATLGEFPTDKPLLHCITITNpfpsppalplagpstpthsshytslinlsnvlslclvllcvlivilicvlvRKICRTPRNSTIHHHACFIPVAQQEDDINRNNSDSRYVKLQATTILLSSLKVLSIAHNQFSSVRRGALAGLDKLTSLSCHHNQIDVLEDHSFSNVIG
**LIAYLMRDILRDGMSQYCLVLLLTIYSYVTA********************WSCPSIKNDLCACDLPHTLRCTANKSDLYAISESLRGLEPDERVSLLDCTLSNVTVLPGKFLEGVTLHGLVISSGELKNISDGAFIGLSSPLQALGLPNNLLSVVPTSALAPLAPNLDRLDLSHNQLYKLENTSFKGLSSLNFLDLSYNKLMTLSQDCLAPLVTLRVLRLQGNRLTVSVVAALQGLRSVTDLDLSHNLLAGPLGPSTVPRLSSLKVLSIAHNQFSSVRRGALAGLDKLTSLSCHHNQIDVLEDHSFRALSTLSHLDLAHNRIVAVSGASLAHLSNLTTLDLSHNFLRALTQDLITPLKSLQELRLDDNDISMEPECIYVGFNTMDLELIYSGVWRHSTLLIPVMLSLCTRSSVVTRYRYCVVLIEGSNILDQSALVLGCSEILALVPTLTSQPLSYVTSLRANVTGLGTVQVYVQLWTNYDPNCLLTITLYIDGDVIVQKNTNCSRPWVSLKQLPWSPKYQVCATLGEFPTDKPLLHCITITNPF******************HYTSLINLSNVLSLCLVLLCVLIVILICVLVRKICRTPRNSTIHHHACFIPVAQQE*********SRYVKLQATTILLSSLKVLSIAHNQFSSVRRGALAGLDKLTSLSCHHNQIDVLE*********
**LIAYLMRDILRDGMSQYCLVLLLTIYSYVTATSSPS**********STPTPWSCPSIKNDLCACDLPHTLRCTANKSDLYAISESLRGLEPDERVSLLDCTLSNVTVLPGKFLEGVTLHGLVISSGELKNISDGAFIGLSSPLQALGLPNNLLSVVPTSALAPLAPNLDRLDLSHNQLYKLENTSFKGLSSLNFLDLSYNKLMTLSQDCLAPLVTLRVLRLQGNRLTVSVVAALQGLRSVTDLDLSHNLLAGPLGPSTVPRLSSLKVLSIAHNQFSSVRRGALAGLDKLTSLSCHHNQIDVLEDHSFRALSTLSHLDLAHNRIVAVSGASLAHLSNLTTLDLSHNFLRALTQDLITPLKSLQELRLDDNDISMEPECIYVGFNTMDLELIYSGVWRHSTLLIPVMLSLCTRSSVVTRYRYCVVLIEGSNILDQSALVLGCSEILALVPTLTSQPLSYVTSLRANVTGLGTVQVYVQLWTNYDPNCLLTITLYIDGDVIVQKNTNCSRPWVSLKQLPWSPKYQVCATLGEFPTDKPLLHCITITNPFPSPPALPLAGPSTPTHSSHYTSLINLSNVLSLCLVLLCVLIVILICVLVRKICRTPRNSTIHHHACFIPVAQQEDDINRNNSDSRYVKLQATTILLSSLKVLSIAHNQFSSVRRGALAGLDKLTSLSCHHNQIDVLEDHSFSNVIG
MSLIAYLMRDILRDGMSQYCLVLLLTIYSYVTA*********************SCPSIKNDLCACDLPHTLRCTANKSDLYAISESLRGLEPDERVSLLDCTLSNVTVLPGKFLEGVTLHGLVISSGELKNISDGAFIGLSSPLQALGLPNNLLSVVPTSALAPLAPNLDRLDLSHNQLYKLENTSFKGLSSLNFLDLSYNKLMTLSQDCLAPLVTLRVLRLQGNRLTVSVVAALQGLRSVTDLDLSHNLLAGPLGPSTVPRLSSLKVLSIAHNQFSSVRRGALAGLDKLTSLSCHHNQIDVLEDHSFRALSTLSHLDLAHNRIVAVSGASLAHLSNLTTLDLSHNFLRALTQDLITPLKSLQELRLDDNDISMEPECIYVGFNTMDLELIYSGVWRHSTLLIPVMLSLCTRSSVVTRYRYCVVLIEGSNILDQSALVLGCSEILALVPTLTSQPLSYVTSLRANVTGLGTVQVYVQLWTNYDPNCLLTITLYIDGDVIVQKNTNCSRPWVSLKQLPWSPKYQVCATLGEFPTDKPLLHCITITNPFPSPPALPL*********SHYTSLINLSNVLSLCLVLLCVLIVILICVLVRKICRTPRNSTIHHHACFIPVAQQEDDINRNNSDSRYVKLQATTILLSSLKVLSIAHNQFSSVRRGALAGLDKLTSLSCHHNQIDVLEDHSFSNVIG
MSLIAYLMRDILRDGMSQYCLVLLLTIYSYVTATSSPSTPTSTLPSSPSTPTPWSCPSIKNDLCACDLPHTLRCTANKSDLYAISESLRGLEPDERVSLLDCTLSNVTVLPGKFLEGVTLHGLVISSGELKNISDGAFIGLSSPLQALGLPNNLLSVVPTSALAPLAPNLDRLDLSHNQLYKLENTSFKGLSSLNFLDLSYNKLMTLSQDCLAPLVTLRVLRLQGNRLTVSVVAALQGLRSVTDLDLSHNLLAGPLGPSTVPRLSSLKVLSIAHNQFSSVRRGALAGLDKLTSLSCHHNQIDVLEDHSFRALSTLSHLDLAHNRIVAVSGASLAHLSNLTTLDLSHNFLRALTQDLITPLKSLQELRLDDNDISMEPECIYVGFNTMDLELIYSGVWRHSTLLIPVMLSLCTRSSVVTRYRYCVVLIEGSNILDQSALVLGCSEILALVPTLTSQPLSYVTSLRANVTGLGTVQVYVQLWTNYDPNCLLTITLYIDGDVIVQKNTNCSRPWVSLKQLPWSPKYQVCATLGEFPTDKPLLHCITITNPFPSPPALPLAGPSTPTHSSHYTSLINLSNVLSLCLVLLCVLIVILICVLVRKICRTPRNSTIHHHACFIPVAQQEDDINRNNSDSRYVKLQATTILLSSLKVLSIAHNQFSSVRRGALAGLDKLTSLSCHHNQIDVLEDHSFS*VIG
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLIAYLMRDILRDGMSQYCLVLLLTIYSYVTATSSPSTPTSTLPSSPSTPTPWSCPSIKNDLCACDLPHTLRCTANKSDLYAISESLRGLEPDERVSLLDCTLSNVTVLPGKFLEGVTLHGLVISSGELKNISDGAFIGLSSPLQALGLPNNLLSVVPTSALAPLAPNLDRLDLSHNQLYKLENTSFKGLSSLNFLDLSYNKLMTLSQDCLAPLVTLRVLRLQGNRLTVSVVAALQGLRSVTDLDLSHNLLAGPLGPSTVPRLSSLKVLSIAHNQFSSVRRGALAGLDKLTSLSCHHNQIDVLEDHSFRALSTLSHLDLAHNRIVAVSGASLAHLSNLTTLDLSHNFLRALTQDLITPLKSLQELRLDDNDISMEPECIYVGFNTMDLELIYSGVWRHSTLLIPVMLSLCTRSSVVTRYRYCVVLIEGSNILDQSALVLGCSEILALVPTLTSQPLSYVTSLRANVTGLGTVQVYVQLWTNYDPNCLLTITLYIDGDVIVQKNTNCSRPWVSLKQLPWSPKYQVCATLGEFPTDKPLLHCITITNPFPSPPALPLAGPSTPTHSSHYTSLINLSNVLSLCLVLLCVLIVILICVLVRKICRTPRNSTIHHHACFIPVAQQEDDINRNNSDSRYVKLQATTILLSSLKVLSIAHNQFSSVRRGALAGLDKLTSLSCHHNQIDVLEDHSFSNVIG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query694 2.2.26 [Sep-21-2011]
P35858605 Insulin-like growth facto yes N/A 0.367 0.421 0.356 3e-23
P35859603 Insulin-like growth facto yes N/A 0.391 0.451 0.316 1e-22
O02833605 Insulin-like growth facto N/A N/A 0.367 0.421 0.356 2e-22
P70389603 Insulin-like growth facto yes N/A 0.397 0.457 0.309 1e-21
Q7Z2Q7622 Leucine-rich repeat-conta no N/A 0.386 0.430 0.327 1e-20
Q8R5M3578 Leucine-rich repeat-conta no N/A 0.378 0.455 0.309 3e-18
Q52KR2 1054 Leucine-rich repeats and no N/A 0.383 0.252 0.282 4e-18
Q6P1C6 1117 Leucine-rich repeats and no N/A 0.396 0.246 0.287 6e-18
D4A6D8523 Leucine-rich repeat trans no N/A 0.318 0.422 0.32 2e-17
Q80X72579 Leucine-rich repeat-conta no N/A 0.337 0.404 0.325 2e-17
>sp|P35858|ALS_HUMAN Insulin-like growth factor-binding protein complex acid labile subunit OS=Homo sapiens GN=IGFALS PE=1 SV=1 Back     alignment and function desciption
 Score =  110 bits (276), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 92/258 (35%), Positives = 128/258 (49%), Gaps = 3/258 (1%)

Query: 112 GKFLEGVTLHGLVISSGELKNISDGAFIGLSSPLQALGLPNNLLSVVPTSALAPLAPNLD 171
           G F     L  L +S+  L  + DG F GL S L  L L  N L+V+P +A   L  +L 
Sbjct: 140 GTFAHTPALASLGLSNNRLSRLEDGLFEGLGS-LWDLNLGWNSLAVLPDAAFRGLG-SLR 197

Query: 172 RLDLSHNQLYKLENTSFKGLSSLNFLDLSYNKLMTLSQDCLAPLVTLRVLRLQGNRLTVS 231
            L L+ N+L  L+   F GL+ L  LDLS N L  +  +    L  L+ L L  N +   
Sbjct: 198 ELVLAGNRLAYLQPALFSGLAELRELDLSRNALRAIKANVFVQLPRLQKLYLDRNLIAAV 257

Query: 232 VVAALQGLRSVTDLDLSHNLLAGPLGPSTVPRLSSLKVLSIAHNQFSSVRRGALAGLDKL 291
              A  GL+++  LDLSHN +AG L   T P L  L+VL ++HN  +S+R      L  L
Sbjct: 258 APGAFLGLKALRWLDLSHNRVAGLL-EDTFPGLLGLRVLRLSHNAIASLRPRTFKDLHFL 316

Query: 292 TSLSCHHNQIDVLEDHSFRALSTLSHLDLAHNRIVAVSGASLAHLSNLTTLDLSHNFLRA 351
             L   HN+I  L + SF  L  L  L L HN++  V   +   L+N+  ++LS N LR 
Sbjct: 317 EELQLGHNRIRQLAERSFEGLGQLEVLTLDHNQLQEVKAGAFLGLTNVAVMNLSGNCLRN 376

Query: 352 LTQDLITPLKSLQELRLD 369
           L + +   L  L  L L+
Sbjct: 377 LPEQVFRGLGKLHSLHLE 394




Involved in protein-protein interactions that result in protein complexes, receptor-ligand binding or cell adhesion.
Homo sapiens (taxid: 9606)
>sp|P35859|ALS_RAT Insulin-like growth factor-binding protein complex acid labile subunit OS=Rattus norvegicus GN=Igfals PE=1 SV=1 Back     alignment and function description
>sp|O02833|ALS_PAPHA Insulin-like growth factor-binding protein complex acid labile subunit OS=Papio hamadryas GN=IGFALS PE=2 SV=1 Back     alignment and function description
>sp|P70389|ALS_MOUSE Insulin-like growth factor-binding protein complex acid labile subunit OS=Mus musculus GN=Igfals PE=2 SV=1 Back     alignment and function description
>sp|Q7Z2Q7|LRR70_HUMAN Leucine-rich repeat-containing protein 70 OS=Homo sapiens GN=LRRC70 PE=2 SV=1 Back     alignment and function description
>sp|Q8R5M3|LRC15_RAT Leucine-rich repeat-containing protein 15 OS=Rattus norvegicus GN=Lrrc15 PE=2 SV=1 Back     alignment and function description
>sp|Q52KR2|LRIG2_MOUSE Leucine-rich repeats and immunoglobulin-like domains protein 2 OS=Mus musculus GN=Lrig2 PE=2 SV=1 Back     alignment and function description
>sp|Q6P1C6|LRIG3_MOUSE Leucine-rich repeats and immunoglobulin-like domains protein 3 OS=Mus musculus GN=Lrig3 PE=1 SV=1 Back     alignment and function description
>sp|D4A6D8|LRRT1_RAT Leucine-rich repeat transmembrane neuronal protein 1 OS=Rattus norvegicus GN=Lrrtm1 PE=3 SV=1 Back     alignment and function description
>sp|Q80X72|LRC15_MOUSE Leucine-rich repeat-containing protein 15 OS=Mus musculus GN=Lrrc15 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query694
193718353777 PREDICTED: LRR receptor-like serine/thre 0.466 0.416 0.633 1e-109
270011063 1155 cys-loop ligand-gated ion channel subuni 0.465 0.279 0.591 1e-100
91086515714 PREDICTED: similar to CG11136 CG11136-PA 0.465 0.452 0.591 1e-100
340724664 795 PREDICTED: slit homolog 1 protein-like [ 0.472 0.412 0.590 1e-100
350398155 795 PREDICTED: slit homolog 1 protein-like [ 0.461 0.402 0.592 2e-98
328782766794 PREDICTED: slit homolog 1 protein-like [ 0.472 0.413 0.584 3e-98
380021110771 PREDICTED: slit homolog 1 protein-like [ 0.471 0.424 0.586 1e-97
190702447747 leucine-rich repeat protein [Glyptapante 0.462 0.429 0.579 3e-97
190702295747 leucine-rich repeat protein [Glyptapante 0.461 0.428 0.581 5e-97
383865599791 PREDICTED: slit homolog 1 protein-like [ 0.463 0.407 0.582 1e-96
>gi|193718353|ref|XP_001950625.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase GSO2-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  401 bits (1031), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 206/325 (63%), Positives = 253/325 (77%), Gaps = 1/325 (0%)

Query: 54  WSCPSIKNDLCACDLPHTLRCTANKSDLYAISESLRGLEPDERVSLLDCTLSNVTVLPGK 113
           W CP ++N  CACDLPHTLRCT  KS    ++ +LR L     +SLLDCT+ NV  LP K
Sbjct: 48  WKCPEVRNVSCACDLPHTLRCTGGKSTFETVARALRRLSGTSSISLLDCTVQNVGSLPAK 107

Query: 114 FLEGVTLHGLVISSGELKNISDGAFIGLSSPLQALGLPNNLLSVVPTSALAPLAPNLDRL 173
            L+GV+LHGLV+SSGE+K++SD AF GL SPLQALGLPNNLL  VP+SALA L+  L+RL
Sbjct: 108 MLDGVSLHGLVVSSGEIKSVSDAAFDGLGSPLQALGLPNNLLERVPSSALAMLS-GLERL 166

Query: 174 DLSHNQLYKLENTSFKGLSSLNFLDLSYNKLMTLSQDCLAPLVTLRVLRLQGNRLTVSVV 233
           DLSHN+L+ + N SFKG  +L FLDLS N +  +S D    L  L+VLRLQ N LT +  
Sbjct: 167 DLSHNRLHTVHNNSFKGSPNLTFLDLSNNSINFISPDAFVNLPFLKVLRLQNNLLTSAST 226

Query: 234 AALQGLRSVTDLDLSHNLLAGPLGPSTVPRLSSLKVLSIAHNQFSSVRRGALAGLDKLTS 293
           + LQGLRS+ +LDLS NLLAG LGPST+PRL +L+++S+AHNQ +SVRRG+ AGL+ + S
Sbjct: 227 SHLQGLRSLIELDLSSNLLAGQLGPSTLPRLPNLQIISLAHNQLNSVRRGSFAGLEGIVS 286

Query: 294 LSCHHNQIDVLEDHSFRALSTLSHLDLAHNRIVAVSGASLAHLSNLTTLDLSHNFLRALT 353
           L+ +HNQIDVLEDH FRA+ TLSHLDLA+NRIVAVS ASLAHL+ L TLDLSHNFLR+LT
Sbjct: 287 LTLNHNQIDVLEDHGFRAVPTLSHLDLANNRIVAVSSASLAHLTKLKTLDLSHNFLRSLT 346

Query: 354 QDLITPLKSLQELRLDDNDISMEPE 378
            DLI PLKS+Q ++LDDNDIS+  E
Sbjct: 347 SDLIVPLKSIQVIKLDDNDISIVAE 371




Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|270011063|gb|EFA07511.1| cys-loop ligand-gated ion channel subunit-like protein [Tribolium castaneum] Back     alignment and taxonomy information
>gi|91086515|ref|XP_971643.1| PREDICTED: similar to CG11136 CG11136-PA [Tribolium castaneum] Back     alignment and taxonomy information
>gi|340724664|ref|XP_003400701.1| PREDICTED: slit homolog 1 protein-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|350398155|ref|XP_003485103.1| PREDICTED: slit homolog 1 protein-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|328782766|ref|XP_623776.3| PREDICTED: slit homolog 1 protein-like [Apis mellifera] Back     alignment and taxonomy information
>gi|380021110|ref|XP_003694417.1| PREDICTED: slit homolog 1 protein-like [Apis florea] Back     alignment and taxonomy information
>gi|190702447|gb|ACE75336.1| leucine-rich repeat protein [Glyptapanteles indiensis] Back     alignment and taxonomy information
>gi|190702295|gb|ACE75191.1| leucine-rich repeat protein [Glyptapanteles flavicoxis] Back     alignment and taxonomy information
>gi|383865599|ref|XP_003708260.1| PREDICTED: slit homolog 1 protein-like [Megachile rotundata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query694
FB|FBgn0034540808 Lrt "Leucine-rich tendon-speci 0.445 0.382 0.501 7.6e-74
UNIPROTKB|P35858605 IGFALS "Insulin-like growth fa 0.367 0.421 0.356 3e-27
WB|WBGene00002282 773 let-4 [Caenorhabditis elegans 0.442 0.397 0.283 2.5e-25
UNIPROTKB|F1LRE2602 Igfals "Insulin-like growth fa 0.410 0.473 0.297 4.8e-25
RGD|68429603 Igfals "insulin-like growth fa 0.410 0.472 0.297 6.4e-25
MGI|MGI:107973603 Igfals "insulin-like growth fa 0.410 0.472 0.294 2.1e-24
UNIPROTKB|Q8TF66581 LRRC15 "Leucine-rich repeat-co 0.422 0.504 0.290 1.5e-23
FB|FBgn0033250470 CG14762 [Drosophila melanogast 0.465 0.687 0.281 3.1e-23
UNIPROTKB|Q1KS52606 ALS "Acid-labile subunit" [Sus 0.420 0.481 0.305 3.9e-23
UNIPROTKB|F1NI07604 IGFALS "Uncharacterized protei 0.514 0.591 0.275 6.9e-23
FB|FBgn0034540 Lrt "Leucine-rich tendon-specific protein" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 720 (258.5 bits), Expect = 7.6e-74, Sum P(2) = 7.6e-74
 Identities = 158/315 (50%), Positives = 207/315 (65%)

Query:    64 CACDLPHTLRCTANKSDLYAISESLRGLEPDERVSLLDCTLSNVTVLP-GKFLEGVTLHG 122
             C CDLPHTLRC  +   +  +++ LR   P   +SLLDC+L NVT L   K  + V+LHG
Sbjct:   123 CGCDLPHTLRCNIDLHGMMLLADRLR-TSPYS-ISLLDCSLRNVTFLSDAKIFDNVSLHG 180

Query:   123 LVISSGELKNISDGAFIGLSSPLQALGLPNNLLSVVPTSALAPLAPNLDRLDLSHNQLYK 182
             LVISSGE+K +   AF+G+  PLQALGLP N L  VP +AL+ L+  L+RLDL++N++  
Sbjct:   181 LVISSGEIKRVHKSAFLGIRGPLQALGLPGNALMSVPWNALSTLSA-LERLDLANNKIKA 239

Query:   183 LENTSFKGLSSLNFLDLSYNKLMTLSQDCLAPLVTLRVLRLQGNRLT--VSVVAALQGLR 240
             L    F GL+SL +L+LS N++ ++SQ     L  L VL+L GNRL      + +L    
Sbjct:   240 LGTADFVGLTSLVYLELSNNQISSISQRTFVNLRKLEVLKLGGNRLGDYAQSLRSLSQCL 299

Query:   241 SVTDLDLSHNLLAGPLGPSTVPRLSSLKVLSIAHNQFSSVRRGALAGLDKLTSLSCHHNQ 300
             S+  LDL  N L GPL   T+P + +L+ L++  N   S++  ALA   +L SLS  HNQ
Sbjct:   300 SLRQLDLQANNLNGPLSEQTLPGMRNLESLNLNRNLIKSIQNKALANFSRLVSLSLRHNQ 359

Query:   301 IDVLEDHSFRALSTLSHLDLAHNRIVAVSGASLAHLSNLTTLDLSHNFLRALTQDLITPL 360
             IDVL+DH+F  L  L  LDL++N IVA+S ASL HLS LT LDL+HNFLRALT DLI PL
Sbjct:   360 IDVLQDHAFFGLGALDSLDLSYNGIVAISSASLQHLSRLTVLDLTHNFLRALTSDLIAPL 419

Query:   361 KSLQELRLDDNDISM 375
              SL+ELRL  NDIS+
Sbjct:   420 PSLRELRLAGNDISI 434


GO:0016021 "integral to membrane" evidence=IDA
GO:0005886 "plasma membrane" evidence=IDA
GO:2001282 "negative regulation of muscle cell chemotaxis toward tendon cell" evidence=IMP
GO:0005927 "muscle tendon junction" evidence=IDA
GO:0005515 "protein binding" evidence=IPI
GO:0043234 "protein complex" evidence=IPI
GO:2001283 "Roundabout signaling pathway involved in muscle cell chemotaxis toward tendon cell" evidence=IGI
UNIPROTKB|P35858 IGFALS "Insulin-like growth factor-binding protein complex acid labile subunit" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
WB|WBGene00002282 let-4 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|F1LRE2 Igfals "Insulin-like growth factor-binding protein complex acid labile subunit" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
RGD|68429 Igfals "insulin-like growth factor binding protein, acid labile subunit" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:107973 Igfals "insulin-like growth factor binding protein, acid labile subunit" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q8TF66 LRRC15 "Leucine-rich repeat-containing protein 15" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
FB|FBgn0033250 CG14762 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q1KS52 ALS "Acid-labile subunit" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1NI07 IGFALS "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query694
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-13
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 7e-12
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-11
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 3e-11
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-10
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 5e-10
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 7e-09
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 8e-09
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 8e-09
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-08
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 4e-08
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 7e-08
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 1e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 9e-06
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 2e-05
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-04
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 2e-04
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 6e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.001
PRK15370754 PRK15370, PRK15370, E3 ubiquitin-protein ligase Sl 0.002
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 0.003
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 0.003
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score = 73.0 bits (179), Expect = 3e-13
 Identities = 68/251 (27%), Positives = 107/251 (42%), Gaps = 30/251 (11%)

Query: 125 ISSGELKNISDGAFIGLSSPLQALGLPNNLLS-VVPTSALAPLAPNLDRLDLSHNQLYKL 183
           +S+ +L           SS L+ L L NN  +  +P  ++    PNL+ LDLS+N L   
Sbjct: 100 LSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPRGSI----PNLETLDLSNNMLSGE 155

Query: 184 ENTSFKGLSSLNFLDLSYNKLMTLSQDCLAPLVTLRVLRLQGNRLTVSVVAALQGLRSVT 243
                   SSL  LDL  N L+    + L  L +L  L L  N+L   +   L  ++S+ 
Sbjct: 156 IPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELGQMKSLK 215

Query: 244 DLDLSHNLLAGPLGPSTVPRLSSLKVLSIAHNQFSSVRRGALAGLDKLTSLSCHHNQIDV 303
            + L +N L+G + P  +  L+SL  L + +N  +                      I  
Sbjct: 216 WIYLGYNNLSGEI-PYEIGGLTSLNHLDLVYNNLTG--------------------PIPS 254

Query: 304 LEDHSFRALSTLSHLDLAHNRIVAVSGASLAHLSNLTTLDLSHNFLRALTQDLITPLKSL 363
               S   L  L +L L  N++      S+  L  L +LDLS N L     +L+  L++L
Sbjct: 255 ----SLGNLKNLQYLFLYQNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQLQNL 310

Query: 364 QELRLDDNDIS 374
           + L L  N+ +
Sbjct: 311 EILHLFSNNFT 321


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|185268 PRK15370, PRK15370, E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 694
KOG4194|consensus873 100.0
KOG4194|consensus 873 99.97
KOG4237|consensus498 99.97
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.95
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 99.94
KOG0444|consensus 1255 99.91
KOG0444|consensus 1255 99.89
KOG0472|consensus565 99.88
KOG4237|consensus498 99.87
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.84
KOG0472|consensus565 99.83
PRK15387788 E3 ubiquitin-protein ligase SspH2; Provisional 99.82
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.8
KOG0618|consensus 1081 99.78
KOG0618|consensus 1081 99.76
PRK15370754 E3 ubiquitin-protein ligase SlrP; Provisional 99.75
PLN032101153 Resistant to P. syringae 6; Provisional 99.72
PLN032101153 Resistant to P. syringae 6; Provisional 99.66
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.65
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.62
KOG0617|consensus264 99.54
KOG0617|consensus264 99.5
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.19
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.14
KOG0532|consensus 722 99.13
KOG0532|consensus 722 99.11
KOG3207|consensus505 99.1
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.09
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.08
KOG0531|consensus414 99.07
KOG1259|consensus490 99.03
KOG0531|consensus414 99.03
KOG3207|consensus505 99.0
KOG1909|consensus382 98.95
KOG1259|consensus490 98.93
KOG1909|consensus382 98.85
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.76
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.75
PLN03150623 hypothetical protein; Provisional 98.6
PLN03150623 hypothetical protein; Provisional 98.59
KOG4658|consensus889 98.58
KOG1859|consensus 1096 98.47
KOG1859|consensus 1096 98.37
KOG4658|consensus889 98.37
KOG2982|consensus418 98.29
KOG2982|consensus418 98.16
KOG4579|consensus177 98.06
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 98.05
KOG1644|consensus233 98.01
TIGR00864 2740 PCC polycystin cation channel protein. Note: this 97.98
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.95
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.77
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 97.77
KOG2120|consensus419 97.77
KOG1644|consensus233 97.75
KOG4579|consensus177 97.69
KOG2120|consensus419 97.65
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.55
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.51
PRK15386426 type III secretion protein GogB; Provisional 97.24
PRK15386426 type III secretion protein GogB; Provisional 97.22
KOG3665|consensus699 97.21
cd0585273 Ig5_Contactin-1 Fifth Ig domain of contactin-1. Ig 97.17
cd0586596 Ig1_NCAM-1 First immunoglobulin (Ig)-like domain o 97.16
cd0574574 Ig3_Peroxidasin Third immunoglobulin (Ig)-like dom 97.0
cd0586692 Ig1_NCAM-2 First immunoglobulin (Ig)-like domain o 96.99
cd0572371 Ig4_Neogenin Fourth immunoglobulin (Ig)-like domai 96.95
cd0589275 Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like 96.94
KOG3665|consensus699 96.93
cd0574669 Ig4_Peroxidasin Fourth immunoglobulin (Ig)-like do 96.88
cd0496973 Ig5_Contactin_like Fifth Ig domain of contactin. I 96.83
cd0572569 Ig3_Robo Third immunoglobulin (Ig)-like domain in 96.81
cd0589375 Ig_Palladin_C C-terminal immunoglobulin (Ig)-like 96.75
KOG2123|consensus388 96.71
cd0587671 Ig3_L1-CAM Third immunoglobulin (Ig)-like domain o 96.71
cd0497792 Ig1_NCAM-1_like First immunoglobulin (Ig)-like dom 96.71
cd0585385 Ig6_Contactin-4 Sixth Ig domain of contactin-4. Ig 96.66
cd0572796 Ig2_Contactin-2-like Second Ig domain of the neura 96.65
cd0573874 Ig2_RPTP_IIa_LAR_like Second immunoglobulin (Ig)-l 96.65
cd0573296 Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like dom 96.65
cd0573588 Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down 96.64
cd0586997 Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain o 96.63
cd0573479 Ig7_DSCAM Seventh immunoglobulin (Ig)-like domain 96.61
cd0576474 Ig_2 Subgroup of the immunoglobulin (Ig) superfami 96.6
cd0497085 Ig6_Contactin_like Sixth Ig domain of contactin. I 96.54
cd0574475 Ig_Myotilin_C_like Immunoglobulin (Ig)-like domain 96.52
KOG2739|consensus260 96.51
cd0572690 Ig4_Robo Fhird immunoglobulin (Ig)-like domain in 96.5
cd0585485 Ig6_Contactin-2 Sixth Ig domain of contactin-2. Ig 96.5
KOG2123|consensus388 96.49
cd0585785 Ig2_FGFR Second immunoglobulin (Ig)-like domain of 96.46
cd0576375 Ig_1 Subgroup of the immunoglobulin (Ig) superfami 96.41
KOG2739|consensus260 96.38
cd0587098 Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain o 96.34
cd0572486 Ig2_Robo Second immunoglobulin (Ig)-like domain in 96.33
cd0584595 Ig2_L1-CAM_like Second immunoglobulin (Ig)-like do 96.31
cd0497181 Ig_TrKABC_d5 Fifth domain (immunoglobulin-like) of 96.25
cd0497490 Ig3_FGFR Third immunoglobulin (Ig)-like domain of 96.19
cd0573792 Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)- 96.14
cd0589192 Ig_M-protein_C C-terminal immunoglobulin (Ig)-like 96.12
cd0585579 Ig_TrkB_d5 Fifth domain (immunoglobulin-like) of T 96.12
cd0585188 Ig3_Contactin-1 Third Ig domain of contactin-1. Ig 96.09
cd0589576 Ig_Pro_neuregulin-1 Immunoglobulin (Ig)-like domai 96.07
cd0497876 Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like 96.05
cd0574091 Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domai 96.02
cd0585890 Ig3_FGFR-2 Third immunoglobulin (Ig)-like domain o 95.99
cd0573171 Ig3_L1-CAM_like Third immunoglobulin (Ig)-like dom 95.97
cd0586776 Ig4_L1-CAM_like Fourth immunoglobulin (Ig)-like do 95.91
cd0589486 Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of card 95.85
cd0497290 Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) o 95.8
cd0574284 Ig1_VEGFR_like First immunoglobulin (Ig)-like doma 95.78
cd0576581 Ig_3 Subgroup of the immunoglobulin (Ig) superfami 95.77
cd0573676 Ig2_Follistatin_like Second immunoglobulin (Ig)-li 95.76
cd0574792 Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like 95.71
cd0497379 Ig1_FGFR First immunoglobulin (Ig)-like domain of 95.69
cd0586286 Ig1_VEGFR First immunoglobulin (Ig)-like domain of 95.69
cd0586876 Ig4_NrCAM Fourth immunoglobulin (Ig)-like domain o 95.69
cd0576077 Ig2_PTK7 Second immunoglobulin (Ig)-like domain of 95.63
cd0588295 Ig1_Necl-1 First (N-terminal) immunoglobulin (Ig)- 95.6
cd0496888 Ig3_Contactin_like Third Ig domain of contactin. I 95.58
cd0574874 Ig_Titin_like Immunoglobulin (Ig)-like domain of t 95.57
KOG3513|consensus 1051 95.55
cd0576298 Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of 95.54
cd0497671 Ig2_VEGFR Second immunoglobulin (Ig)-like domain o 95.5
cd0573095 Ig3_NCAM-1_like Third immunoglobulin (Ig)-like dom 95.46
cd04975101 Ig4_SCFR_like Fourth immunoglobulin (Ig)-like doma 95.4
cd0586470 Ig2_VEGFR-2 Second immunoglobulin (Ig)-like domain 95.4
cd0575075 Ig_Pro_neuregulin Immunoglobulin (Ig)-like domain 95.37
cd0586367 Ig2_VEGFR-3 Second immunoglobulin (Ig)-like domain 95.35
cd0585682 Ig2_FGFRL1-like Second immunoglobulin (Ig)-like do 95.33
cd0585094 Ig1_Contactin-2 First Ig domain of contactin-2. Ig 95.25
cd0587387 Ig_Sema4D_like Immunoglobulin (Ig)-like domain of 95.21
cd0584993 Ig1_Contactin-1 First Ig domain of contactin-1. Ig 95.16
PF0767990 I-set: Immunoglobulin I-set domain; InterPro: IPR0 95.04
cd0574378 Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domai 95.02
KOG1947|consensus482 94.99
cd0497989 Ig_Semaphorin_C Immunoglobulin (Ig)-like domain of 94.95
cd05859101 Ig4_PDGFR-alpha Fourth immunoglobulin (Ig)-like do 94.93
cd07693100 Ig1_Robo First immunoglobulin (Ig)-like domain in 94.92
cd0572295 Ig1_Neogenin First immunoglobulin (Ig)-like domain 94.81
cd0584894 Ig1_Contactin-5 First Ig domain of contactin-5. Ig 94.75
KOG4341|consensus483 94.74
cd0770272 Ig2_VEGFR-1 Second immunoglobulin (Ig)-like domain 94.65
cd0586184 Ig1_PDGFR-alphabeta Frst immunoglobulin (Ig)-like 94.53
cd0587477 Ig6_NrCAM Sixth immunoglobulin (Ig)-like domain of 94.51
cd05774105 Ig_CEACAM_D1 First immunoglobulin (Ig)-like domain 94.37
PF0004764 ig: Immunoglobulin domain The Prosite family only 94.34
KOG4308|consensus478 94.33
cd0572885 Ig4_Contactin-2-like Fourth Ig domain of the neura 94.28
cd05773109 Ig8_hNephrin_like Eighth immunoglobulin-like domai 94.2
cd0575694 Ig1_IL1R_like First immunoglobulin (Ig)-like domai 94.13
cd0573969 Ig3_RPTP_IIa_LAR_like Third immunoglobulin (Ig)-li 94.12
cd0770195 Ig1_Necl-3 First (N-terminal) immunoglobulin (Ig)- 93.91
KOG1947|consensus482 93.63
cd0573377 Ig6_L1-CAM_like Sixth immunoglobulin (Ig)-like dom 93.63
cd0575792 Ig2_IL1R_like Second immunoglobulin (Ig)-like doma 93.51
cd0572985 Ig2_FGFR_like Second immunoglobulin (Ig)-like doma 93.31
cd0575898 Ig5_KIRREL3-like Fifth immunoglobulin (Ig)-like do 93.23
cd0496791 Ig1_Contactin First Ig domain of contactin. Ig1_Co 93.12
cd0587191 Ig_Semaphorin_classIII Immunoglobulin (Ig)-like do 93.1
cd0588580 Ig2_Necl-4 Second immunoglobulin (Ig)-like domain 93.02
PF1392775 Ig_3: Immunoglobulin domain; PDB: 2D3V_A 1G0X_A 1V 92.97
KOG4341|consensus483 92.9
smart0040863 IGc2 Immunoglobulin C-2 Type. 92.89
cd0587577 Ig6_hNeurofascin_like Sixth immunoglobulin (Ig)-li 92.84
cd05896104 Ig1_IL1RAPL-1_like First immunoglobulin (Ig)-like 92.47
cd0589795 Ig2_IL1R2_like Second immunoglobulin (Ig)-like dom 92.15
cd0587285 Ig_Sema4B_like Immunoglobulin (Ig)-like domain of 92.12
cd0589898 Ig5_KIRREL3 Fifth immunoglobulin (Ig)-like domain 91.9
cd0588699 Ig1_Nectin-1_like First immunoglobulin (Ig) domain 91.79
PHA02826227 IL-1 receptor-like protein; Provisional 91.78
cd0571795 Ig1_Necl-1-3_like First (N-terminal) immunoglobuli 91.67
cd05714106 Ig_CSPGs_LP Immunoglobulin (Ig)-like domain of cho 91.59
smart0008251 LRRCT Leucine rich repeat C-terminal domain. 91.52
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 91.32
cd0575485 Ig3_Perlecan_like Third immunoglobulin (Ig)-like d 91.09
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 91.08
smart0037026 LRR Leucine-rich repeats, outliers. 91.08
cd05877106 Ig_LP_like Immunoglobulin (Ig)-like domain of huma 91.07
cd05713100 Ig_MOG_like Immunoglobulin (Ig)-like domain of mye 90.83
cd05888100 Ig1_Nectin-4_like Frst immunoglobulin (Ig) domain 90.78
KOG4308|consensus478 90.56
cd05902110 Ig_Neurocan Immunoglobulin (Ig)-like domain of the 90.4
cd0574981 Ig2_Tyro3_like Second immunoglobulin (Ig)-like dom 90.25
cd05879116 Ig_P0 Immunoglobulin (Ig)-like domain of Protein z 90.23
cd0575383 Ig2_FcgammaR_like Second immunoglobulin (Ig)-like 90.17
cd05901117 Ig_Versican Immunoglobulin (Ig)-like domain of the 90.14
cd0574192 Ig_CEACAM_D1_like First immunoglobulin (Ig)-like d 90.13
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 89.92
cd0571898 Ig1_PVR_like First immunoglobulin (Ig) domain of p 89.53
smart0037026 LRR Leucine-rich repeats, outliers. 89.44
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 89.44
cd0575278 Ig1_FcgammaR_like Frst immunoglobulin (Ig)-like do 88.89
cd0769094 Ig1_CD4 First immunoglobulin (Ig) domain of CD4. I 88.73
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 88.59
cd05900112 Ig_Aggrecan Immunoglobulin (Ig)-like domain of the 88.16
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 88.15
cd0588796 Ig1_Nectin-3_like First immunoglobulin (Ig) domain 88.12
smart0040986 IG Immunoglobulin. 87.96
smart0041086 IG_like Immunoglobulin like. IG domains that canno 87.96
cd05880115 Ig_EVA1 Immunoglobulin (Ig)-like domain of epithel 87.51
KOG0473|consensus326 87.33
KOG4222|consensus 1281 87.12
PHA02826227 IL-1 receptor-like protein; Provisional 86.79
cd0588195 Ig1_Necl-2 First (N-terminal) immunoglobulin (Ig)- 86.47
cd0588996 Ig1_DNAM-1_like First immunoglobulin (Ig) domain o 86.37
PHA0263363 hypothetical protein; Provisional 86.3
cd05878110 Ig_Aggrecan_like Immunoglobulin (Ig)-like domain o 85.66
cd05715116 Ig_P0-like Immunoglobulin (Ig)-like domain of Prot 85.22
PHA02785326 IL-beta-binding protein; Provisional 85.14
KOG3513|consensus 1051 85.13
PHA03376221 BARF1; Provisional 85.05
cd0577597 Ig_SLAM-CD84_like_N N-terminal immunoglobulin (Ig) 83.53
KOG0473|consensus326 83.53
cd05771139 IgC_Tapasin_R Tapasin-R immunoglobulin-like domain 83.15
KOG4221|consensus 1381 82.32
cd0584697 Ig1_MRC-OX-2_like First immunoglobulin (Ig) domain 81.86
KOG3864|consensus221 81.46
PF1389580 Ig_2: Immunoglobulin domain; PDB: 2V5R_B 2V5M_A 2V 81.19
PF07354271 Sp38: Zona-pellucida-binding protein (Sp38); Inter 80.96
PHA02785326 IL-beta-binding protein; Provisional 80.46
>KOG4194|consensus Back     alignment and domain information
Probab=100.00  E-value=2.4e-43  Score=378.60  Aligned_cols=408  Identities=24%  Similarity=0.325  Sum_probs=324.9

Q ss_pred             eeEEEcCCCCCCCCCc-cccCCCCccEEEccCCCCCCCCcchhcCCCCCccEEEccCCCCCCCCccccccCCCCccEEEc
Q psy8879          97 VSLLDCTLSNVTVLPG-KFLEGVTLHGLVISSGELKNISDGAFIGLSSPLQALGLPNNLLSVVPTSALAPLAPNLDRLDL  175 (694)
Q Consensus        97 L~~Ldls~n~l~~lp~-~~~~~~~L~~L~Ls~n~i~~i~~~~F~~l~~~L~~L~Ls~N~L~~lp~~~~~~l~~~L~~L~L  175 (694)
                      |+.||+|.|.|.++|. .|.+-.++++|+|++|.|+.+..+.|.++. +|..|.|+.|+++.+|...|+++ ++|+.|+|
T Consensus       151 lrslDLSrN~is~i~~~sfp~~~ni~~L~La~N~It~l~~~~F~~ln-sL~tlkLsrNrittLp~r~Fk~L-~~L~~LdL  228 (873)
T KOG4194|consen  151 LRSLDLSRNLISEIPKPSFPAKVNIKKLNLASNRITTLETGHFDSLN-SLLTLKLSRNRITTLPQRSFKRL-PKLESLDL  228 (873)
T ss_pred             hhhhhhhhchhhcccCCCCCCCCCceEEeeccccccccccccccccc-hheeeecccCcccccCHHHhhhc-chhhhhhc
Confidence            5666777777766654 355667899999999999999999998877 59999999999999999999999 99999999


Q ss_pred             cCCCCCCCCcccccCCCCccEEEecCCCCCCCCccccCCCCCCcEEeccCCcccchhhhhhccCcccccccCCCCcCCCC
Q psy8879         176 SHNQLYKLENTSFKGLSSLNFLDLSYNKLMTLSQDCLAPLVTLRVLRLQGNRLTVSVVAALQGLRSVTDLDLSHNLLAGP  255 (694)
Q Consensus       176 s~N~L~~i~~~~f~~L~~L~~L~Ls~N~l~~i~~~~f~~L~~L~~L~Ls~N~l~~~~~~~~~~L~~L~~L~Ls~N~l~~~  255 (694)
                      ..|+|..+....|.++++|+.|.|..|.|..+..++|..+.++++|+|..|++......++.+++.|+.|++++|.+.. 
T Consensus       229 nrN~irive~ltFqgL~Sl~nlklqrN~I~kL~DG~Fy~l~kme~l~L~~N~l~~vn~g~lfgLt~L~~L~lS~NaI~r-  307 (873)
T KOG4194|consen  229 NRNRIRIVEGLTFQGLPSLQNLKLQRNDISKLDDGAFYGLEKMEHLNLETNRLQAVNEGWLFGLTSLEQLDLSYNAIQR-  307 (873)
T ss_pred             cccceeeehhhhhcCchhhhhhhhhhcCcccccCcceeeecccceeecccchhhhhhcccccccchhhhhccchhhhhe-
Confidence            9999988877889999999999999999999999999999999999999999998888999999999999999999985 


Q ss_pred             CCCCCCCCccccceeeccCCcccccccccccCCcccceecccCCccccccchhhhcccccccccCCCCccccccc---cc
Q psy8879         256 LGPSTVPRLSSLKVLSIAHNQFSSVRRGALAGLDKLTSLSCHHNQIDVLEDHSFRALSTLSHLDLAHNRIVAVSG---AS  332 (694)
Q Consensus       256 i~p~~~~~l~~L~~L~Ls~N~L~~i~~~~~~~L~~L~~L~Ls~N~L~~i~~~~f~~l~~L~~L~Ls~N~L~~i~~---~~  332 (694)
                      +.++.++-.++|++|+|+.|+|++++++.|..+..|++|+|++|.|+.+...+|.++++|+.|||++|.|+....   ..
T Consensus       308 ih~d~WsftqkL~~LdLs~N~i~~l~~~sf~~L~~Le~LnLs~Nsi~~l~e~af~~lssL~~LdLr~N~ls~~IEDaa~~  387 (873)
T KOG4194|consen  308 IHIDSWSFTQKLKELDLSSNRITRLDEGSFRVLSQLEELNLSHNSIDHLAEGAFVGLSSLHKLDLRSNELSWCIEDAAVA  387 (873)
T ss_pred             eecchhhhcccceeEeccccccccCChhHHHHHHHhhhhcccccchHHHHhhHHHHhhhhhhhcCcCCeEEEEEecchhh
Confidence            778999999999999999999999999999999999999999999999999999999999999999999987644   46


Q ss_pred             hhcccccCeeecCCCCCCCcChhhhCCCCCCCEEEccCCCCCCCCccccc----------CCCC-CCccccccccccccc
Q psy8879         333 LAHLSNLTTLDLSHNFLRALTQDLITPLKSLQELRLDDNDISMEPECIYV----------GFNT-MDLELIYSGVWRHST  401 (694)
Q Consensus       333 f~~l~~L~~L~Ls~N~L~~l~~~~~~~l~~L~~L~Ls~N~L~~l~~~~f~----------~~Np-CdC~l~~~~~wl~~~  401 (694)
                      |.++++|+.|+|.+|+|+.++..+|..+++|++|||.+|.|..|.+..|.          +.+- |||.+.||..|+...
T Consensus       388 f~gl~~LrkL~l~gNqlk~I~krAfsgl~~LE~LdL~~NaiaSIq~nAFe~m~Lk~Lv~nSssflCDCql~Wl~qWl~~~  467 (873)
T KOG4194|consen  388 FNGLPSLRKLRLTGNQLKSIPKRAFSGLEALEHLDLGDNAIASIQPNAFEPMELKELVMNSSSFLCDCQLKWLAQWLYRR  467 (873)
T ss_pred             hccchhhhheeecCceeeecchhhhccCcccceecCCCCcceeecccccccchhhhhhhcccceEEeccHHHHHHHHHhc
Confidence            88999999999999999999999999999999999999999999999887          2222 999999999999643


Q ss_pred             ccCCccCccccCCcccceeeEEEEE-----------------eecCccccceeeeeceeE---------EEEeccCcccc
Q psy8879         402 LLIPVMLSLCTRSSVVTRYRYCVVL-----------------IEGSNILDQSALVLGCSE---------ILALVPTLTSQ  455 (694)
Q Consensus       402 ~~~~~~~~~C~~~~~~~~~~~~~v~-----------------~~~~~~~~~~~~~l~c~~---------i~~l~~~~~~~  455 (694)
                      .........|++|+.-......-+.                 .+......+.-.-+.|.+         +.|...+. ++
T Consensus       468 ~lq~sv~a~CayPe~Lad~~i~svd~~~lvC~DspkpqI~~qPe~~~al~g~nirftC~a~sssasplsi~WR~dne-vq  546 (873)
T KOG4194|consen  468 KLQSSVIAKCAYPEPLADQSIVSVDTANLVCDDSPKPQIVTQPETVSALIGENIRFTCNAYSSSASPLSIEWRKDNE-VQ  546 (873)
T ss_pred             ccccceeeeccCCcccccceeEeechhhceecCCCCcceecCchHhhhhhccceEEEEEeccCCCCCceeEeeeccc-cC
Confidence            3222233344443222111111000                 001111222335566766         55666555 44


Q ss_pred             ccceeEeeeeEEec------------ccEE-EEEEEecCCCcceeEEEEEeeeccceeEEeeccCC
Q psy8879         456 PLSYVTSLRANVTG------------LGTV-QVYVQLWTNYDPNCLLTITLYIDGDVIVQKNTNCS  508 (694)
Q Consensus       456 ~~~~i~~~~~n~~~------------~gtL-~~~v~~~d~G~YtC~~~n~~~~~~~~~~~~~~~~~  508 (694)
                      +...+.+.-.-.+.            .+.| ..||+..|+|.|.|+|+|..++.=+-.++-++|..
T Consensus       547 ~rv~ved~a~~~~q~r~~~~~e~~~~~~~L~L~nVt~td~grYQCVvtN~FGStysqk~KltV~~~  612 (873)
T KOG4194|consen  547 PRVDVEDFATFLSQNRNGTFGEREEYTAILHLDNVTFTDEGRYQCVVTNHFGSTYSQKAKLTVNQA  612 (873)
T ss_pred             cccchhcchhhhhhhccCccchhhhhhheeeeeeeecccCceEEEEEecccCcchhheeEEEeecc
Confidence            11111111111111            1233 88999999999999999987776555555555544



>KOG4194|consensus Back     alignment and domain information
>KOG4237|consensus Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG0444|consensus Back     alignment and domain information
>KOG0444|consensus Back     alignment and domain information
>KOG0472|consensus Back     alignment and domain information
>KOG4237|consensus Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>KOG0472|consensus Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>KOG0618|consensus Back     alignment and domain information
>KOG0618|consensus Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617|consensus Back     alignment and domain information
>KOG0617|consensus Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG0532|consensus Back     alignment and domain information
>KOG0532|consensus Back     alignment and domain information
>KOG3207|consensus Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0531|consensus Back     alignment and domain information
>KOG1259|consensus Back     alignment and domain information
>KOG0531|consensus Back     alignment and domain information
>KOG3207|consensus Back     alignment and domain information
>KOG1909|consensus Back     alignment and domain information
>KOG1259|consensus Back     alignment and domain information
>KOG1909|consensus Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG4658|consensus Back     alignment and domain information
>KOG1859|consensus Back     alignment and domain information
>KOG1859|consensus Back     alignment and domain information
>KOG4658|consensus Back     alignment and domain information
>KOG2982|consensus Back     alignment and domain information
>KOG2982|consensus Back     alignment and domain information
>KOG4579|consensus Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG1644|consensus Back     alignment and domain information
>TIGR00864 PCC polycystin cation channel protein Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2120|consensus Back     alignment and domain information
>KOG1644|consensus Back     alignment and domain information
>KOG4579|consensus Back     alignment and domain information
>KOG2120|consensus Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665|consensus Back     alignment and domain information
>cd05852 Ig5_Contactin-1 Fifth Ig domain of contactin-1 Back     alignment and domain information
>cd05865 Ig1_NCAM-1 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 Back     alignment and domain information
>cd05745 Ig3_Peroxidasin Third immunoglobulin (Ig)-like domain of peroxidasin Back     alignment and domain information
>cd05866 Ig1_NCAM-2 First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-2 Back     alignment and domain information
>cd05723 Ig4_Neogenin Fourth immunoglobulin (Ig)-like domain in neogenin and similar proteins Back     alignment and domain information
>cd05892 Ig_Myotilin_C C-terminal immunoglobulin (Ig)-like domain of myotilin Back     alignment and domain information
>KOG3665|consensus Back     alignment and domain information
>cd05746 Ig4_Peroxidasin Fourth immunoglobulin (Ig)-like domain of peroxidasin Back     alignment and domain information
>cd04969 Ig5_Contactin_like Fifth Ig domain of contactin Back     alignment and domain information
>cd05725 Ig3_Robo Third immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>cd05893 Ig_Palladin_C C-terminal immunoglobulin (Ig)-like domain of palladin Back     alignment and domain information
>KOG2123|consensus Back     alignment and domain information
>cd05876 Ig3_L1-CAM Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>cd04977 Ig1_NCAM-1_like First immunoglobulin (Ig)-like domain of neural cell adhesion molecule NCAM-1 and similar proteins Back     alignment and domain information
>cd05853 Ig6_Contactin-4 Sixth Ig domain of contactin-4 Back     alignment and domain information
>cd05727 Ig2_Contactin-2-like Second Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins Back     alignment and domain information
>cd05738 Ig2_RPTP_IIa_LAR_like Second immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR Back     alignment and domain information
>cd05732 Ig5_NCAM-1_like Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) and similar proteins Back     alignment and domain information
>cd05735 Ig8_DSCAM Eight immunoglobulin (Ig) domain of Down Syndrome Cell Adhesion molecule (DSCAM) Back     alignment and domain information
>cd05869 Ig5_NCAM-1 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) Back     alignment and domain information
>cd05734 Ig7_DSCAM Seventh immunoglobulin (Ig)-like domain of Down Syndrome Cell Adhesion molecule (DSCAM) Back     alignment and domain information
>cd05764 Ig_2 Subgroup of the immunoglobulin (Ig) superfamily Back     alignment and domain information
>cd04970 Ig6_Contactin_like Sixth Ig domain of contactin Back     alignment and domain information
>cd05744 Ig_Myotilin_C_like Immunoglobulin (Ig)-like domain of myotilin, palladin, and myopalladin Back     alignment and domain information
>KOG2739|consensus Back     alignment and domain information
>cd05726 Ig4_Robo Fhird immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>cd05854 Ig6_Contactin-2 Sixth Ig domain of contactin-2 Back     alignment and domain information
>KOG2123|consensus Back     alignment and domain information
>cd05857 Ig2_FGFR Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor Back     alignment and domain information
>cd05763 Ig_1 Subgroup of the immunoglobulin (Ig) superfamily Back     alignment and domain information
>KOG2739|consensus Back     alignment and domain information
>cd05870 Ig5_NCAM-2 Fifth immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-2 (also known as OCAM/mamFas II and RNCAM) Back     alignment and domain information
>cd05724 Ig2_Robo Second immunoglobulin (Ig)-like domain in Robo (roundabout) receptors Back     alignment and domain information
>cd05845 Ig2_L1-CAM_like Second immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins Back     alignment and domain information
>cd04971 Ig_TrKABC_d5 Fifth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC Back     alignment and domain information
>cd04974 Ig3_FGFR Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR) Back     alignment and domain information
>cd05737 Ig_Myomesin_like_C C-temrinal immunoglobulin (Ig)-like domain of myomesin and M-protein Back     alignment and domain information
>cd05891 Ig_M-protein_C C-terminal immunoglobulin (Ig)-like domain of M-protein (also known as myomesin-2) Back     alignment and domain information
>cd05855 Ig_TrkB_d5 Fifth domain (immunoglobulin-like) of Trk receptor TrkB Back     alignment and domain information
>cd05851 Ig3_Contactin-1 Third Ig domain of contactin-1 Back     alignment and domain information
>cd05895 Ig_Pro_neuregulin-1 Immunoglobulin (Ig)-like domain found in neuregulin (NRG)-1 Back     alignment and domain information
>cd04978 Ig4_L1-NrCAM_like Fourth immunoglobulin (Ig)-like domain of L1, Ng-CAM (Neuron-glia CAM cell adhesion molecule), and NrCAM (Ng-CAM-related) Back     alignment and domain information
>cd05740 Ig_CEACAM_D4 Fourth immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) Back     alignment and domain information
>cd05858 Ig3_FGFR-2 Third immunoglobulin (Ig)-like domain of fibroblast growth factor receptor 2 (FGFR2) Back     alignment and domain information
>cd05731 Ig3_L1-CAM_like Third immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>cd05867 Ig4_L1-CAM_like Fourth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) Back     alignment and domain information
>cd05894 Ig_C5_MyBP-C C5 immunoglobulin (Ig) domain of cardiac myosin binding protein C (MyBP-C) Back     alignment and domain information
>cd04972 Ig_TrkABC_d4 Fourth domain (immunoglobulin-like) of Trk receptors TrkA, TrkB and TrkC Back     alignment and domain information
>cd05742 Ig1_VEGFR_like First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor (R) and similar proteins Back     alignment and domain information
>cd05765 Ig_3 Subgroup of the immunoglobulin (Ig) superfamily Back     alignment and domain information
>cd05736 Ig2_Follistatin_like Second immunoglobulin (Ig)-like domain of a follistatin-like molecule encoded by the Mahya gene and similar proteins Back     alignment and domain information
>cd05747 Ig5_Titin_like M5, fifth immunoglobulin (Ig)-like domain of human titin C terminus and similar proteins Back     alignment and domain information
>cd04973 Ig1_FGFR First immunoglobulin (Ig)-like domain of fibroblast growth factor receptor (FGFR) Back     alignment and domain information
>cd05862 Ig1_VEGFR First immunoglobulin (Ig)-like domain of vascular endothelial growth factor (VEGF) receptor(R) Back     alignment and domain information
>cd05868 Ig4_NrCAM Fourth immunoglobulin (Ig)-like domain of NrCAM (NgCAM-related cell adhesion molecule) Back     alignment and domain information
>cd05760 Ig2_PTK7 Second immunoglobulin (Ig)-like domain of protein tyrosine kinase (PTK) 7, also known as CCK4 Back     alignment and domain information
>cd05882 Ig1_Necl-1 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molcule-1 (Necl-1, also known as cell adhesion molecule3 (CADM3)) Back     alignment and domain information
>cd04968 Ig3_Contactin_like Third Ig domain of contactin Back     alignment and domain information
>cd05748 Ig_Titin_like Immunoglobulin (Ig)-like domain of titin and similar proteins Back     alignment and domain information
>KOG3513|consensus Back     alignment and domain information
>cd05762 Ig8_MLCK Eighth immunoglobulin (Ig)-like domain of human myosin light-chain kinase (MLCK) Back     alignment and domain information
>cd04976 Ig2_VEGFR Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor (VEGFR) Back     alignment and domain information
>cd05730 Ig3_NCAM-1_like Third immunoglobulin (Ig)-like domain of Neural Cell Adhesion Molecule NCAM-1 (NCAM) Back     alignment and domain information
>cd04975 Ig4_SCFR_like Fourth immunoglobulin (Ig)-like domain of stem cell factor receptor (SCFR) and similar proteins Back     alignment and domain information
>cd05864 Ig2_VEGFR-2 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 2 (VEGFR-2) Back     alignment and domain information
>cd05750 Ig_Pro_neuregulin Immunoglobulin (Ig)-like domain in neuregulins (NRGs) Back     alignment and domain information
>cd05863 Ig2_VEGFR-3 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 3 (VEGFR-3) Back     alignment and domain information
>cd05856 Ig2_FGFRL1-like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor_like-1(FGFRL1) Back     alignment and domain information
>cd05850 Ig1_Contactin-2 First Ig domain of contactin-2 Back     alignment and domain information
>cd05873 Ig_Sema4D_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4D Back     alignment and domain information
>cd05849 Ig1_Contactin-1 First Ig domain of contactin-1 Back     alignment and domain information
>PF07679 I-set: Immunoglobulin I-set domain; InterPro: IPR013098 The basic structure of immunoglobulin (Ig) molecules is a tetramer of two light chains and two heavy chains linked by disulphide bonds Back     alignment and domain information
>cd05743 Ig_Perlecan_D2_like Immunoglobulin (Ig)-like domain II (D2) of the human basement membrane heparan sulfate proteoglycan perlecan, also known as HSPG2 Back     alignment and domain information
>KOG1947|consensus Back     alignment and domain information
>cd04979 Ig_Semaphorin_C Immunoglobulin (Ig)-like domain of semaphorin Back     alignment and domain information
>cd05859 Ig4_PDGFR-alpha Fourth immunoglobulin (Ig)-like domain of platelet-derived growth factor receptor (PDGFR) alpha Back     alignment and domain information
>cd07693 Ig1_Robo First immunoglobulin (Ig)-like domain in Robo (roundabout) receptors and similar proteins Back     alignment and domain information
>cd05722 Ig1_Neogenin First immunoglobulin (Ig)-like domain in neogenin and similar proteins Back     alignment and domain information
>cd05848 Ig1_Contactin-5 First Ig domain of contactin-5 Back     alignment and domain information
>KOG4341|consensus Back     alignment and domain information
>cd07702 Ig2_VEGFR-1 Second immunoglobulin (Ig)-like domain of vascular endothelial growth factor receptor 1 (VEGFR-1) Back     alignment and domain information
>cd05861 Ig1_PDGFR-alphabeta Frst immunoglobulin (Ig)-like domain of platelet-derived growth factor (PDGF) receptors (R), alpha (CD140a), and beta (CD140b) Back     alignment and domain information
>cd05874 Ig6_NrCAM Sixth immunoglobulin (Ig)-like domain of NrCAM (Ng (neuronglia) CAM-related cell adhesion molecule) Back     alignment and domain information
>cd05774 Ig_CEACAM_D1 First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) Back     alignment and domain information
>PF00047 ig: Immunoglobulin domain The Prosite family only concerns antibodies and MHCs Back     alignment and domain information
>KOG4308|consensus Back     alignment and domain information
>cd05728 Ig4_Contactin-2-like Fourth Ig domain of the neural cell adhesion molecule contactin-2 and similar proteins Back     alignment and domain information
>cd05773 Ig8_hNephrin_like Eighth immunoglobulin-like domain of nephrin Back     alignment and domain information
>cd05756 Ig1_IL1R_like First immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins Back     alignment and domain information
>cd05739 Ig3_RPTP_IIa_LAR_like Third immunoglobulin (Ig)-like domain of the receptor protein tyrosine phosphatase (RPTP)-F, also known as LAR Back     alignment and domain information
>cd07701 Ig1_Necl-3 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule-3 (Necl-3, also known as cell adhesion molecule 2 (CADM2)) Back     alignment and domain information
>KOG1947|consensus Back     alignment and domain information
>cd05733 Ig6_L1-CAM_like Sixth immunoglobulin (Ig)-like domain of the L1 cell adhesion molecule (CAM) and similar proteins Back     alignment and domain information
>cd05757 Ig2_IL1R_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor (IL1R) and similar proteins Back     alignment and domain information
>cd05729 Ig2_FGFR_like Second immunoglobulin (Ig)-like domain of fibroblast growth factor (FGF) receptor and similar proteins Back     alignment and domain information
>cd05758 Ig5_KIRREL3-like Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 (also known as Neph2) and similar proteins Back     alignment and domain information
>cd04967 Ig1_Contactin First Ig domain of contactin Back     alignment and domain information
>cd05871 Ig_Semaphorin_classIII Immunoglobulin (Ig)-like domain of class III semaphorin Back     alignment and domain information
>cd05885 Ig2_Necl-4 Second immunoglobulin (Ig)-like domain of nectin-like molecule-4 (Necl-4, also known as cell adhesion molecule 4 (CADM4)) Back     alignment and domain information
>PF13927 Ig_3: Immunoglobulin domain; PDB: 2D3V_A 1G0X_A 1VDG_A 1P7Q_D 3D2U_H 1UFU_A 1UGN_A 3VH8_H 3OQ3_B 4DKD_C Back     alignment and domain information
>KOG4341|consensus Back     alignment and domain information
>smart00408 IGc2 Immunoglobulin C-2 Type Back     alignment and domain information
>cd05875 Ig6_hNeurofascin_like Sixth immunoglobulin (Ig)-like domain of human neurofascin (NF) Back     alignment and domain information
>cd05896 Ig1_IL1RAPL-1_like First immunoglobulin (Ig)-like domain of X-linked interleukin-1 receptor accessory protein-like 1 (IL1RAPL-1) Back     alignment and domain information
>cd05897 Ig2_IL1R2_like Second immunoglobulin (Ig)-like domain of interleukin-1 receptor-2 (IL1R2) Back     alignment and domain information
>cd05872 Ig_Sema4B_like Immunoglobulin (Ig)-like domain of the class IV semaphorin Sema4B Back     alignment and domain information
>cd05898 Ig5_KIRREL3 Fifth immunoglobulin (Ig)-like domain of Kirrel (kin of irregular chiasm-like) 3 protein (also known as Neph2) Back     alignment and domain information
>cd05886 Ig1_Nectin-1_like First immunoglobulin (Ig) domain of nectin-1 (also known as poliovirus receptor related protein 1, or as CD111) and similar proteins Back     alignment and domain information
>PHA02826 IL-1 receptor-like protein; Provisional Back     alignment and domain information
>cd05717 Ig1_Necl-1-3_like First (N-terminal) immunoglobulin (Ig)-like domain of the nectin-like molecules Necl-1 - Necl-3 (also known as cell adhesion molecules CADM3, CADM1, and CADM2 respectively) Back     alignment and domain information
>cd05714 Ig_CSPGs_LP Immunoglobulin (Ig)-like domain of chondroitin sulfate proteoglycans (CSPGs), human cartilage link protein (LP) and similar proteins Back     alignment and domain information
>smart00082 LRRCT Leucine rich repeat C-terminal domain Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>cd05754 Ig3_Perlecan_like Third immunoglobulin (Ig)-like domain found in Perlecan and similar proteins Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>cd05877 Ig_LP_like Immunoglobulin (Ig)-like domain of human cartilage link protein (LP) Back     alignment and domain information
>cd05713 Ig_MOG_like Immunoglobulin (Ig)-like domain of myelin oligodendrocyte glycoprotein (MOG) Back     alignment and domain information
>cd05888 Ig1_Nectin-4_like Frst immunoglobulin (Ig) domain of nectin-4 (also known as poliovirus receptor related protein 4, or as LNIR receptor) and similar proteins Back     alignment and domain information
>KOG4308|consensus Back     alignment and domain information
>cd05902 Ig_Neurocan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), neurocan Back     alignment and domain information
>cd05749 Ig2_Tyro3_like Second immunoglobulin (Ig)-like domain of Axl/Tyro3 receptor tyrosine kinases (RTKs) Back     alignment and domain information
>cd05879 Ig_P0 Immunoglobulin (Ig)-like domain of Protein zero (P0) Back     alignment and domain information
>cd05753 Ig2_FcgammaR_like Second immunoglobulin (Ig)-like domain of Fcgamma-receptors (FcgammaRs) and similar proteins Back     alignment and domain information
>cd05901 Ig_Versican Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), versican Back     alignment and domain information
>cd05741 Ig_CEACAM_D1_like First immunoglobulin (Ig)-like domain of carcinoembryonic antigen (CEA) related cell adhesion molecule (CEACAM) and similar proteins Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>cd05718 Ig1_PVR_like First immunoglobulin (Ig) domain of poliovirus receptor (PVR, also known as CD155) and similar proteins Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>cd05752 Ig1_FcgammaR_like Frst immunoglobulin (Ig)-like domain of Fcgamma-receptors (FcgammaRs) and similar proteins Back     alignment and domain information
>cd07690 Ig1_CD4 First immunoglobulin (Ig) domain of CD4 Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>cd05900 Ig_Aggrecan Immunoglobulin (Ig)-like domain of the chondroitin sulfate proteoglycan core protein (CSPG), aggrecan Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>cd05887 Ig1_Nectin-3_like First immunoglobulin (Ig) domain of nectin-3 (also known as poliovirus receptor related protein 3) and similar proteins Back     alignment and domain information
>smart00409 IG Immunoglobulin Back     alignment and domain information
>smart00410 IG_like Immunoglobulin like Back     alignment and domain information
>cd05880 Ig_EVA1 Immunoglobulin (Ig)-like domain of epithelial V-like antigen 1 (EVA) Back     alignment and domain information
>KOG0473|consensus Back     alignment and domain information
>KOG4222|consensus Back     alignment and domain information
>PHA02826 IL-1 receptor-like protein; Provisional Back     alignment and domain information
>cd05881 Ig1_Necl-2 First (N-terminal) immunoglobulin (Ig)-like domain of nectin-like molecule 2 (also known as cell adhesion molecule 1 (CADM1)) Back     alignment and domain information
>cd05889 Ig1_DNAM-1_like First immunoglobulin (Ig) domain of DNAX accessory molecule 1 (DNAM-1, also known as CD226) and similar proteins Back     alignment and domain information
>PHA02633 hypothetical protein; Provisional Back     alignment and domain information
>cd05878 Ig_Aggrecan_like Immunoglobulin (Ig)-like domain of the aggrecan-like chondroitin sulfate proteoglycan core protein (CSPG) Back     alignment and domain information
>cd05715 Ig_P0-like Immunoglobulin (Ig)-like domain of Protein zero (P0) and similar proteins Back     alignment and domain information
>PHA02785 IL-beta-binding protein; Provisional Back     alignment and domain information
>KOG3513|consensus Back     alignment and domain information
>PHA03376 BARF1; Provisional Back     alignment and domain information
>cd05775 Ig_SLAM-CD84_like_N N-terminal immunoglobulin (Ig)-like domain of the signaling lymphocyte activation molecule (SLAM) family, CD84_like Back     alignment and domain information
>KOG0473|consensus Back     alignment and domain information
>cd05771 IgC_Tapasin_R Tapasin-R immunoglobulin-like domain Back     alignment and domain information
>KOG4221|consensus Back     alignment and domain information
>cd05846 Ig1_MRC-OX-2_like First immunoglobulin (Ig) domain of rat MRC OX-2 antigen (also known as CD200) and similar proteins Back     alignment and domain information
>KOG3864|consensus Back     alignment and domain information
>PF13895 Ig_2: Immunoglobulin domain; PDB: 2V5R_B 2V5M_A 2V5S_B 2GI7_A 3LAF_A 4DEP_C 3O4O_B 2EC8_A 2E9W_A 1J87_A Back     alignment and domain information
>PF07354 Sp38: Zona-pellucida-binding protein (Sp38); InterPro: IPR010857 This family contains a number of zona-pellucida-binding proteins that seem to be restricted to mammals Back     alignment and domain information
>PHA02785 IL-beta-binding protein; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query694
3zyn_A321 Crystal Structure Of The N-Terminal Leucine Rich Re 7e-16
3zyo_A411 Crystal Structure Of The N-Terminal Leucine Rich Re 7e-16
3kj4_A286 Structure Of Rat Nogo Receptor Bound To 1d9 Antagon 4e-14
3kj4_A286 Structure Of Rat Nogo Receptor Bound To 1d9 Antagon 1e-05
3zyj_A440 Netring1 In Complex With Ngl1 Length = 440 5e-14
3zyj_A440 Netring1 In Complex With Ngl1 Length = 440 1e-05
3zyi_A452 Netring2 In Complex With Ngl2 Length = 452 6e-14
1p8t_A285 Crystal Structure Of Nogo-66 Receptor Length = 285 3e-13
1p8t_A285 Crystal Structure Of Nogo-66 Receptor Length = 285 2e-05
1ozn_A285 1.5a Crystal Structure Of The Nogo Receptor Ligand 3e-13
1ozn_A285 1.5a Crystal Structure Of The Nogo Receptor Ligand 2e-05
3rfs_A272 Design Of A Binding Scaffold Based On Variable Lymp 3e-13
3t6q_A606 Crystal Structure Of Mouse Rp105MD-1 Complex Length 4e-12
1xcd_A329 Dimeric Bovine Tissue-Extracted Decorin, Crystal Fo 1e-11
1xku_A330 Crystal Structure Of The Dimeric Protein Core Of De 1e-11
3rfj_A279 Design Of A Binding Scaffold Based On Variable Lymp 2e-11
2id5_A477 Crystal Structure Of The Lingo-1 Ectodomain Length 2e-11
2id5_A477 Crystal Structure Of The Lingo-1 Ectodomain Length 5e-07
2o6q_A270 Structural Diversity Of The Hagfish Variable Lympho 3e-11
3m19_A251 Crystal Structure Of Variable Lymphocyte Receptor V 6e-11
3m19_A251 Crystal Structure Of Variable Lymphocyte Receptor V 4e-08
3m18_A251 Crystal Structure Of Variable Lymphocyte Receptor V 6e-11
3m18_A251 Crystal Structure Of Variable Lymphocyte Receptor V 6e-08
3cig_A697 Crystal Structure Of Mouse Tlr3 Ectodomain Length = 8e-11
3cig_A 697 Crystal Structure Of Mouse Tlr3 Ectodomain Length = 4e-08
2ft3_A332 Crystal Structure Of The Biglycan Dimer Core Protei 1e-10
2ft3_A332 Crystal Structure Of The Biglycan Dimer Core Protei 4e-04
3v47_A455 Crystal Structure Of The N-Tetminal Fragment Of Zeb 4e-10
2z7x_A549 Crystal Structure Of The Tlr1-Tlr2 Heterodimer Indu 1e-09
2z7x_A549 Crystal Structure Of The Tlr1-Tlr2 Heterodimer Indu 2e-05
2z80_A353 Crystal Structure Of The Tlr1-Tlr2 Heterodimer Indu 1e-09
2z80_A353 Crystal Structure Of The Tlr1-Tlr2 Heterodimer Indu 2e-05
3j0a_A 844 Homology Model Of Human Toll-Like Receptor 5 Fitted 2e-09
2omz_A466 Crystal Structure Of Inla Y369a/hec1 Complex Length 2e-09
2omy_A461 Crystal Structure Of Inla S192n/hec1 Complex Length 2e-09
2omv_A461 Crystal Structure Of Inla S192n Y369s/hec1 Complex 3e-09
1o6s_A466 Internalin (Listeria Monocytogenes) E-Cadherin (Hum 3e-09
2omx_A462 Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX 5e-09
2omt_A462 Crystal Structure Of Inla G194s+sHEC1 COMPLEX Lengt 5e-09
2omu_A462 Crystal Structure Of Inla G194s+s Y369s/hec1 Comple 5e-09
2a0z_A705 The Molecular Structure Of Toll-like Receptor 3 Lig 1e-08
2a0z_A 705 The Molecular Structure Of Toll-like Receptor 3 Lig 2e-07
1ziw_A680 Human Toll-Like Receptor 3 Extracellular Domain Str 1e-08
1ziw_A 680 Human Toll-Like Receptor 3 Extracellular Domain Str 2e-07
3o6n_A390 Crystal Structure Of Apl1 Leucine-Rich Repeat Domai 1e-08
3o6n_A390 Crystal Structure Of Apl1 Leucine-Rich Repeat Domai 4e-05
3ulu_A694 Structure Of Quaternary Complex Of Human Tlr3ecd Wi 1e-08
3ulu_A 694 Structure Of Quaternary Complex Of Human Tlr3ecd Wi 2e-07
2z63_A570 Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 A 2e-08
2z63_A570 Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 A 2e-05
3oja_B597 Crystal Structure Of Lrim1APL1C COMPLEX Length = 59 4e-08
3oja_B597 Crystal Structure Of Lrim1APL1C COMPLEX Length = 59 6e-05
3p72_A269 Structure Of Platelet Glycoprotein 1b Alpha With A 5e-08
3p72_A269 Structure Of Platelet Glycoprotein 1b Alpha With A 4e-04
1u0n_D265 The Ternary Von Willebrand Factor A1-Glycoprotein I 5e-08
1u0n_D265 The Ternary Von Willebrand Factor A1-Glycoprotein I 4e-04
1m0z_A290 Crystal Structure Of The Von Willebrand Factor Bind 5e-08
1m0z_A290 Crystal Structure Of The Von Willebrand Factor Bind 7e-04
1m10_B290 Crystal Structure Of The Complex Of Glycoprotein Ib 6e-08
1m10_B290 Crystal Structure Of The Complex Of Glycoprotein Ib 6e-04
1p9a_G290 Crystal Structure Of N-terminal Domain Of Human Pla 6e-08
1p9a_G290 Crystal Structure Of N-terminal Domain Of Human Pla 5e-04
1ook_G290 Crystal Structure Of The Complex Of Platelet Recept 7e-08
1ook_G290 Crystal Structure Of The Complex Of Platelet Recept 5e-04
3pmh_G290 Mechanism Of Sulfotyrosine-Mediated Glycoprotein Ib 7e-08
3pmh_G290 Mechanism Of Sulfotyrosine-Mediated Glycoprotein Ib 5e-04
2v70_A220 Third Lrr Domain Of Human Slit2 Length = 220 8e-08
2v70_A220 Third Lrr Domain Of Human Slit2 Length = 220 4e-04
1p8v_A279 Crystal Structure Of The Complex Of Platelet Recept 8e-08
1p8v_A279 Crystal Structure Of The Complex Of Platelet Recept 4e-04
1gwb_B281 Structure Of Glycoprotein 1b Length = 281 9e-08
1gwb_B281 Structure Of Glycoprotein 1b Length = 281 3e-04
3rg1_A612 Crystal Structure Of The Rp105MD-1 Complex Length = 9e-08
1sq0_B288 Crystal Structure Of The Complex Of The Wild-Type V 1e-07
1sq0_B288 Crystal Structure Of The Complex Of The Wild-Type V 1e-04
2z66_A306 Crystal Structure Of The Vt3 Hybrid Of Human Tlr4 A 1e-07
3fxi_A605 Crystal Structure Of The Human Tlr4-Human Md-2-E.Co 1e-07
3fxi_A 605 Crystal Structure Of The Human Tlr4-Human Md-2-E.Co 3e-05
3a79_A580 Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Len 2e-07
3a79_A580 Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Len 1e-04
2z81_A549 Crystal Structure Of The Tlr1-tlr2 Heterodimer Indu 2e-07
2z81_A549 Crystal Structure Of The Tlr1-tlr2 Heterodimer Indu 1e-04
2v9t_B220 Complex Between The Second Lrr Domain Of Slit2 And 3e-07
2v9t_B220 Complex Between The Second Lrr Domain Of Slit2 And 1e-04
4g8a_A635 Crystal Structure Of Human Tlr4 Polymorphic Variant 3e-07
4g8a_A 635 Crystal Structure Of Human Tlr4 Polymorphic Variant 2e-05
2v9s_A220 Second Lrr Domain Of Human Slit2 Length = 220 3e-07
2v9s_A220 Second Lrr Domain Of Human Slit2 Length = 220 1e-04
3vq1_A606 Crystal Structure Of Mouse Tlr4MD-2LIPID IVA COMPLE 7e-07
3vq1_A606 Crystal Structure Of Mouse Tlr4MD-2LIPID IVA COMPLE 1e-04
2z64_A599 Crystal Structure Of Mouse Tlr4 And Mouse Md-2 Comp 8e-07
2z64_A599 Crystal Structure Of Mouse Tlr4 And Mouse Md-2 Comp 1e-04
2z62_A276 Crystal Structure Of The Tv3 Hybrid Of Human Tlr4 A 9e-07
3ul9_A278 Structure Of The Tv3 Mutant M41e Length = 278 9e-07
3ul7_A278 Crystal Structure Of The Tv3 Mutant F63w Length = 2 1e-06
3ula_A279 Crystal Structure Of The Tv3 Mutant F63w-Md-2-Erito 1e-06
3ul8_A279 Crystal Structure Of The Tv3 Mutant V134l Length = 1e-06
1w8a_A192 Third Lrr Domain Of Drosophila Slit Length = 192 3e-06
1w8a_A192 Third Lrr Domain Of Drosophila Slit Length = 192 1e-04
2o6s_A208 Structural Diversity Of The Hagfish Variable Lympho 5e-06
2wfh_A193 The Human Slit 2 Dimerization Domain D4 Length = 19 1e-05
3o53_A317 Crystal Structure Of Lrim1 Leucine-Rich Repeat Doma 2e-05
3rgx_A768 Structural Insight Into Brassinosteroid Perception 2e-05
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 2e-05
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 3e-05
3e6j_A229 Crystal Structure Of Variable Lymphocyte Receptor ( 6e-05
2xot_A361 Crystal Structure Of Neuronal Leucine Rich Repeat P 7e-05
3oja_A487 Crystal Structure Of Lrim1APL1C COMPLEX Length = 48 8e-05
3b2d_A603 Crystal Structure Of Human Rp105MD-1 Complex Length 8e-05
3v44_A407 Crystal Structure Of The N-Terminal Fragment Of Zeb 1e-04
4fho_A231 Crystal Structure Of An Internalin C2 (Inlc2) From 1e-04
2z7x_B520 Crystal Structure Of The Tlr1-Tlr2 Heterodimer Indu 1e-04
3a79_B562 Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Len 2e-04
2o6r_A177 Structural Diversity Of The Hagfish Variable Lympho 4e-04
1h6u_A308 Internalin H: Crystal Structure Of Fused N-Terminal 6e-04
>pdb|3ZYN|A Chain A, Crystal Structure Of The N-Terminal Leucine Rich Repeats Of Netrin-G Ligand-3 Length = 321 Back     alignment and structure

Iteration: 1

Score = 82.8 bits (203), Expect = 7e-16, Method: Compositional matrix adjust. Identities = 68/224 (30%), Positives = 107/224 (47%), Gaps = 3/224 (1%) Query: 148 LGLPNNLLSVVPTSALAPLAPNLDRLDLSHNQLYKLENTSFKGLSSLNFLDLSYNKLMTL 207 L L N + V+ T L +L+ L LS N + K+E +F GL SLN L+L N+L T+ Sbjct: 40 LNLQENSIQVIRTDTFKHLR-HLEILQLSKNLVRKIEVGAFNGLPSLNTLELFDNRLTTV 98 Query: 208 SQDCLAPLVTLRVLRLQGNRLTVSVVAALQGLRSVTDLDLSHNLLAGPLGPSTVPRLSSL 267 L LR L L+ N + A + S+ LDL + + L +L Sbjct: 99 PTQAFEYLSKLRELWLRNNPIESIPSYAFNRVPSLRRLDLGELKRLEYISEAAFEGLVNL 158 Query: 268 KVLSIAHNQFSSVRRGALAGLDKLTSLSCHHNQIDVLEDHSFRALSTLSHLDLAHNRIVA 327 + L++ + L L +L L N++D++ SF+ L++L L L H ++ Sbjct: 159 RYLNLGMCNLKDI--PNLTALVRLEELELSGNRLDLIRPGSFQGLTSLRKLWLMHAQVAT 216 Query: 328 VSGASLAHLSNLTTLDLSHNFLRALTQDLITPLKSLQELRLDDN 371 + + L +L L+LSHN L +L DL TPL L+ + L+ N Sbjct: 217 IERNAFDDLKSLEELNLSHNNLMSLPHDLFTPLHRLERVHLNHN 260
>pdb|3ZYO|A Chain A, Crystal Structure Of The N-Terminal Leucine Rich Repeats And Immunoglobulin Domain Of Netrin-G Ligand-3 Length = 411 Back     alignment and structure
>pdb|3KJ4|A Chain A, Structure Of Rat Nogo Receptor Bound To 1d9 Antagonist Antibody Length = 286 Back     alignment and structure
>pdb|3KJ4|A Chain A, Structure Of Rat Nogo Receptor Bound To 1d9 Antagonist Antibody Length = 286 Back     alignment and structure
>pdb|3ZYJ|A Chain A, Netring1 In Complex With Ngl1 Length = 440 Back     alignment and structure
>pdb|3ZYJ|A Chain A, Netring1 In Complex With Ngl1 Length = 440 Back     alignment and structure
>pdb|3ZYI|A Chain A, Netring2 In Complex With Ngl2 Length = 452 Back     alignment and structure
>pdb|1P8T|A Chain A, Crystal Structure Of Nogo-66 Receptor Length = 285 Back     alignment and structure
>pdb|1P8T|A Chain A, Crystal Structure Of Nogo-66 Receptor Length = 285 Back     alignment and structure
>pdb|1OZN|A Chain A, 1.5a Crystal Structure Of The Nogo Receptor Ligand Binding Domain Reveals A Convergent Recognition Scaffold Mediating Inhibition Of Myelination Length = 285 Back     alignment and structure
>pdb|1OZN|A Chain A, 1.5a Crystal Structure Of The Nogo Receptor Ligand Binding Domain Reveals A Convergent Recognition Scaffold Mediating Inhibition Of Myelination Length = 285 Back     alignment and structure
>pdb|3RFS|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 272 Back     alignment and structure
>pdb|3T6Q|A Chain A, Crystal Structure Of Mouse Rp105MD-1 Complex Length = 606 Back     alignment and structure
>pdb|1XCD|A Chain A, Dimeric Bovine Tissue-Extracted Decorin, Crystal Form 1 Length = 329 Back     alignment and structure
>pdb|1XKU|A Chain A, Crystal Structure Of The Dimeric Protein Core Of Decorin, The Archetypal Small Leucine-Rich Repeat Proteoglycan Length = 330 Back     alignment and structure
>pdb|3RFJ|A Chain A, Design Of A Binding Scaffold Based On Variable Lymphocyte Receptors Of Jawless Vertebrates By Module Engineering Length = 279 Back     alignment and structure
>pdb|2ID5|A Chain A, Crystal Structure Of The Lingo-1 Ectodomain Length = 477 Back     alignment and structure
>pdb|2ID5|A Chain A, Crystal Structure Of The Lingo-1 Ectodomain Length = 477 Back     alignment and structure
>pdb|2O6Q|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors A29 Length = 270 Back     alignment and structure
>pdb|3M19|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R5.1 Length = 251 Back     alignment and structure
>pdb|3M19|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R5.1 Length = 251 Back     alignment and structure
>pdb|3M18|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R2.1 In Complex With Hen Egg Lysozyme Length = 251 Back     alignment and structure
>pdb|3M18|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor Vlra.R2.1 In Complex With Hen Egg Lysozyme Length = 251 Back     alignment and structure
>pdb|3CIG|A Chain A, Crystal Structure Of Mouse Tlr3 Ectodomain Length = 697 Back     alignment and structure
>pdb|3CIG|A Chain A, Crystal Structure Of Mouse Tlr3 Ectodomain Length = 697 Back     alignment and structure
>pdb|2FT3|A Chain A, Crystal Structure Of The Biglycan Dimer Core Protein Length = 332 Back     alignment and structure
>pdb|2FT3|A Chain A, Crystal Structure Of The Biglycan Dimer Core Protein Length = 332 Back     alignment and structure
>pdb|3V47|A Chain A, Crystal Structure Of The N-Tetminal Fragment Of Zebrafish Tlr5 In Complex With Salmonella Flagellin Length = 455 Back     alignment and structure
>pdb|2Z7X|A Chain A, Crystal Structure Of The Tlr1-Tlr2 Heterodimer Induced By Binding Of A Tri-Acylated Lipopeptide Length = 549 Back     alignment and structure
>pdb|2Z7X|A Chain A, Crystal Structure Of The Tlr1-Tlr2 Heterodimer Induced By Binding Of A Tri-Acylated Lipopeptide Length = 549 Back     alignment and structure
>pdb|2Z80|A Chain A, Crystal Structure Of The Tlr1-Tlr2 Heterodimer Induced By Binding Of A Tri-Acylated Lipopeptide Length = 353 Back     alignment and structure
>pdb|2Z80|A Chain A, Crystal Structure Of The Tlr1-Tlr2 Heterodimer Induced By Binding Of A Tri-Acylated Lipopeptide Length = 353 Back     alignment and structure
>pdb|3J0A|A Chain A, Homology Model Of Human Toll-Like Receptor 5 Fitted Into An Electron Microscopy Single Particle Reconstruction Length = 844 Back     alignment and structure
>pdb|2OMZ|A Chain A, Crystal Structure Of Inla Y369a/hec1 Complex Length = 466 Back     alignment and structure
>pdb|2OMY|A Chain A, Crystal Structure Of Inla S192n/hec1 Complex Length = 461 Back     alignment and structure
>pdb|2OMV|A Chain A, Crystal Structure Of Inla S192n Y369s/hec1 Complex Length = 461 Back     alignment and structure
>pdb|1O6S|A Chain A, Internalin (Listeria Monocytogenes) E-Cadherin (Human) Recognition Complex Length = 466 Back     alignment and structure
>pdb|2OMX|A Chain A, Crystal Structure Of Inla S192n G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMT|A Chain A, Crystal Structure Of Inla G194s+sHEC1 COMPLEX Length = 462 Back     alignment and structure
>pdb|2OMU|A Chain A, Crystal Structure Of Inla G194s+s Y369s/hec1 Complex Length = 462 Back     alignment and structure
>pdb|2A0Z|A Chain A, The Molecular Structure Of Toll-like Receptor 3 Ligand Binding Domain Length = 705 Back     alignment and structure
>pdb|2A0Z|A Chain A, The Molecular Structure Of Toll-like Receptor 3 Ligand Binding Domain Length = 705 Back     alignment and structure
>pdb|1ZIW|A Chain A, Human Toll-Like Receptor 3 Extracellular Domain Structure Length = 680 Back     alignment and structure
>pdb|1ZIW|A Chain A, Human Toll-Like Receptor 3 Extracellular Domain Structure Length = 680 Back     alignment and structure
>pdb|3O6N|A Chain A, Crystal Structure Of Apl1 Leucine-Rich Repeat Domain Length = 390 Back     alignment and structure
>pdb|3O6N|A Chain A, Crystal Structure Of Apl1 Leucine-Rich Repeat Domain Length = 390 Back     alignment and structure
>pdb|3ULU|A Chain A, Structure Of Quaternary Complex Of Human Tlr3ecd With Three Fabs (Form1) Length = 694 Back     alignment and structure
>pdb|3ULU|A Chain A, Structure Of Quaternary Complex Of Human Tlr3ecd With Three Fabs (Form1) Length = 694 Back     alignment and structure
>pdb|2Z63|A Chain A, Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 570 Back     alignment and structure
>pdb|2Z63|A Chain A, Crystal Structure Of The Tv8 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 570 Back     alignment and structure
>pdb|3OJA|B Chain B, Crystal Structure Of Lrim1APL1C COMPLEX Length = 597 Back     alignment and structure
>pdb|3OJA|B Chain B, Crystal Structure Of Lrim1APL1C COMPLEX Length = 597 Back     alignment and structure
>pdb|3P72|A Chain A, Structure Of Platelet Glycoprotein 1b Alpha With A Bound Peptide Inhibitor Length = 269 Back     alignment and structure
>pdb|3P72|A Chain A, Structure Of Platelet Glycoprotein 1b Alpha With A Bound Peptide Inhibitor Length = 269 Back     alignment and structure
>pdb|1U0N|D Chain D, The Ternary Von Willebrand Factor A1-Glycoprotein Ibalpha- Botrocetin Complex Length = 265 Back     alignment and structure
>pdb|1U0N|D Chain D, The Ternary Von Willebrand Factor A1-Glycoprotein Ibalpha- Botrocetin Complex Length = 265 Back     alignment and structure
>pdb|1M0Z|A Chain A, Crystal Structure Of The Von Willebrand Factor Binding Domain Of Glycoprotein Ib Alpha Length = 290 Back     alignment and structure
>pdb|1M0Z|A Chain A, Crystal Structure Of The Von Willebrand Factor Binding Domain Of Glycoprotein Ib Alpha Length = 290 Back     alignment and structure
>pdb|1M10|B Chain B, Crystal Structure Of The Complex Of Glycoprotein Ib Alpha And The Von Willebrand Factor A1 Domain Length = 290 Back     alignment and structure
>pdb|1M10|B Chain B, Crystal Structure Of The Complex Of Glycoprotein Ib Alpha And The Von Willebrand Factor A1 Domain Length = 290 Back     alignment and structure
>pdb|1P9A|G Chain G, Crystal Structure Of N-terminal Domain Of Human Platelet Receptor Glycoprotein Ib-alpha At 1.7 Angstrom Resolution Length = 290 Back     alignment and structure
>pdb|1P9A|G Chain G, Crystal Structure Of N-terminal Domain Of Human Platelet Receptor Glycoprotein Ib-alpha At 1.7 Angstrom Resolution Length = 290 Back     alignment and structure
>pdb|1OOK|G Chain G, Crystal Structure Of The Complex Of Platelet Receptor Gpib-alpha And Human Alpha-thrombin Length = 290 Back     alignment and structure
>pdb|1OOK|G Chain G, Crystal Structure Of The Complex Of Platelet Receptor Gpib-alpha And Human Alpha-thrombin Length = 290 Back     alignment and structure
>pdb|3PMH|G Chain G, Mechanism Of Sulfotyrosine-Mediated Glycoprotein Ib Interaction With Two Distinct Alpha-Thrombin Sites Length = 290 Back     alignment and structure
>pdb|3PMH|G Chain G, Mechanism Of Sulfotyrosine-Mediated Glycoprotein Ib Interaction With Two Distinct Alpha-Thrombin Sites Length = 290 Back     alignment and structure
>pdb|2V70|A Chain A, Third Lrr Domain Of Human Slit2 Length = 220 Back     alignment and structure
>pdb|2V70|A Chain A, Third Lrr Domain Of Human Slit2 Length = 220 Back     alignment and structure
>pdb|1P8V|A Chain A, Crystal Structure Of The Complex Of Platelet Receptor Gpib-alpha And Alpha-thrombin At 2.6a Length = 279 Back     alignment and structure
>pdb|1P8V|A Chain A, Crystal Structure Of The Complex Of Platelet Receptor Gpib-alpha And Alpha-thrombin At 2.6a Length = 279 Back     alignment and structure
>pdb|1GWB|B Chain B, Structure Of Glycoprotein 1b Length = 281 Back     alignment and structure
>pdb|1GWB|B Chain B, Structure Of Glycoprotein 1b Length = 281 Back     alignment and structure
>pdb|3RG1|A Chain A, Crystal Structure Of The Rp105MD-1 Complex Length = 612 Back     alignment and structure
>pdb|1SQ0|B Chain B, Crystal Structure Of The Complex Of The Wild-Type Von Willebrand Factor A1 Domain And Glycoprotein Ib Alpha At 2.6 Angstrom Resolution Length = 288 Back     alignment and structure
>pdb|1SQ0|B Chain B, Crystal Structure Of The Complex Of The Wild-Type Von Willebrand Factor A1 Domain And Glycoprotein Ib Alpha At 2.6 Angstrom Resolution Length = 288 Back     alignment and structure
>pdb|2Z66|A Chain A, Crystal Structure Of The Vt3 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 306 Back     alignment and structure
>pdb|3FXI|A Chain A, Crystal Structure Of The Human Tlr4-Human Md-2-E.Coli Lps Ra Complex Length = 605 Back     alignment and structure
>pdb|3FXI|A Chain A, Crystal Structure Of The Human Tlr4-Human Md-2-E.Coli Lps Ra Complex Length = 605 Back     alignment and structure
>pdb|3A79|A Chain A, Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Length = 580 Back     alignment and structure
>pdb|3A79|A Chain A, Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Length = 580 Back     alignment and structure
>pdb|2Z81|A Chain A, Crystal Structure Of The Tlr1-tlr2 Heterodimer Induced By Binding Of A Tri-acylated Lipopeptide Length = 549 Back     alignment and structure
>pdb|2Z81|A Chain A, Crystal Structure Of The Tlr1-tlr2 Heterodimer Induced By Binding Of A Tri-acylated Lipopeptide Length = 549 Back     alignment and structure
>pdb|2V9T|B Chain B, Complex Between The Second Lrr Domain Of Slit2 And The First Ig Domain From Robo1 Length = 220 Back     alignment and structure
>pdb|2V9T|B Chain B, Complex Between The Second Lrr Domain Of Slit2 And The First Ig Domain From Robo1 Length = 220 Back     alignment and structure
>pdb|4G8A|A Chain A, Crystal Structure Of Human Tlr4 Polymorphic Variant D299g And T399i In Complex With Md-2 And Lps Length = 635 Back     alignment and structure
>pdb|4G8A|A Chain A, Crystal Structure Of Human Tlr4 Polymorphic Variant D299g And T399i In Complex With Md-2 And Lps Length = 635 Back     alignment and structure
>pdb|2V9S|A Chain A, Second Lrr Domain Of Human Slit2 Length = 220 Back     alignment and structure
>pdb|2V9S|A Chain A, Second Lrr Domain Of Human Slit2 Length = 220 Back     alignment and structure
>pdb|3VQ1|A Chain A, Crystal Structure Of Mouse Tlr4MD-2LIPID IVA COMPLEX Length = 606 Back     alignment and structure
>pdb|3VQ1|A Chain A, Crystal Structure Of Mouse Tlr4MD-2LIPID IVA COMPLEX Length = 606 Back     alignment and structure
>pdb|2Z64|A Chain A, Crystal Structure Of Mouse Tlr4 And Mouse Md-2 Complex Length = 599 Back     alignment and structure
>pdb|2Z64|A Chain A, Crystal Structure Of Mouse Tlr4 And Mouse Md-2 Complex Length = 599 Back     alignment and structure
>pdb|2Z62|A Chain A, Crystal Structure Of The Tv3 Hybrid Of Human Tlr4 And Hagfish Vlrb.61 Length = 276 Back     alignment and structure
>pdb|3UL9|A Chain A, Structure Of The Tv3 Mutant M41e Length = 278 Back     alignment and structure
>pdb|3UL7|A Chain A, Crystal Structure Of The Tv3 Mutant F63w Length = 278 Back     alignment and structure
>pdb|3ULA|A Chain A, Crystal Structure Of The Tv3 Mutant F63w-Md-2-Eritoran Complex Length = 279 Back     alignment and structure
>pdb|3UL8|A Chain A, Crystal Structure Of The Tv3 Mutant V134l Length = 279 Back     alignment and structure
>pdb|1W8A|A Chain A, Third Lrr Domain Of Drosophila Slit Length = 192 Back     alignment and structure
>pdb|1W8A|A Chain A, Third Lrr Domain Of Drosophila Slit Length = 192 Back     alignment and structure
>pdb|2O6S|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B59 Length = 208 Back     alignment and structure
>pdb|2WFH|A Chain A, The Human Slit 2 Dimerization Domain D4 Length = 193 Back     alignment and structure
>pdb|3O53|A Chain A, Crystal Structure Of Lrim1 Leucine-Rich Repeat Domain Length = 317 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3E6J|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor (Vlr) Rbc36 In Complex With H-Trisaccharide Length = 229 Back     alignment and structure
>pdb|2XOT|A Chain A, Crystal Structure Of Neuronal Leucine Rich Repeat Protein Amigo-1 Length = 361 Back     alignment and structure
>pdb|3OJA|A Chain A, Crystal Structure Of Lrim1APL1C COMPLEX Length = 487 Back     alignment and structure
>pdb|3B2D|A Chain A, Crystal Structure Of Human Rp105MD-1 Complex Length = 603 Back     alignment and structure
>pdb|3V44|A Chain A, Crystal Structure Of The N-Terminal Fragment Of Zebrafish Tlr5 Length = 407 Back     alignment and structure
>pdb|4FHO|A Chain A, Crystal Structure Of An Internalin C2 (Inlc2) From Listeria Monocytogenes Str. 4b F2365 At 1.90 A Resolution Length = 231 Back     alignment and structure
>pdb|2Z7X|B Chain B, Crystal Structure Of The Tlr1-Tlr2 Heterodimer Induced By Binding Of A Tri-Acylated Lipopeptide Length = 520 Back     alignment and structure
>pdb|3A79|B Chain B, Crystal Structure Of Tlr2-Tlr6-Pam2csk4 Complex Length = 562 Back     alignment and structure
>pdb|2O6R|A Chain A, Structural Diversity Of The Hagfish Variable Lymphocyte Receptors B61 Length = 177 Back     alignment and structure
>pdb|1H6U|A Chain A, Internalin H: Crystal Structure Of Fused N-Terminal Domains Length = 308 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query694
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-55
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-45
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 7e-33
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-06
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-05
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-05
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-05
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-05
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-05
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-05
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-04
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-04
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-51
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-41
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-30
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-05
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 8e-05
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-04
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-04
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-50
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 8e-37
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-30
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 9e-24
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 3e-06
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 1e-05
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-05
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 1e-04
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 4e-04
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 5e-04
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 5e-04
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-49
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-43
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-41
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 6e-24
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 3e-06
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 1e-05
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 3e-04
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 3e-04
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 5e-04
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-48
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-41
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 8e-39
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 3e-29
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-19
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 8e-06
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 2e-04
2ft3_A 332 Biglycan; proteoglycan, dimer interface, structura 5e-04
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-47
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-44
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-43
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-05
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-04
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-46
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-44
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-41
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-28
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-20
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-11
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 2e-05
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 4e-05
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 5e-05
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 2e-04
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 4e-04
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 8e-46
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-31
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-31
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-06
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-05
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-05
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-05
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-04
1ozn_A 285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-04
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 7e-44
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 7e-43
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 6e-33
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-25
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 6e-22
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 4e-05
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 7e-05
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 9e-05
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-04
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 5e-04
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-43
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-43
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-41
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-41
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 3e-41
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-39
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-32
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-27
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-21
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 6e-05
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-04
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-04
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-04
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-04
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-04
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 9e-04
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-43
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-40
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-28
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-22
3o53_A 317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-04
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-43
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-42
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-41
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-39
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-39
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-38
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 8e-38
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-37
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 4e-29
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-26
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-09
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 9e-05
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-04
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-04
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-04
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-04
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-04
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 8e-43
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-16
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-15
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-10
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 9e-06
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-05
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 8e-04
2z80_A 353 TOLL-like receptor 2, variable lymphocyte recepto; 9e-04
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-41
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-38
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-35
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-32
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-31
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-27
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-27
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 2e-15
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-05
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-04
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-41
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-39
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-37
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-37
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-33
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-31
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-30
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-29
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-20
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-14
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 8e-05
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-04
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-04
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-04
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 7e-41
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-39
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-31
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-28
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 9e-16
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-04
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-39
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-37
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-33
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-31
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-29
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-20
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-04
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-04
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-04
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-04
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-38
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-38
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-35
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-34
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 6e-30
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-28
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-27
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-26
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-16
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-04
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-38
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 3e-36
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-34
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-31
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-30
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-13
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-36
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-25
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-19
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 9e-19
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-06
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-34
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 3e-34
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 7e-33
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-29
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-24
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-20
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 2e-04
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 8e-04
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-34
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-34
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-34
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-29
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-23
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-33
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-32
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-32
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-27
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-22
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-19
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-17
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-32
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 3e-28
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-19
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-19
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 6e-12
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-11
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-32
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-25
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-16
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 6e-32
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-31
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 7e-25
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-18
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-31
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 8e-26
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-14
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 6e-31
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 7e-29
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-29
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-29
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-28
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-20
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 6e-20
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 9e-29
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-19
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-28
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-24
1o6v_A466 Internalin A; bacterial infection, extracellular r 6e-23
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-18
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 8e-28
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-27
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-16
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-15
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-26
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 5e-26
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-22
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 7e-21
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-20
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 5e-15
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-12
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-12
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-11
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 9e-10
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-05
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-26
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-21
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 9e-21
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 9e-20
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-17
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-15
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-14
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-25
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-21
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-20
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-24
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-22
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 7e-21
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-05
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-05
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-04
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-24
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-22
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-21
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 4e-16
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 1e-23
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 3e-23
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 9e-18
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-23
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-21
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-17
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 9e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 6e-04
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-23
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-21
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-19
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 8e-18
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-04
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-23
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-18
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-18
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-16
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-15
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-13
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-22
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-21
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-15
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 9e-14
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-21
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-19
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-16
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-15
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-04
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-21
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-21
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 6e-15
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 8e-08
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-20
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-16
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-15
3m19_A251 Variable lymphocyte receptor A diversity region; a 4e-06
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 1e-20
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-16
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 6e-11
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-20
4ezg_A197 Putative uncharacterized protein; internalin-A, le 9e-20
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-19
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-18
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-18
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 6e-17
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-09
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-05
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-18
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-15
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-14
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-10
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 9e-18
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-14
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-09
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-17
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-17
3e6j_A229 Variable lymphocyte receptor diversity region; var 6e-16
3e6j_A229 Variable lymphocyte receptor diversity region; var 1e-09
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-09
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-09
3e6j_A229 Variable lymphocyte receptor diversity region; var 4e-09
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-15
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-14
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-11
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 7e-11
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-10
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 1e-10
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 2e-15
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-14
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-12
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-10
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 9e-09
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 2e-14
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 5e-11
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 9e-11
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 4e-10
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 1e-09
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-14
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-11
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-11
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-10
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-09
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-14
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 5e-13
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-12
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 6e-14
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-14
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-10
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-09
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 8e-14
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 9e-14
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 4e-13
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-12
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-10
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 5e-08
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 4e-05
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 6e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 5e-12
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-10
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-10
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 5e-10
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 1e-05
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-11
1w8a_A192 SLIT protein; signaling protein, secreted protein, 8e-11
1w8a_A192 SLIT protein; signaling protein, secreted protein, 3e-10
1w8a_A192 SLIT protein; signaling protein, secreted protein, 2e-09
1w8a_A192 SLIT protein; signaling protein, secreted protein, 4e-08
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 4e-11
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 8e-11
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 9e-06
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 7e-10
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 2e-09
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 1e-07
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 8e-07
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 3e-06
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 7e-08
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 7e-08
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 1e-06
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 8e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 6e-06
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 6e-06
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 2e-05
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 3e-05
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 2e-05
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 7e-05
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 2e-04
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 3e-04
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 6e-04
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 8e-04
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
 Score =  196 bits (500), Expect = 1e-55
 Identities = 83/326 (25%), Positives = 132/326 (40%), Gaps = 16/326 (4%)

Query: 55  SCPSIKNDLCACDLP-HTLRCTANKSDLYAISESLRGLEPDERVSLLDCTLSNVTVLPGK 113
            CP      C C      + C   +    A+ E +          LLD   + +  L   
Sbjct: 2   GCPP----RCECSAQDRAVLCHRKR--FVAVPEGI-----PTETRLLDLGKNRIKTLNQD 50

Query: 114 FLEGVT-LHGLVISSGELKNISDGAFIGLSSPLQALGLPNNLLSVVPTSALAPLAPNLDR 172
                  L  L ++   +  +  GAF  L + L+ LGL +N L ++P      L  NL +
Sbjct: 51  EFASFPHLEELELNENIVSAVEPGAFNNLFN-LRTLGLRSNRLKLIPLGVFTGL-SNLTK 108

Query: 173 LDLSHNQLYKLENTSFKGLSSLNFLDLSYNKLMTLSQDCLAPLVTLRVLRLQGNRLTVSV 232
           LD+S N++  L +  F+ L +L  L++  N L+ +S    + L +L  L L+   LT   
Sbjct: 109 LDISENKIVILLDYMFQDLYNLKSLEVGDNDLVYISHRAFSGLNSLEQLTLEKCNLTSIP 168

Query: 233 VAALQGLRSVTDLDLSHNLLAGPLGPSTVPRLSSLKVLSIAHNQFSSVRRGALAGLDKLT 292
             AL  L  +  L L H  +   +   +  RL  LKVL I+H  +             LT
Sbjct: 169 TEALSHLHGLIVLRLRHLNINA-IRDYSFKRLYRLKVLEISHWPYLDTMTPNCLYGLNLT 227

Query: 293 SLSCHHNQIDVLEDHSFRALSTLSHLDLAHNRIVAVSGASLAHLSNLTTLDLSHNFLRAL 352
           SLS  H  +  +   + R L  L  L+L++N I  + G+ L  L  L  + L    L  +
Sbjct: 228 SLSITHCNLTAVPYLAVRHLVYLRFLNLSYNPISTIEGSMLHELLRLQEIQLVGGQLAVV 287

Query: 353 TQDLITPLKSLQELRLDDNDISMEPE 378
                  L  L+ L +  N ++   E
Sbjct: 288 EPYAFRGLNYLRVLNVSGNQLTTLEE 313


>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Length = 267 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Length = 185 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query694
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 100.0
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.98
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.98
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 99.98
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 99.97
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.97
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 99.97
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.97
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.96
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.96
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.96
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 99.96
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.96
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 99.96
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 99.96
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.96
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 99.96
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.96
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.96
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 99.96
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.96
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.96
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 99.96
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.95
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.95
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.95
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 99.95
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.95
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.95
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 99.95
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.95
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 99.95
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 99.95
1o6v_A466 Internalin A; bacterial infection, extracellular r 99.95
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.95
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.94
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.94
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.94
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.94
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.94
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.93
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.93
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.93
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.92
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.92
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.92
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.92
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.92
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.92
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.92
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 99.92
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.91
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.91
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.91
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.91
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.9
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 99.9
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.9
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.89
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.89
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.89
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.89
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.88
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.88
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.88
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.88
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.87
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.87
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.86
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.86
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.86
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.86
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.86
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.85
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.84
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.83
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.83
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.83
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.82
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.82
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.81
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.81
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.81
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.8
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.79
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.79
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 99.78
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.78
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.78
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.78
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.77
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.77
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.77
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.76
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.75
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 99.75
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.73
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.72
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.72
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.71
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.71
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.69
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.69
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.69
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.68
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.66
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.65
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.65
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.64
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.64
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.64
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.63
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.62
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.61
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.6
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.59
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.58
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.58
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.56
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.53
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.52
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.5
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.49
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.47
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.46
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.46
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.45
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.41
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.39
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.38
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.35
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.31
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.21
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.19
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.16
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 98.7
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.68
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.56
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.15
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.14
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.0
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.8
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.6
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.55
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 96.76
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 96.69
4fa8_A203 Secreted protein BARF1; immunoglobulin-like domain 96.67
2qsq_A111 Carcinoembryonic antigen-related cell adhesion MO; 96.42
3knb_A100 Titin; IG-like, titin, OBSL1, ATP-binding, calmodu 96.42
3knb_B107 Obscurin-like protein 1; IG-like, titin, OBSL1, AT 96.17
1g1c_A99 Immunoglobulin-like domain I1 from titin; immunogl 96.03
2kkq_A116 Myotilin; unknown function, actin-binding, cell me 95.93
2edj_A100 Roundabout homolog 2; KIAA1568 protein, beta sandw 95.84
3caf_A100 Fibroblast growth factor receptor 2; FGFR2, D2, AT 95.76
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 95.75
1wit_A93 Twitchin 18TH IGSF module; immunoglobulin superfam 95.73
1wwb_X103 Protein (brain derived neurotrophic factor recepto 95.71
2dlt_A106 Myosin binding protein C, fast-type; IG-like domai 95.7
3so5_A112 LIG-3, leucine-rich repeats and immunoglobulin-lik 95.68
1he7_A126 High affinity nerve growth factor receptor; transf 95.63
2eo9_A118 Roundabout homolog 1; beta-sandwich, IG-fold, H-RO 95.55
3irg_A100 Titin; IG-like, titin, OBSL1, complex, alternative 95.51
3irg_B107 Obscurin-like protein 1; IG-like, titin, OBSL1, co 95.51
1waa_A93 Titin; metal binding protein, calmodulin-binding, 95.43
2kdg_A100 Myotilin; immonoglobulin domain, actin-binding, st 95.4
2cqv_A114 MLCK, myosin light chain kinase, smooth muscle and 95.33
2yr3_A99 Myosin light chain kinase, smooth muscle; IG domai 95.28
3puc_A99 Titin; I-SET IG-like domain, M-BAND, transferase; 95.26
1u2h_A99 APEG-1, aortic preferentially expressed protein 1; 95.24
3s35_X122 Vascular endothelial growth factor receptor 2; ant 95.23
2dm2_A110 Palladin; beta-sandwich, KIAA0992, actin-associate 95.19
3kvq_A108 Vascular endothelial growth factor receptor 2; veg 95.18
2ckn_A95 Basic fibroblast growth factor receptor 1; kinase, 95.17
3qp3_A103 Titin; I-SET IG-like, sarcomere, M-BAND, transfera 95.11
2dm3_A110 KIAA0992 protein, palladin; beta-sandwich, myopall 95.05
1wwc_A118 Protein (NT-3 growth factor receptor TRKC); TRK re 95.0
2v9t_A117 Roundabout homolog 1; structural protein-receptor 94.79
1fhg_A154 Telokin; immunoglobulin fold, beta barrel, contrac 94.73
1nct_A106 Titin; cell adhesion, glycoprotein, transmembrane, 94.69
4hwu_A95 Fibroblast growth factor receptor 2; FGFR2, KGFR, 94.67
3rbg_A124 Cytotoxic and regulatory T-cell molecule; IGV, crt 94.58
1gxe_A139 Myosin binding protein C, cardiac-type; cytoskelet 94.53
2e7c_A118 Myosin-binding protein C, fast-type; IG-like domai 94.46
2dm7_A108 KIAA1556 protein; beta-sandwich, IG-fold, obscurin 94.4
3m45_A108 Cell adhesion molecule 2; IG fold, dimer, disulfid 94.39
2cr3_A99 Basic fibroblast growth factor receptor 1; IG fold 94.17
2yuz_A100 Myosin-binding protein C, SLOW-type; immunoglobuli 94.16
1gl4_B98 Basement membrane-specific heparan sulfate proteog 94.16
2bk8_A97 Connectin, M1, titin heart isoform N2-B; IG domain 94.06
1x44_A103 Myosin-binding protein C, SLOW-type; IG-like domai 93.76
2lvc_A91 Obscurin-like protein 1; structural genomics, nort 93.73
3cx2_A108 Myosin-binding protein C, cardiac-type; protonatio 93.64
3qr2_A137 Basigin; CD147, EMMPRIN, immunoglobulin-like domai 93.46
4gos_A125 V-SET domain-containing T-cell activation inhibit; 93.39
2dav_A126 SLOW MYBP-C, myosin-binding protein C, SLOW-type; 93.02
2a38_A194 Titin; Z1Z2, structural protein; 2.00A {Homo sapie 92.89
2eny_A104 Obscurin; beta-sandwich, IG-fold, structural genom 92.73
2v44_A189 NCAM2, neural cell adhesion molecule 2; phosphoryl 92.55
1eaj_A126 Coxsackie virus and adenovirus receptor; virus/vir 92.49
3p2t_A196 Leukocyte immunoglobulin-like receptor subfamily 4 92.45
1pd6_A104 Cardiac MYBP-C;, myosin-binding protein C, cardiac 92.33
2yuv_A100 Myosin-binding protein C, SLOW-type; SLOW-type myo 92.31
2x1w_L213 Vascular endothelial growth factor receptor 2; hor 92.29
2edf_A103 Obscurin; beta-sandwich, IG-fold, structural genom 92.27
2vr9_A217 Roundabout 1, ROBO; immunoglobulin-like domain, AX 92.25
2r15_A212 Myomesin-1; sarcomeric protein, IG-like domains, h 92.17
2iep_A192 Muscle-specific kinase receptor; beta-sandwich, si 92.02
3bfo_A91 Mucosa-associated lymphoid tissue lymphoma translo 92.01
2cpc_A113 KIAA0657 protein; immunoglobulin domain, IG domain 92.0
3rbs_A207 Myomesin-1; immunoglobulin C-SET domain, contractI 92.0
2yd6_A212 PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa 91.91
3ejj_X289 Macrophage colony-stimulating factor 1 receptor; g 91.81
2edh_A113 Obscurin; structural genomics, NPPSFA, national pr 91.79
2ny1_B184 T-cell surface glycoprotein CD4; HIV, GP120, CD4, 91.74
4f80_A226 Butyrophilin subfamily 3 member A1; B7 superfamily 91.69
2v5t_A189 NCAM2, N-CAM 2, neural cell adhesion molecule 2; p 91.58
2fbo_J250 V1V2;, variable region-containing chitin-binding p 91.53
1qz1_A291 Neural cell adhesion molecule 1, 140 kDa isoform; 91.53
4frw_A218 Poliovirus receptor-related protein 4; immunoglobu 91.49
2cry_A122 KIN of IRRE-like protein 3; IG fold, KIN of irregu 91.49
2eo1_A102 OBSCN protein, cDNA FLJ14124 FIS, clone mamma10024 91.45
3mtr_A215 N-CAM-1, NCAM-1, neural cell adhesion molecule 1; 91.41
2va4_A192 NCAM2, N-CAM 2, neural cell adhesion molecule 2; t 91.31
1ncn_A110 T lymphocyte activation antigen CD86; IG V, beta s 91.27
2edn_A118 Myosin-binding protein C, fast-type; beta-sandwich 91.21
2j8h_A197 Titin, connectin; cardiomyopathy, nuclear protein, 91.2
1hng_A176 CD2; T lymphocyte adhesion glycoprotein; 2.80A {Ra 91.14
3r4d_A208 CEA-related cell adhesion molecule 1, isoform 1/2; 91.1
2edk_A101 Myosin-binding protein C, fast-type; IG fold, fast 91.0
1epf_A191 NCAM, protein (neural cell adhesion molecule); imm 90.89
3r4d_A208 CEA-related cell adhesion molecule 1, isoform 1/2; 90.78
2yd1_A212 Tyrosine-protein phosphatase LAR; hydrolase; 1.80A 90.76
4fqp_A313 Poliovirus receptor; immunoglobulin-like domain, I 90.72
3lcy_A197 Titin; A-BAND, IG tandem domains, ATP-binding, cal 90.7
2lu7_A84 Obscurin-like protein 1; structural genomics, nort 90.59
3kld_A384 Contactin 4, axcam, BIG-2; cell adhesion, protein 90.55
2jll_A 389 NCAM2, neural cell adhesion molecule 2; immunoglob 90.47
1z9m_A145 GAPA225; nectin-like, IG-like domain, V domain, ce 90.4
1pko_A139 Myelin oligodendrocyte glycoprotein; IGV-domain, i 90.37
2y25_A317 Myomesin; structural protein, sarcomere, M-BAND, i 90.33
1jbj_A186 CD3 epsilon and gamma ectodomain fragment complex; 90.24
1ugn_A198 LIR1, leukocyte immunoglobulin-like receptor 1; im 90.17
3mjg_X289 Beta-type platelet-derived growth factor receptor; 90.14
2o26_X290 MAST/stem cell growth factor receptor; stem cell f 90.1
2wim_A291 N-CAM 2, NCAM2, neural cell adhesion molecule 2; c 90.1
2e6p_A104 Obscurin-like protein 1; IG-like domain, structura 90.07
3udw_C118 Poliovirus receptor; PVR tigit IGSF signal transdu 90.02
2yd6_A212 PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sa 89.94
2ens_A96 Advanced glycosylation END product-specific recept 89.82
3s97_C201 Contactin-1; carbonic anhdyrase like immunoglobuli 89.74
3mj6_A268 Junctional adhesion molecule-like; immunoglobulin 89.71
4dkd_C292 Macrophage colony-stimulating factor 1 receptor; d 89.6
2nzi_A305 Titin; IG-domain, FNIII-domain, transferase; 2.90A 89.48
4gjt_B123 Poliovirus receptor-related protein 4; six-bladed 89.42
1hnf_A182 CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 89.4
3ojm_B231 Fibroblast growth factor receptor 2; beta trefoil 89.36
3jz7_A214 MCAR, CAR, coxsackievirus and adenovirus receptor 89.35
3p2t_A196 Leukocyte immunoglobulin-like receptor subfamily 4 89.28
3q0h_A117 T cell immunoreceptor with IG and ITIM domains; im 89.24
1epf_A191 NCAM, protein (neural cell adhesion molecule); imm 89.15
3laf_A403 Deleted in colorectal cancer; netrin-1 receptor, i 89.13
1h5b_A113 Murine T cell receptor (TCR) valpha domain; immune 89.09
1oll_A188 NK receptor; immune system/receptor, NK cell trigg 89.01
3grw_A241 Fibroblast growth factor receptor 3; FGFR3, protei 88.88
1vca_A202 VCAM-D1,2, human vascular cell adhesion molecule-1 88.83
2k1m_A95 Myosin-binding protein C, cardiac-type; IG-I domai 88.77
3eow_R221 Poliovirus receptor; immunoglobulin super family, 88.72
2dku_A103 KIAA1556 protein; beta-sandwich, IG-fold, obscurin 88.7
2v5t_A189 NCAM2, N-CAM 2, neural cell adhesion molecule 2; p 88.66
2d3v_A196 Leukocyte immunoglobulin-like receptor subfamily A 88.65
4f80_A226 Butyrophilin subfamily 3 member A1; B7 superfamily 88.51
3ojm_B231 Fibroblast growth factor receptor 2; beta trefoil 88.45
3kld_A384 Contactin 4, axcam, BIG-2; cell adhesion, protein 88.4
2rik_A284 Titin; I-SET IG fold, poly-IG linear array, struct 88.26
1cs6_A382 Axonin-1; neural cell adhesion, cell adhesion; 1.8 88.25
2pet_A231 Lutheran blood group glycoprotein; immunoglobulin 88.17
3sgj_C204 Human FCG3A receptor; receptor complex, FC recepto 88.11
4i0k_A222 CD276 antigen; immunoglobulin domain, glycoprotein 88.09
1itb_B315 Type 1 interleukin-1 receptor; immunoglobulin fold 88.07
2c5d_C195 AXL oncogene, tyrosine-protein kinase receptor UFO 88.06
3b5h_A184 Cervical EMMPRIN, HAB18G/CD147; IG-like domain, ce 88.02
2wv3_A190 Neuroplastin; igcam, membrane, glycoprotein, cell 87.94
2x1w_L213 Vascular endothelial growth factor receptor 2; hor 87.88
3bp6_B202 Programmed cell death 1 ligand 2; PD-1, PD-L2, com 87.88
3grw_A241 Fibroblast growth factor receptor 3; FGFR3, protei 87.78
2j8h_A197 Titin, connectin; cardiomyopathy, nuclear protein, 87.72
2va4_A192 NCAM2, N-CAM 2, neural cell adhesion molecule 2; t 87.64
1fnl_A175 Low affinity immunoglobulin gamma FC region recept 87.58
2e7b_A103 Obscurin; IG-like domain, structural genomics, NPP 87.48
1jhl_L108 IGG1-kappa D11.15 FV (light chain); complex(antibo 87.44
3lcy_A197 Titin; A-BAND, IG tandem domains, ATP-binding, cal 87.44
2yd1_A212 Tyrosine-protein phosphatase LAR; hydrolase; 1.80A 87.41
2jjs_C127 Leukocyte surface antigen CD47; signal regulatory 87.4
3ry4_A170 Low affinity immunoglobulin gamma FC region recep; 87.31
1bih_A395 Hemolin; insect immunity, LPS-binding, homophilic 87.31
2cr6_A115 KIAA1556 protein, obscurin; IG-fold, immunoglobuli 87.29
2if7_A193 SLAM family member 6; NTB-A, homophilic receptor, 87.29
2oyp_A109 Hepatitis A virus cellular receptor 2; TIM-3, T-ce 87.21
2yd9_A304 Receptor-type tyrosine-protein phosphatase S; hydr 87.2
2ywz_A111 NEW antigen receptor variable domain; IG VNAR, imm 87.09
3sbw_C222 Programmed cell death 1 ligand 1; PD-1, PD-L1, B7- 86.98
2v9r_A212 Roundabout homolog 1; proto-oncogene, differentiat 86.91
3nl4_L213 Antigen binding fragment, immunoglobulin IGG - LI; 86.87
2y23_A312 Myomesin; structural protein, sarcomere, M-BAND, i 86.78
1f97_A212 Junction adhesion molecule; immunoglobulin superfa 86.76
2a38_A194 Titin; Z1Z2, structural protein; 2.00A {Homo sapie 86.7
3rbs_A207 Myomesin-1; immunoglobulin C-SET domain, contractI 86.67
2edo_A121 CD48 antigen; beta-sandwich, IG-fold, B-lymphocyte 86.64
2gi7_A184 GPVI protein; IG-like domains, blood clotting, cel 86.63
3bp6_B202 Programmed cell death 1 ligand 2; PD-1, PD-L2, com 86.55
3vh8_G316 Killer cell immunoglobulin-like receptor 3DL1; imm 86.53
2gi7_A184 GPVI protein; IG-like domains, blood clotting, cel 86.49
2v44_A189 NCAM2, neural cell adhesion molecule 2; phosphoryl 86.17
2oz4_A265 Intercellular adhesion molecule 1; IGSF domain, st 86.16
3r08_E82 T-cell surface glycoprotein CD3 epsilon chain; ant 86.08
3pv7_A248 B7-H6, IG-like domain-containing protein DKFZP686O 86.08
3p3y_A404 Neurofascin; IG domains, cell adhesion; HET: NAG; 86.04
4hwn_A108 FC receptor-like A; FCRLA, FCRL, IG-C2 domain, IG 85.96
1dr9_A201 B7-1 (CD80), T lymphocyte activation antigen; IG s 85.85
4fmk_A225 Poliovirus receptor-related protein 2; immunoglobu 85.84
4fom_A308 Poliovirus receptor-related protein 3; immunoglobu 85.65
4fa8_A203 Secreted protein BARF1; immunoglobulin-like domain 85.6
1jbj_A186 CD3 epsilon and gamma ectodomain fragment complex; 85.53
1neu_A124 Myelin P0 protein; structural protein, glycoprotei 85.52
1f2q_A176 High affinity immunoglobulin epsilon receptor ALP 85.49
2ptt_A110 CD48 antigen; CD244, CD48, NK cell receptor, X-RAY 85.46
2vsd_A105 CHIR AB1; immune system receptor, FC receptor; HET 85.38
2wv3_A190 Neuroplastin; igcam, membrane, glycoprotein, cell 85.02
4fmk_A225 Poliovirus receptor-related protein 2; immunoglobu 85.0
2e6q_A112 Obscurin-like protein 1; IG-like domain, structura 84.89
2c5d_C195 AXL oncogene, tyrosine-protein kinase receptor UFO 84.83
3u83_A331 Poliovirus receptor-related protein 1; nectin-1, h 84.81
3r0n_A128 Poliovirus receptor-related protein 2; IG-domain, 84.76
1xt5_A135 Variable region-containing chitin-binding protein 84.66
1nkr_A201 P58-CL42 KIR; inhibitory receptor, natural killer 84.54
2d3v_A196 Leukocyte immunoglobulin-like receptor subfamily A 84.53
3r06_A213 Anti-mouse CD3epsilon antibody 2C11 FAB light CHA; 84.48
3qs7_E423 FL cytokine receptor; immunoglobulin-like domain, 84.47
1qz1_A291 Neural cell adhesion molecule 1, 140 kDa isoform; 84.36
1rhf_A182 Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 84.33
1sy6_A204 T-cell surface glycoprotein CD3 gamma/epsilon chai 84.32
3jz7_A214 MCAR, CAR, coxsackievirus and adenovirus receptor 84.3
1qfw_M108 FV, antibody (anti beta subunit) (light chain); gl 84.22
2pnd_A119 V-SET and immunoglobulin domain containing 4; comp 84.22
1pew_A109 JTO2, A lambda-6 type immunoglobulin light chain, 84.05
3sgj_C204 Human FCG3A receptor; receptor complex, FC recepto 83.98
3tv3_L211 PGT128 light chain, IG lambda-2 chain C regions; F 83.94
4i0k_A222 CD276 antigen; immunoglobulin domain, glycoprotein 83.77
3o4o_C339 Interleukin-1 receptor type 2; cytokine-receptor c 83.7
1u3h_A110 T-cell receptor alpha-chain; complex, immune syste 84.18
3s97_C201 Contactin-1; carbonic anhdyrase like immunoglobuli 83.65
2coq_A108 NEW antigen receptor variable domain; IG VNAR, nat 83.62
2yd9_A304 Receptor-type tyrosine-protein phosphatase S; hydr 83.6
1rhf_A182 Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 83.52
2dru_A180 Chimera of CD48 antigen and T-cell surface antige; 83.51
3qs9_E527 FL cytokine receptor; immunoglobulin-like domain, 83.46
1nbq_A209 JAM, junctional adhesion molecule 1, PAM-1; reovir 83.34
3qs7_E423 FL cytokine receptor; immunoglobulin-like domain, 83.27
2d9c_A136 Signal-regulatory protein beta-1; beta-sandwich, S 83.26
1hng_A176 CD2; T lymphocyte adhesion glycoprotein; 2.80A {Ra 83.08
3mjg_X289 Beta-type platelet-derived growth factor receptor; 83.03
3laf_A403 Deleted in colorectal cancer; netrin-1 receptor, i 82.99
3mj6_A268 Junctional adhesion molecule-like; immunoglobulin 82.95
2ocw_A585 Polymeric-immunoglobulin receptor; SC, secretory, 82.86
2rik_A284 Titin; I-SET IG fold, poly-IG linear array, struct 82.81
1oaq_L120 Light chain; antibody, allergy, IGE, conformationa 82.74
1dr9_A201 B7-1 (CD80), T lymphocyte activation antigen; IG s 82.73
2v5m_A388 Dscam; neurobiology SPL immunoglobulin domain, cel 82.72
3k0w_A218 Mucosa-associated lymphoid tissue lymphoma translo 82.7
2v9r_A212 Roundabout homolog 1; proto-oncogene, differentiat 82.57
2vr9_A217 Roundabout 1, ROBO; immunoglobulin-like domain, AX 82.33
2r15_A212 Myomesin-1; sarcomeric protein, IG-like domains, h 82.21
3tf7_C256 42F3 MUT7 SCFV (42F3 alpha chain, linker, 42F3 BE; 82.13
1xiw_B79 T-cell surface glycoprotein CD3 delta chain; CD3-e 81.86
2jju_A127 Signal regulatory protein beta-1; immunoglobulin d 81.74
1nkr_A201 P58-CL42 KIR; inhibitory receptor, natural killer 81.61
1p6f_A242 NKP46, natural cytotoxicity triggering receptor 1; 81.46
2or8_A116 Hepatitis A virus cellular receptor 1 homolog; bet 81.43
1ry7_B334 FGFR-3, fibroblast growth factor receptor 3; FGF-F 81.42
2q20_A109 VK1 O18/O8 germline light chain variable domain; A 81.25
3d9a_L213 Light chain of hyhel10 antibody fragment (FAB); ly 81.19
1ry7_B334 FGFR-3, fibroblast growth factor receptor 3; FGF-F 81.14
1pz5_B220 Heavy chain of FAB (SYA/J6); antibody-antigen stru 81.09
3pl6_D268 MBP peptide / T-cell receptor beta chain chimera; 81.05
2xzc_L216 FAB A.17 light chain; immune system; HET: XOP; 1.3 81.04
3khq_A133 B-cell antigen receptor complex-associated protei 80.93
1uct_A218 Immunoglobulin alpha FC receptor; beta stands, imm 80.82
2y25_A317 Myomesin; structural protein, sarcomere, M-BAND, i 80.76
3moq_A126 NEW antigen receptor variable domain, P3(40) PEPT 80.76
1f97_A212 Junction adhesion molecule; immunoglobulin superfa 80.74
2jll_A389 NCAM2, neural cell adhesion molecule 2; immunoglob 80.72
2iep_A192 Muscle-specific kinase receptor; beta-sandwich, si 80.68
1tvd_A116 T cell receptor, ES204 V delta; immunoreceptor, TC 80.59
3mj8_L213 Stimulatory hamster antibody HL4E10 FAB light CHA; 80.46
2p1y_A238 Bispecific alpha/beta TCR; autoimmunity, immunoglo 80.32
4dep_C349 Interleukin-1 receptor accessory protein; B-trefoi 80.29
3auv_A276 SC-DSFV derived from the G6-FAB; SC-DSFV (disulfid 80.28
2e27_L119 Anti-ciguatoxin antibody, light chain; immunoglobu 80.22
2wim_A291 N-CAM 2, NCAM2, neural cell adhesion molecule 2; c 80.21
3bdb_A137 Novel immune-type receptor 11; immunoglobulin vari 80.08
3tf7_C256 42F3 MUT7 SCFV (42F3 alpha chain, linker, 42F3 BE; 80.07
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
Probab=100.00  E-value=2.3e-44  Score=403.39  Aligned_cols=430  Identities=24%  Similarity=0.297  Sum_probs=345.5

Q ss_pred             CCCCCCCCCCCCCC-CCcEEEccCCCchhhhhhhcCCCCCCCCeeEEEcCCCCCCCCC-ccccCCCCccEEEccCCCCCC
Q psy8879          55 SCPSIKNDLCACDL-PHTLRCTANKSDLYAISESLRGLEPDERVSLLDCTLSNVTVLP-GKFLEGVTLHGLVISSGELKN  132 (694)
Q Consensus        55 ~Cp~~~~~~C~C~~-~~~v~C~~~~~~l~~i~~~L~~l~~~~~L~~Ldls~n~l~~lp-~~~~~~~~L~~L~Ls~n~i~~  132 (694)
                      .||.    .|.|.. ...+.|...  .+..+|..+.     ..++.|++++|+++.++ ..|..+++|++|++++|.++.
T Consensus         2 ~Cp~----~C~C~~~~~~v~c~~~--~l~~ip~~~~-----~~l~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~n~i~~   70 (477)
T 2id5_A            2 GCPP----RCECSAQDRAVLCHRK--RFVAVPEGIP-----TETRLLDLGKNRIKTLNQDEFASFPHLEELELNENIVSA   70 (477)
T ss_dssp             CCST----TCEEETTTTEEECCSC--CCSSCCSCCC-----TTCSEEECCSSCCCEECTTTTTTCTTCCEEECTTSCCCE
T ss_pred             cccC----CCeECCCCCEEEeCCC--CcCcCCCCCC-----CCCcEEECCCCccceECHhHccCCCCCCEEECCCCccCE
Confidence            5888    899964 357888653  4666676543     38999999999998884 578889999999999999999


Q ss_pred             CCcchhcCCCCCccEEEccCCCCCCCCccccccCCCCccEEEccCCCCCCCCcccccCCCCccEEEecCCCCCCCCcccc
Q psy8879         133 ISDGAFIGLSSPLQALGLPNNLLSVVPTSALAPLAPNLDRLDLSHNQLYKLENTSFKGLSSLNFLDLSYNKLMTLSQDCL  212 (694)
Q Consensus       133 i~~~~F~~l~~~L~~L~Ls~N~L~~lp~~~~~~l~~~L~~L~Ls~N~L~~i~~~~f~~L~~L~~L~Ls~N~l~~i~~~~f  212 (694)
                      +.+.+|.++. +|++|+|++|.++.++...|.++ ++|++|+|++|.++.+.+..|.++++|++|++++|.+.++.+..|
T Consensus        71 ~~~~~~~~l~-~L~~L~L~~n~l~~~~~~~~~~l-~~L~~L~Ls~n~i~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~  148 (477)
T 2id5_A           71 VEPGAFNNLF-NLRTLGLRSNRLKLIPLGVFTGL-SNLTKLDISENKIVILLDYMFQDLYNLKSLEVGDNDLVYISHRAF  148 (477)
T ss_dssp             ECTTTTTTCT-TCCEEECCSSCCCSCCTTSSTTC-TTCCEEECTTSCCCEECTTTTTTCTTCCEEEECCTTCCEECTTSS
T ss_pred             eChhhhhCCc-cCCEEECCCCcCCccCcccccCC-CCCCEEECCCCccccCChhHccccccCCEEECCCCccceeChhhc
Confidence            9888888876 49999999999999999889999 999999999999999998999999999999999999999999999


Q ss_pred             CCCCCCcEEeccCCcccchhhhhhccCcccccccCCCCcCCCCCCCCCCCCccccceeeccCCcccccccccccCCcccc
Q psy8879         213 APLVTLRVLRLQGNRLTVSVVAALQGLRSVTDLDLSHNLLAGPLGPSTVPRLSSLKVLSIAHNQFSSVRRGALAGLDKLT  292 (694)
Q Consensus       213 ~~L~~L~~L~Ls~N~l~~~~~~~~~~L~~L~~L~Ls~N~l~~~i~p~~~~~l~~L~~L~Ls~N~L~~i~~~~~~~L~~L~  292 (694)
                      ..+++|++|++++|++++..+..+.++++|+.|++++|.+.+ +.+..+..+++|+.|++++|.+.+..+.......+|+
T Consensus       149 ~~l~~L~~L~l~~n~l~~~~~~~l~~l~~L~~L~l~~n~i~~-~~~~~~~~l~~L~~L~l~~~~~~~~~~~~~~~~~~L~  227 (477)
T 2id5_A          149 SGLNSLEQLTLEKCNLTSIPTEALSHLHGLIVLRLRHLNINA-IRDYSFKRLYRLKVLEISHWPYLDTMTPNCLYGLNLT  227 (477)
T ss_dssp             TTCTTCCEEEEESCCCSSCCHHHHTTCTTCCEEEEESCCCCE-ECTTCSCSCTTCCEEEEECCTTCCEECTTTTTTCCCS
T ss_pred             cCCCCCCEEECCCCcCcccChhHhcccCCCcEEeCCCCcCcE-eChhhcccCcccceeeCCCCccccccCcccccCcccc
Confidence            999999999999999998888889999999999999999986 5577899999999999999876554444444556899


Q ss_pred             eecccCCccccccchhhhcccccccccCCCCccccccccchhcccccCeeecCCCCCCCcChhhhCCCCCCCEEEccCCC
Q psy8879         293 SLSCHHNQIDVLEDHSFRALSTLSHLDLAHNRIVAVSGASLAHLSNLTTLDLSHNFLRALTQDLITPLKSLQELRLDDND  372 (694)
Q Consensus       293 ~L~Ls~N~L~~i~~~~f~~l~~L~~L~Ls~N~L~~i~~~~f~~l~~L~~L~Ls~N~L~~l~~~~~~~l~~L~~L~Ls~N~  372 (694)
                      +|++++|+++.++...|..+++|+.|+|++|+++++.+..|.++++|+.|+|++|+++++.+..|..+++|+.|+|++|+
T Consensus       228 ~L~l~~n~l~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~L~~N~  307 (477)
T 2id5_A          228 SLSITHCNLTAVPYLAVRHLVYLRFLNLSYNPISTIEGSMLHELLRLQEIQLVGGQLAVVEPYAFRGLNYLRVLNVSGNQ  307 (477)
T ss_dssp             EEEEESSCCCSCCHHHHTTCTTCCEEECCSSCCCEECTTSCTTCTTCCEEECCSSCCSEECTTTBTTCTTCCEEECCSSC
T ss_pred             EEECcCCcccccCHHHhcCccccCeeECCCCcCCccChhhccccccCCEEECCCCccceECHHHhcCcccCCEEECCCCc
Confidence            99999999999988889999999999999999999988889999999999999999999988889999999999999999


Q ss_pred             CCCCCccccc----------CCCC--CCcccccccccccccccCCccCccccCCcccc---------------eeeEEEE
Q psy8879         373 ISMEPECIYV----------GFNT--MDLELIYSGVWRHSTLLIPVMLSLCTRSSVVT---------------RYRYCVV  425 (694)
Q Consensus       373 L~~l~~~~f~----------~~Np--CdC~l~~~~~wl~~~~~~~~~~~~C~~~~~~~---------------~~~~~~v  425 (694)
                      ++.+++..|.          .+||  |||.+.|+..|.... ......+.|..+....               ..+..+.
T Consensus       308 l~~~~~~~~~~l~~L~~L~l~~N~l~c~c~~~~~~~~~~~~-~~~~~~~~C~~p~~~~g~~l~~~~~~~~~~~~~C~~P~  386 (477)
T 2id5_A          308 LTTLEESVFHSVGNLETLILDSNPLACDCRLLWVFRRRWRL-NFNRQQPTCATPEFVQGKEFKDFPDVLLPNYFTCRRAR  386 (477)
T ss_dssp             CSCCCGGGBSCGGGCCEEECCSSCEECSGGGHHHHTTTTSS-CCTTCCCBEEESGGGTTCBGGGSCSSCCTTSSCCEEEE
T ss_pred             CceeCHhHcCCCcccCEEEccCCCccCccchHhHHhhhhcc-ccCccCceeCCchHHcCCchhhCccccccceeEecccc
Confidence            9999887764          6888  999999998886521 1223345665532111               1122222


Q ss_pred             EeecC----ccccceeeeeceeE-------EEEeccCccccccceeEeeeeEEecccEE-EEEEEecCCCcceeEEEEEe
Q psy8879         426 LIEGS----NILDQSALVLGCSE-------ILALVPTLTSQPLSYVTSLRANVTGLGTV-QVYVQLWTNYDPNCLLTITL  493 (694)
Q Consensus       426 ~~~~~----~~~~~~~~~l~c~~-------i~~l~~~~~~~~~~~i~~~~~n~~~~gtL-~~~v~~~d~G~YtC~~~n~~  493 (694)
                      .....    ...++..+.+.|.+       +.|....+.....  ....++.+..+|+| |.+|+.+|+|.|+|+|+|..
T Consensus       387 i~~~~~~~~~v~~G~~v~l~C~~~g~P~p~i~W~~~~~~~~~~--~~~~~~~~~~~~~L~i~~v~~~d~G~Y~C~a~N~~  464 (477)
T 2id5_A          387 IRDRKAQQVFVDEGHTVQFVCRADGDPPPAILWLSPRKHLVSA--KSNGRLTVFPDGTLEVRYAQVQDNGTYLCIAANAG  464 (477)
T ss_dssp             ESCCSCEEEEEETTCCEEECCCEEEESCCEEEEECTTSCBC---------CEECTTSCEEESSCCSTTCEEEEEEEEETT
T ss_pred             ccccccccEEEeCCCeEEEEEeccccCCCEEEEEECCcccccc--CCCceEEeCCCCEEEEeeCChHHCEEEEEEEEeCC
Confidence            22211    23344556677766       5666655444311  13446667778888 99999999999999999998


Q ss_pred             eeccceeE
Q psy8879         494 YIDGDVIV  501 (694)
Q Consensus       494 ~~~~~~~~  501 (694)
                      +.+...+.
T Consensus       465 g~~~~~~~  472 (477)
T 2id5_A          465 GNDSMPAH  472 (477)
T ss_dssp             EEEEEEEE
T ss_pred             CcEEEEEE
Confidence            87755544



>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>4fa8_A Secreted protein BARF1; immunoglobulin-like domains, 4-helix bundle fold, viral PROT cytokine complex; HET: NAG BMA; 2.20A {Human herpesvirus 4} PDB: 2ch8_A* 3uez_A* 4adf_A* 4adq_A* Back     alignment and structure
>2qsq_A Carcinoembryonic antigen-related cell adhesion MO; glycoprotein, GPI-anchor, immunoglobulin DOMA lipoprotein, membrane; 1.95A {Homo sapiens} PDB: 2qst_A 2ver_N* 2gk2_A Back     alignment and structure
>3knb_A Titin; IG-like, titin, OBSL1, ATP-binding, calmodulin-BIN cardiomyopathy, disease mutation, immunoglobulin domain; 1.40A {Homo sapiens} PDB: 3q5o_A 2wp3_T* 2wwk_T 2wwm_D 2y9r_T* Back     alignment and structure
>3knb_B Obscurin-like protein 1; IG-like, titin, OBSL1, ATP-binding, calmodulin-BIN cardiomyopathy, disease mutation, immunoglobulin domain; 1.40A {Homo sapiens} PDB: 2wp3_O* 2wwm_C 2wwk_O Back     alignment and structure
>1g1c_A Immunoglobulin-like domain I1 from titin; immunoglobulin domain, beta-sandwhich, I-SET, structural protein; 2.10A {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>2kkq_A Myotilin; unknown function, actin-binding, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Back     alignment and structure
>2edj_A Roundabout homolog 2; KIAA1568 protein, beta sandwich, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3caf_A Fibroblast growth factor receptor 2; FGFR2, D2, ATP-binding, disease MU ectodermal dysplasia, glycoprotein, heparin-binding, immuno domain, kinase; 1.96A {Homo sapiens} PDB: 3cu1_A* 3euu_A 3dar_A 1wvz_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1wit_A Twitchin 18TH IGSF module; immunoglobulin superfamily, I SET, muscle protein; NMR {Caenorhabditis elegans} SCOP: b.1.1.4 PDB: 1wiu_A Back     alignment and structure
>1wwb_X Protein (brain derived neurotrophic factor receptor TRKB); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 2.10A {Homo sapiens} SCOP: b.1.1.4 PDB: 1hcf_X Back     alignment and structure
>2dlt_A Myosin binding protein C, fast-type; IG-like domain, mybpc2, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3so5_A LIG-3, leucine-rich repeats and immunoglobulin-like DOMA protein 3; structural genomics, joint center for struct genomics, JCSG; HET: MLY MSE; 1.70A {Mus musculus} Back     alignment and structure
>1he7_A High affinity nerve growth factor receptor; transferase, TRK-receptor, strand-swapping; 2.0A {Homo sapiens} SCOP: b.1.1.4 PDB: 1wwa_X 1www_X Back     alignment and structure
>2eo9_A Roundabout homolog 1; beta-sandwich, IG-fold, H-ROBO-1, deleted in U twenty twenty, neurogenesis, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1waa_A Titin; metal binding protein, calmodulin-binding, cytoskeleton, immunoglobulin domain, muscle protein, phosphorylation, repeat; 1.80A {Homo sapiens} PDB: 1waa_E 1waa_F 1tit_A 1tiu_A 2rq8_A Back     alignment and structure
>2kdg_A Myotilin; immonoglobulin domain, actin-binding, structural protein, cell membrane, cytoplasm, cytoskeleton, disease mutation, immunoglobulin domain; NMR {Homo sapiens} Back     alignment and structure
>2cqv_A MLCK, myosin light chain kinase, smooth muscle and non- muscle isozymes; IG fold, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>2yr3_A Myosin light chain kinase, smooth muscle; IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3puc_A Titin; I-SET IG-like domain, M-BAND, transferase; 0.96A {Homo sapiens} Back     alignment and structure
>1u2h_A APEG-1, aortic preferentially expressed protein 1; structural genomics, IG-fold I-SET, RGD motif, homophilic adhesion, arterial smooth muscle cells; 0.96A {Homo sapiens} Back     alignment and structure
>3s35_X Vascular endothelial growth factor receptor 2; antibody, KDR, VEGF receptor, cancer, immune system-transfer complex; HET: NAG; 2.20A {Homo sapiens} PDB: 3s36_X 3s37_X Back     alignment and structure
>2dm2_A Palladin; beta-sandwich, KIAA0992, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3kvq_A Vascular endothelial growth factor receptor 2; vegfr2, angiogenesis, ATP-binding, developmental protein, differentiation, glycoprotein; 2.70A {Homo sapiens} SCOP: b.1.1.0 Back     alignment and structure
>2ckn_A Basic fibroblast growth factor receptor 1; kinase, transferase, heparin-binding, nucleotide-binding, immunoglobulin domain, alternatice splicing; NMR {Mus musculus} Back     alignment and structure
>3qp3_A Titin; I-SET IG-like, sarcomere, M-BAND, transferase; 2.00A {Homo sapiens} Back     alignment and structure
>2dm3_A KIAA0992 protein, palladin; beta-sandwich, myopalladin, actin-associated scaffold, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wwc_A Protein (NT-3 growth factor receptor TRKC); TRK receptor, receptor tyrosine kinase, 3D-domain swapping, transferase; 1.90A {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>2v9t_A Roundabout homolog 1; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} Back     alignment and structure
>1fhg_A Telokin; immunoglobulin fold, beta barrel, contractIle protein; 2.00A {Meleagris gallopavo} SCOP: b.1.1.4 PDB: 1tlk_A Back     alignment and structure
>1nct_A Titin; cell adhesion, glycoprotein, transmembrane, repeat, brain, immunoglobulin fold, alternative splicing, signal, muscle protein; NMR {Homo sapiens} SCOP: b.1.1.4 PDB: 1ncu_A 1tnm_A 1tnn_A Back     alignment and structure
>4hwu_A Fibroblast growth factor receptor 2; FGFR2, KGFR, CD332, IG-C2 type 1 domain, IG superfamily, IMM system, structural genomics, PSI-biology; 2.90A {Mus musculus} Back     alignment and structure
>3rbg_A Cytotoxic and regulatory T-cell molecule; IGV, crtam, structural genomics, PSI-biology, NEW YORK struc genomics research consortium, nysgrc; 2.30A {Homo sapiens} Back     alignment and structure
>2e7c_A Myosin-binding protein C, fast-type; IG-like domain, fast MYBP-C, C-protein, skeletal muscle fast-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dm7_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2edl_A 2edw_A 2gqh_A 2edt_A 2edq_A 2edr_A Back     alignment and structure
>3m45_A Cell adhesion molecule 2; IG fold, dimer, disulfide bond, glycoprotein, immunoglobulin membrane, transmembrane; HET: NAG; 2.21A {Mus musculus} Back     alignment and structure
>2cr3_A Basic fibroblast growth factor receptor 1; IG fold, FGFR1, BFGF-R, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yuz_A Myosin-binding protein C, SLOW-type; immunoglobulin domain, SLOW-type myosin-binding protein C, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1gl4_B Basement membrane-specific heparan sulfate proteoglycan core protein; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: b.1.1.4 Back     alignment and structure
>2bk8_A Connectin, M1, titin heart isoform N2-B; IG domain, M-BAND, structural protein, muscle, antibo; 1.69A {Homo sapiens} Back     alignment and structure
>1x44_A Myosin-binding protein C, SLOW-type; IG-like domain, SLOW- type/skeletal muscle SLOW-isoform, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>2lvc_A Obscurin-like protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, structural prote; NMR {Homo sapiens} Back     alignment and structure
>3cx2_A Myosin-binding protein C, cardiac-type; protonation states, actin-binding, cardiomyopathy, cell adhesion, disease mutation, immunoglobulin domain; 1.30A {Homo sapiens} PDB: 2v6h_A 2avg_A Back     alignment and structure
>3qr2_A Basigin; CD147, EMMPRIN, immunoglobulin-like domain, beta sheet, STRU genomics, berkeley structural genomics center, BSGC, cell A; 2.30A {Homo sapiens} PDB: 3qqn_A Back     alignment and structure
>4gos_A V-SET domain-containing T-cell activation inhibit; immunoglobulin domain, glycoprotein, disulfide bond, immunit adaptive immunity; HET: NAG BMA MAN; 1.59A {Homo sapiens} Back     alignment and structure
>2dav_A SLOW MYBP-C, myosin-binding protein C, SLOW-type; IG domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Back     alignment and structure
>2eny_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1eaj_A Coxsackie virus and adenovirus receptor; virus/viral protein receptor, immunoglobulin V domain fold, symmetric dimer; 1.35A {Homo sapiens} SCOP: b.1.1.1 PDB: 1f5w_A 2j12_B 2j1k_A 2wbw_B* 2w9l_A* 1rsf_A 1jew_R 1kac_B 1p69_B 1p6a_B Back     alignment and structure
>3p2t_A Leukocyte immunoglobulin-like receptor subfamily 4; LILR, IG, inhibitory receptor, disulfide, immune system; 1.70A {Homo sapiens} Back     alignment and structure
>1pd6_A Cardiac MYBP-C;, myosin-binding protein C, cardiac-type, domain C2; IG domain, structural protein; NMR {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>2yuv_A Myosin-binding protein C, SLOW-type; SLOW-type myosin-binding protein C, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2yxm_A Back     alignment and structure
>2x1w_L Vascular endothelial growth factor receptor 2; hormone-signaling protein complex, angiogenesis, glycoprotein, HOST-virus interaction, membrane; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2x1x_R* Back     alignment and structure
>2edf_A Obscurin; beta-sandwich, IG-fold, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* Back     alignment and structure
>2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Back     alignment and structure
>2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Back     alignment and structure
>3bfo_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1 (isoform 2); hydrolase, immunoglobulin domain, nucleus, protease; 1.15A {Homo sapiens} Back     alignment and structure
>2cpc_A KIAA0657 protein; immunoglobulin domain, IG domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Back     alignment and structure
>2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Back     alignment and structure
>3ejj_X Macrophage colony-stimulating factor 1 receptor; growth factor-receptor complex, receptor tyrosine kinase, CY 4-helix bundle, ATP-binding; HET: NAG; 2.40A {Mus musculus} PDB: 4exp_X* Back     alignment and structure
>2edh_A Obscurin; structural genomics, NPPSFA, national project on P structural and functional analyses, riken structural genomics/proteomics initiative; NMR {Homo sapiens} Back     alignment and structure
>2ny1_B T-cell surface glycoprotein CD4; HIV, GP120, CD4, viral protein-immune system compl; HET: NAG SUC; 1.99A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 2nxz_B* 2ny0_B* 2nxy_B* 2ny2_B* 2ny3_B* 2ny4_B* 2ny5_C* 2ny6_B* 3jwd_C* 3jwo_C* 1g9m_C* 1g9n_C* 1gc1_C* 1rzj_C* 1rzk_C* 3o2d_A 3cd4_A 3lqa_C* 2b4c_C* 2qad_B* ... Back     alignment and structure
>4f80_A Butyrophilin subfamily 3 member A1; B7 superfamily, CD277, immune system; 1.94A {Homo sapiens} PDB: 4f9l_A* 4f9p_A 4f8t_A 4f8q_A Back     alignment and structure
>2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Back     alignment and structure
>2fbo_J V1V2;, variable region-containing chitin-binding protein 3; immunoglobulin, VCBP, V-type, V SET, immune system; 1.85A {Branchiostoma floridae} Back     alignment and structure
>1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Back     alignment and structure
>4frw_A Poliovirus receptor-related protein 4; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; 3.50A {Homo sapiens} Back     alignment and structure
>2cry_A KIN of IRRE-like protein 3; IG fold, KIN of irregular chiasm-like protein 3, nephrin- like 2, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: b.1.1.1 Back     alignment and structure
>2eo1_A OBSCN protein, cDNA FLJ14124 FIS, clone mamma1002498; beta-sandwich, IG-fold, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3mtr_A N-CAM-1, NCAM-1, neural cell adhesion molecule 1; immunoglobulin domain, fibronectin type III repeat, CE adhesion; 1.80A {Homo sapiens} Back     alignment and structure
>1ncn_A T lymphocyte activation antigen CD86; IG V, beta strands, immune system; 2.70A {Homo sapiens} SCOP: b.1.1.1 PDB: 1i85_A Back     alignment and structure
>2edn_A Myosin-binding protein C, fast-type; beta-sandwich, IG-fold, fast MYBP-C, C-protein, skeletal muscle fast isoform, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Back     alignment and structure
>1hng_A CD2; T lymphocyte adhesion glycoprotein; 2.80A {Rattus rattus} SCOP: b.1.1.1 b.1.1.3 Back     alignment and structure
>3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* Back     alignment and structure
>2edk_A Myosin-binding protein C, fast-type; IG fold, fast MYBP-C, C-protein, skeletal muscle fast- isoform, MYBPCF, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Back     alignment and structure
>3r4d_A CEA-related cell adhesion molecule 1, isoform 1/2; immunoglobulin, beta-sandwich, mceacam1A - immunoglobulin FO spike NTD - galectin-like beta-sandwich fold; HET: NAG; 3.10A {Mus musculus} PDB: 1l6z_A* Back     alignment and structure
>2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A Back     alignment and structure
>4fqp_A Poliovirus receptor; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; HET: NAG BMA FUC MAN; 3.60A {Homo sapiens} PDB: 1nn8_R 1dgi_R Back     alignment and structure
>3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} Back     alignment and structure
>2lu7_A Obscurin-like protein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, structural prote; NMR {Homo sapiens} Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Back     alignment and structure
>1z9m_A GAPA225; nectin-like, IG-like domain, V domain, cell adhesion; 2.40A {Homo sapiens} Back     alignment and structure
>1pko_A Myelin oligodendrocyte glycoprotein; IGV-domain, immune system; 1.45A {Rattus norvegicus} SCOP: b.1.1.1 PDB: 1pkq_E 3csp_A 1py9_A Back     alignment and structure
>2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Back     alignment and structure
>1jbj_A CD3 epsilon and gamma ectodomain fragment complex; beta-sheet, C2-SET immunoglobulin superfamily, H-bonded G strand PAIR, single-chain; NMR {Mus musculus} SCOP: b.1.1.4 b.1.1.4 PDB: 1xmw_A Back     alignment and structure
>1ugn_A LIR1, leukocyte immunoglobulin-like receptor 1; immunoglobulin-like folds, immune system; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 3d2u_D* 1g0x_A 1p7q_D 1ufu_A 1vdg_A 2gw5_A 2dyp_D 2otp_A 3q2c_A Back     alignment and structure
>3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Back     alignment and structure
>2o26_X MAST/stem cell growth factor receptor; stem cell factor, receptor tyrosine kinase, class III, recep ligand complex, cytokine, 4-helix bundle; HET: NAG FUL MAN NDG; 2.50A {Mus musculus} Back     alignment and structure
>2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Back     alignment and structure
>2e6p_A Obscurin-like protein 1; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3udw_C Poliovirus receptor; PVR tigit IGSF signal transduction immunology, IGSF, cell SU receptor signalling, glycosylation, membrane protein; HET: NAG; 2.90A {Homo sapiens} Back     alignment and structure
>2yd6_A PTPRD protein; hydrolase; HET: FLC; 1.35A {Homo sapiens} PDB: 2yd7_A 2yd2_A 2yd3_A 2yd4_A* 2yd8_A* 2yd5_A* 3pxh_A Back     alignment and structure
>2ens_A Advanced glycosylation END product-specific receptor; beta-sandwich, C2-SET, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} Back     alignment and structure
>3mj6_A Junctional adhesion molecule-like; immunoglobulin tandem domain, cell adhesion, cell junction, glycoprotein, immunoglobulin domain, membrane; HET: NAG FUC; 2.19A {Mus musculus} PDB: 3mj7_A* 3mj9_A* Back     alignment and structure
>4dkd_C Macrophage colony-stimulating factor 1 receptor; dimeric four-helix bundle cytokine, receptor tyrosine kinase glycosylation; HET: NAG BMA; 3.00A {Homo sapiens} Back     alignment and structure
>2nzi_A Titin; IG-domain, FNIII-domain, transferase; 2.90A {Homo sapiens} Back     alignment and structure
>4gjt_B Poliovirus receptor-related protein 4; six-bladed -propeller, IGV-like fold, viral entry, MV-H, NEC BETA4/BETA5 groove; HET: NAG; 3.10A {Homo sapiens} Back     alignment and structure
>1hnf_A CD2; T lymphocyte adhesion glycoprotein; HET: NAG; 2.50A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1cdb_A 1gya_A* 1qa9_A Back     alignment and structure
>3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Back     alignment and structure
>3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X Back     alignment and structure
>3p2t_A Leukocyte immunoglobulin-like receptor subfamily 4; LILR, IG, inhibitory receptor, disulfide, immune system; 1.70A {Homo sapiens} Back     alignment and structure
>3q0h_A T cell immunoreceptor with IG and ITIM domains; immune receptor, adhesion, structural genomics, NEW YORK STR genomics research consortium, nysgrc; 1.70A {Homo sapiens} PDB: 3rq3_A 3udw_A* 3ucr_A Back     alignment and structure
>1epf_A NCAM, protein (neural cell adhesion molecule); immunoglobulin fold, glycoprotein; 1.85A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 PDB: 2ncm_A 3ncm_A Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Back     alignment and structure
>1h5b_A Murine T cell receptor (TCR) valpha domain; immune response, immunoglobulin fold; 1.85A {Mus musculus} SCOP: b.1.1.1 PDB: 1h5b_C 1h5b_B Back     alignment and structure
>1oll_A NK receptor; immune system/receptor, NK cell triggering receptor, immune system, IG domain, cytotoxicity, C2-type IG-like domains; 1.93A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Back     alignment and structure
>1vca_A VCAM-D1,2, human vascular cell adhesion molecule-1; immunoglobulin superfamily, integrin-binding, cell adhesion protein; 1.80A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 PDB: 1ij9_A 1vsc_A Back     alignment and structure
>2k1m_A Myosin-binding protein C, cardiac-type; IG-I domain, cardiac muscle, hypertrophic cardiomyopathy, actin-binding, cell adhesion, disease mutation; NMR {Homo sapiens} Back     alignment and structure
>2dku_A KIAA1556 protein; beta-sandwich, IG-fold, obscurin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2v5t_A NCAM2, N-CAM 2, neural cell adhesion molecule 2; phosphorylation, immunoglobulin domain, membrane, glycoprote adhesion, transmembrane; HET: NAG; 2.00A {Homo sapiens} Back     alignment and structure
>2d3v_A Leukocyte immunoglobulin-like receptor subfamily A member 5 isoform 1; immunoglobulin-like fold, immune system; 1.85A {Homo sapiens} Back     alignment and structure
>4f80_A Butyrophilin subfamily 3 member A1; B7 superfamily, CD277, immune system; 1.94A {Homo sapiens} PDB: 4f9l_A* 4f9p_A 4f8t_A 4f8q_A Back     alignment and structure
>3ojm_B Fibroblast growth factor receptor 2; beta trefoil motif, immunoglobulin-like domain, growth facto factor receptor, extracellular; 2.10A {Homo sapiens} PDB: 1nun_B* 3oj2_C 2fdb_P 1iil_E 1ev2_E 1e0o_B* 1ii4_E 1djs_A 3ojv_C* 1cvs_C 1fq9_C* 1evt_C Back     alignment and structure
>3kld_A Contactin 4, axcam, BIG-2; cell adhesion, protein complex, receptor protein tyrosine phosphatase; HET: NAG; 2.00A {Mus musculus} PDB: 3jxa_A* Back     alignment and structure
>2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Back     alignment and structure
>1cs6_A Axonin-1; neural cell adhesion, cell adhesion; 1.80A {Gallus gallus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 PDB: 2om5_A Back     alignment and structure
>2pet_A Lutheran blood group glycoprotein; immunoglobulin superfamily., cell adhesion; 1.70A {Homo sapiens} PDB: 2pf6_A Back     alignment and structure
>3sgj_C Human FCG3A receptor; receptor complex, FC receptor, antibody, immune system; HET: NAG BMA MAN FUC; 2.20A {Homo sapiens} PDB: 3sgk_C* Back     alignment and structure
>4i0k_A CD276 antigen; immunoglobulin domain, glycoprotein, immunity, adaptive IMMU structural genomics, protein structure initiative; HET: NAG BMA MAN; 2.97A {Mus musculus} Back     alignment and structure
>1itb_B Type 1 interleukin-1 receptor; immunoglobulin fold, transmembrane, glycoprotein, signal, complex (immunoglobulin/receptor); 2.50A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ira_Y* 4dep_B* 1g0y_R Back     alignment and structure
>2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} Back     alignment and structure
>3b5h_A Cervical EMMPRIN, HAB18G/CD147; IG-like domain, cell invasion; 2.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} Back     alignment and structure
>2x1w_L Vascular endothelial growth factor receptor 2; hormone-signaling protein complex, angiogenesis, glycoprotein, HOST-virus interaction, membrane; HET: NAG BMA; 2.70A {Homo sapiens} PDB: 2x1x_R* Back     alignment and structure
>3bp6_B Programmed cell death 1 ligand 2; PD-1, PD-L2, complex, costimulation, glycoprotein, immunoglo domain, membrane, transmembrane, receptor; 1.60A {Mus musculus} PDB: 3bp5_B 3rnq_B 3bov_A 3rnk_B Back     alignment and structure
>3grw_A Fibroblast growth factor receptor 3; FGFR3, protein-protein complex, receptor tyrosine kinas binding, immunoglobulin domain, kinase, membrane, nucleotid binding; HET: NAG; 2.10A {Homo sapiens} Back     alignment and structure
>2j8h_A Titin, connectin; cardiomyopathy, nuclear protein, serine/threonine-protein KI LIMB-girdle muscular dystrophy, phosphorylation; 1.99A {Homo sapiens} PDB: 2j8o_A 2ill_A Back     alignment and structure
>1fnl_A Low affinity immunoglobulin gamma FC region receptor III-B; beta sandwich, immunoglobulin-like, immune system receptor; 1.80A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1e4j_A 1e4k_C* 1t83_C* 1t89_C* 3ay4_C* Back     alignment and structure
>2e7b_A Obscurin; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2yz8_A Back     alignment and structure
>1jhl_L IGG1-kappa D11.15 FV (light chain); complex(antibody-antigen); 2.40A {Mus musculus} SCOP: b.1.1.1 Back     alignment and structure
>3lcy_A Titin; A-BAND, IG tandem domains, ATP-binding, calmodulin-BI cardiomyopathy, disease mutation, disulfide bond, immunoglo domain, isopeptide bond; 2.50A {Homo sapiens} Back     alignment and structure
>2yd1_A Tyrosine-protein phosphatase LAR; hydrolase; 1.80A {Drosophila melanogaster} PDB: 3pxj_A Back     alignment and structure
>2jjs_C Leukocyte surface antigen CD47; signal regulatory protein alpha, immunoglobulin superfamily, transmembrane, phosphoprotein, paired receptor; HET: NAG; 1.85A {Homo sapiens} PDB: 2jjt_C* 2vsc_A* Back     alignment and structure
>3ry4_A Low affinity immunoglobulin gamma FC region recep; FC receptor, CD32, immunoglobulin superfamily, low responder polymorphism, cell membrane; HET: NAG; 1.50A {Homo sapiens} PDB: 1fcg_A 3ry5_A 1h9v_A 3d5o_F* 3ry6_C* 2fcb_A Back     alignment and structure
>1bih_A Hemolin; insect immunity, LPS-binding, homophilic adhesion; 3.10A {Hyalophora cecropia} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 b.1.1.4 Back     alignment and structure
>2cr6_A KIAA1556 protein, obscurin; IG-fold, immunoglobulin domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2if7_A SLAM family member 6; NTB-A, homophilic receptor, immune system; 3.00A {Homo sapiens} Back     alignment and structure
>2oyp_A Hepatitis A virus cellular receptor 2; TIM-3, T-cell immunoglobulin mucin, signaling protein; 1.95A {Mus musculus} PDB: 3kaa_A* Back     alignment and structure
>2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Back     alignment and structure
>2ywz_A NEW antigen receptor variable domain; IG VNAR, immune system; 2.21A {Orectolobus maculatus} PDB: 2ywy_A Back     alignment and structure
>3sbw_C Programmed cell death 1 ligand 1; PD-1, PD-L1, B7-H1, programmed death-1 ligand 1, complex, costimulatory, immune system; 2.28A {Homo sapiens} PDB: 3fn3_A 3bis_A 3bik_A Back     alignment and structure
>2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A Back     alignment and structure
>2y23_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin- like; 2.50A {Homo sapiens} Back     alignment and structure
>1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 Back     alignment and structure
>2a38_A Titin; Z1Z2, structural protein; 2.00A {Homo sapiens} PDB: 1ya5_A 2f8v_A Back     alignment and structure
>3rbs_A Myomesin-1; immunoglobulin C-SET domain, contractIle protein; 1.85A {Homo sapiens} Back     alignment and structure
>2edo_A CD48 antigen; beta-sandwich, IG-fold, B-lymphocyte activation marker blast-1, BCM1 surface antigen, leukocyte antigen MEM-102, TCT.1; NMR {Homo sapiens} Back     alignment and structure
>2gi7_A GPVI protein; IG-like domains, blood clotting, cell adhesion; 2.40A {Homo sapiens} Back     alignment and structure
>3bp6_B Programmed cell death 1 ligand 2; PD-1, PD-L2, complex, costimulation, glycoprotein, immunoglo domain, membrane, transmembrane, receptor; 1.60A {Mus musculus} PDB: 3bp5_B 3rnq_B 3bov_A 3rnk_B Back     alignment and structure
>3vh8_G Killer cell immunoglobulin-like receptor 3DL1; immunoglobulin fold, natural killer cell receptor, immune SY; HET: NAG; 1.80A {Homo sapiens} PDB: 1im9_D Back     alignment and structure
>2gi7_A GPVI protein; IG-like domains, blood clotting, cell adhesion; 2.40A {Homo sapiens} Back     alignment and structure
>2oz4_A Intercellular adhesion molecule 1; IGSF domain, structural plasticity, cell-surface dimerizatio adhesion; HET: NAG FUC; 2.70A {Homo sapiens} SCOP: b.1.1.3 b.1.1.4 b.1.1.4 PDB: 1p53_A* Back     alignment and structure
>3r08_E T-cell surface glycoprotein CD3 epsilon chain; antibody, T-cell receptor, signalling, immune SY; 4.10A {Cricetulus migratorius} Back     alignment and structure
>3pv7_A B7-H6, IG-like domain-containing protein DKFZP686O24166/DKFZP686I21167; NK cell receptor, receptor-ligand complex, immune system; HET: NAG; 2.00A {Homo sapiens} PDB: 3pv6_A* Back     alignment and structure
>3p3y_A Neurofascin; IG domains, cell adhesion; HET: NAG; 2.60A {Homo sapiens} PDB: 3p40_A* Back     alignment and structure
>4hwn_A FC receptor-like A; FCRLA, FCRL, IG-C2 domain, IG superfamily, immune system, ST genomics, PSI-biology; 2.01A {Homo sapiens} Back     alignment and structure
>1dr9_A B7-1 (CD80), T lymphocyte activation antigen; IG superfamily, immune system; HET: NAG; 3.00A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1i8l_A* Back     alignment and structure
>4fmk_A Poliovirus receptor-related protein 2; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; HET: NAG BMA MAN FUC; 2.56A {Mus musculus} PDB: 4fn0_A* 4fs0_A* Back     alignment and structure
>4fom_A Poliovirus receptor-related protein 3; immunoglobulin-like domain, IG domain, cell adhesion; HET: NAG BMA MAN FUC; 3.93A {Homo sapiens} Back     alignment and structure
>4fa8_A Secreted protein BARF1; immunoglobulin-like domains, 4-helix bundle fold, viral PROT cytokine complex; HET: NAG BMA; 2.20A {Human herpesvirus 4} PDB: 2ch8_A* 3uez_A* 4adf_A* 4adq_A* Back     alignment and structure
>1jbj_A CD3 epsilon and gamma ectodomain fragment complex; beta-sheet, C2-SET immunoglobulin superfamily, H-bonded G strand PAIR, single-chain; NMR {Mus musculus} SCOP: b.1.1.4 b.1.1.4 PDB: 1xmw_A Back     alignment and structure
>1neu_A Myelin P0 protein; structural protein, glycoprotein, transmembrane, phosphorylation, immunoglobulin fold, signal; 1.90A {Rattus norvegicus} SCOP: b.1.1.1 Back     alignment and structure
>1f2q_A High affinity immunoglobulin epsilon receptor ALP subunit; immunoglobulin fold, glycoprotein, IGE-binding Pro immune system; HET: NAG MAN; 2.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1j86_A* 1rpq_A* 2y7q_A* 1f6a_A* 1j88_A* 1j89_A* 1j87_A* Back     alignment and structure
>2ptt_A CD48 antigen; CD244, CD48, NK cell receptor, X-RAY, immune system; 1.63A {Mus musculus} PDB: 2ptv_A Back     alignment and structure
>2vsd_A CHIR AB1; immune system receptor, FC receptor; HET: NAG NDG MAN; 1.82A {Gallus gallus} Back     alignment and structure
>2wv3_A Neuroplastin; igcam, membrane, glycoprotein, cell membrane, cell adhesion, transmembrane, disulfide bond, alternative splicing; HET: NAG; 1.95A {Rattus norvegicus} Back     alignment and structure
>4fmk_A Poliovirus receptor-related protein 2; immunoglobulin-like domain, IG domain, viral entry receptor, adhesion; HET: NAG BMA MAN FUC; 2.56A {Mus musculus} PDB: 4fn0_A* 4fs0_A* Back     alignment and structure
>2e6q_A Obscurin-like protein 1; IG-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2c5d_C AXL oncogene, tyrosine-protein kinase receptor UFO; signaling protein/receptor, growth regulation/complex, vitamin K-dependent protein; HET: NAG; 3.3A {Homo sapiens} Back     alignment and structure
>3u83_A Poliovirus receptor-related protein 1; nectin-1, hinge region plasiticity, cell adhesion; HET: PG6; 2.50A {Homo sapiens} PDB: 3alp_A* 3u82_B 4fmf_A* 3sku_E* 2l7j_A Back     alignment and structure
>3r0n_A Poliovirus receptor-related protein 2; IG-domain, cell-adhesion molecule, virus entry receptor, STR genomics, PSI-biology; 1.30A {Homo sapiens} PDB: 4dfh_A 4dfi_A Back     alignment and structure
>1xt5_A Variable region-containing chitin-binding protein 3; innate immunity, VCBP, primordial antigen receptor, florida lancelet, amphioxus; 1.15A {Branchiostoma floridae} Back     alignment and structure
>1nkr_A P58-CL42 KIR; inhibitory receptor, natural killer cells, immunological receptors, immunoglobulin fold; 1.70A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1m4k_A 1efx_D 2dli_A 2dl2_A 3h8n_A Back     alignment and structure
>2d3v_A Leukocyte immunoglobulin-like receptor subfamily A member 5 isoform 1; immunoglobulin-like fold, immune system; 1.85A {Homo sapiens} Back     alignment and structure
>3r06_A Anti-mouse CD3epsilon antibody 2C11 FAB light CHA; anti-CD3epsilon, T-cell receptor, signalling, IMMU; 2.50A {Cricetulus migratorius} PDB: 3r08_L 3ld8_B 3ldb_B* Back     alignment and structure
>3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Back     alignment and structure
>1qz1_A Neural cell adhesion molecule 1, 140 kDa isoform; IG modules, NCAM; 2.00A {Rattus norvegicus} SCOP: b.1.1.4 b.1.1.4 b.1.1.4 PDB: 1ie5_A Back     alignment and structure
>1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Back     alignment and structure
>1sy6_A T-cell surface glycoprotein CD3 gamma/epsilon chain; CD3 epsilon, OKT3 FAB, signaling protein/antibiotic complex; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 2atp_E* Back     alignment and structure
>3jz7_A MCAR, CAR, coxsackievirus and adenovirus receptor homolog; cell adhesion molecule, immunoglobuline superfamily, alternative splicing, cell adhesion; 2.19A {Mus musculus} PDB: 3mj7_B* 2npl_X Back     alignment and structure
>1qfw_M FV, antibody (anti beta subunit) (light chain); glycoprotein hormone; HET: NAG; 3.50A {Mus musculus} SCOP: b.1.1.1 Back     alignment and structure
>2pnd_A V-SET and immunoglobulin domain containing 4; complement receptor, IG-like domain, immune system; 1.00A {Mus musculus} PDB: 2icc_A 2ice_S* 2icf_S* Back     alignment and structure
>1pew_A JTO2, A lambda-6 type immunoglobulin light chain, domain; beta sheet, immune system; 1.60A {Homo sapiens} SCOP: b.1.1.1 PDB: 1cd0_A 1pw3_A 2cd0_A 2w0k_A 3b5g_A 3bdx_A* 2w0l_A Back     alignment and structure
>3sgj_C Human FCG3A receptor; receptor complex, FC receptor, antibody, immune system; HET: NAG BMA MAN FUC; 2.20A {Homo sapiens} PDB: 3sgk_C* Back     alignment and structure
>3tv3_L PGT128 light chain, IG lambda-2 chain C regions; FAB, HIV-1 neutralizing antibody, GP120, immune system; HET: PCA MAN GOL EPE; 1.29A {Homo sapiens} PDB: 3tyg_L* 3twc_L* 3tnm_L 2mcg_1 1mcw_M 1a8j_L 3mcg_1 1dcl_A 1mcb_A* 1mcc_A* 1mcd_A* 1mce_A* 1mcf_A* 1mch_A 1mci_A* 1mcj_A* 1mck_A 1mcl_A* 1mcn_A* 1mcq_A ... Back     alignment and structure
>4i0k_A CD276 antigen; immunoglobulin domain, glycoprotein, immunity, adaptive IMMU structural genomics, protein structure initiative; HET: NAG BMA MAN; 2.97A {Mus musculus} Back     alignment and structure
>3o4o_C Interleukin-1 receptor type 2; cytokine-receptor complex, beta-trefoil, IG-like fold, immun; HET: NAG; 3.30A {Homo sapiens} Back     alignment and structure
>1u3h_A T-cell receptor alpha-chain; complex, immune system; 2.42A {Mus musculus} SCOP: b.1.1.1 PDB: 1b88_A 1kj2_A* 1kb5_A 1d9k_A* Back     alignment and structure
>3s97_C Contactin-1; carbonic anhdyrase like immunoglobulin, cell adhesion comple adhesion; HET: NAG; 2.30A {Homo sapiens} Back     alignment and structure
>2coq_A NEW antigen receptor variable domain; IG VNAR, natural TYPE2, immune system; 2.10A {Orectolobus maculatus} Back     alignment and structure
>2yd9_A Receptor-type tyrosine-protein phosphatase S; hydrolase; HET: NAG B3P; 2.60A {Homo sapiens} Back     alignment and structure
>1rhf_A Tyrosine-protein kinase receptor TYRO3; AXL/TYRO3 family, cellular adhesion, ligand-independent DIME mutational analysis, transferase; HET: EPE; 1.96A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 Back     alignment and structure
>2dru_A Chimera of CD48 antigen and T-cell surface antige; CD2 binding domain of CD48, immune system; HET: NAG; 2.60A {Rattus norvegicus} Back     alignment and structure
>3qs9_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, hematopoietic cytokine-receptor complex, cell surface, EXTR complex; 7.80A {Homo sapiens} Back     alignment and structure
>1nbq_A JAM, junctional adhesion molecule 1, PAM-1; reovirus receptor, tight junction formation, immunoglobulin superfamily, immune system; 2.90A {Homo sapiens} SCOP: b.1.1.1 b.1.1.4 PDB: 3eoy_G Back     alignment and structure
>3qs7_E FL cytokine receptor; immunoglobulin-like domain, four-helical bundle cytokine, CY receptor complex, extracellular complex; HET: NAG; 4.30A {Homo sapiens} Back     alignment and structure
>2d9c_A Signal-regulatory protein beta-1; beta-sandwich, SIRP-beta-1, CD172B antigen, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1hng_A CD2; T lymphocyte adhesion glycoprotein; 2.80A {Rattus rattus} SCOP: b.1.1.1 b.1.1.3 Back     alignment and structure
>3mjg_X Beta-type platelet-derived growth factor receptor; protein-protein complex, growth factor-receptor complex, TRA hormone complex; HET: NDG NAG; 2.30A {Homo sapiens} Back     alignment and structure
>3laf_A Deleted in colorectal cancer; netrin-1 receptor, immunoglobulin superfamily, horseshoe, AP; HET: NAG BMA; 2.40A {Rattus norvegicus} Back     alignment and structure
>3mj6_A Junctional adhesion molecule-like; immunoglobulin tandem domain, cell adhesion, cell junction, glycoprotein, immunoglobulin domain, membrane; HET: NAG FUC; 2.19A {Mus musculus} PDB: 3mj7_A* 3mj9_A* Back     alignment and structure
>2ocw_A Polymeric-immunoglobulin receptor; SC, secretory, antibody, immunity, immune system; NMR {Homo sapiens} PDB: 3chn_S 3cm9_S 3chn_J 3cm9_J Back     alignment and structure
>2rik_A Titin; I-SET IG fold, poly-IG linear array, structural protein; 1.60A {Oryctolagus cuniculus} PDB: 2rjm_A Back     alignment and structure
>1oaq_L Light chain; antibody, allergy, IGE, conformational diversity, multispecificity; 1.50A {Rattus rattus} SCOP: b.1.1.1 PDB: 1ocw_L 2bjm_L* 1oau_L* 1oar_L* 1oaz_L 1mfa_L* 1a6v_L* 1oax_L* 1oay_L* 1a6w_L* 1a6u_L 1dl7_L* Back     alignment and structure
>1dr9_A B7-1 (CD80), T lymphocyte activation antigen; IG superfamily, immune system; HET: NAG; 3.00A {Homo sapiens} SCOP: b.1.1.1 b.1.1.3 PDB: 1i8l_A* Back     alignment and structure
>2v5m_A Dscam; neurobiology SPL immunoglobulin domain, cell adhesion, membrane, development protein; HET: NAG; 1.95A {Drosophila melanogaster} PDB: 2v5s_A* 2v5r_A* Back     alignment and structure
>3k0w_A Mucosa-associated lymphoid tissue lymphoma translocation protein 1, isoform 2; hydrolase, immunoglobulin domain, nucleus, protease; 2.80A {Homo sapiens} Back     alignment and structure
>2v9r_A Roundabout homolog 1; proto-oncogene, differentiation, phosphorylation, disease MU neuronal development, immunoglobulin domain, chemotaxis; 2.00A {Homo sapiens} PDB: 2v9q_A Back     alignment and structure
>2vr9_A Roundabout 1, ROBO; immunoglobulin-like domain, AXON guidance, cell adhesion, immunoglobulin domain; 3.2A {Drosophila melanogaster} PDB: 2vra_A* Back     alignment and structure
>2r15_A Myomesin-1; sarcomeric protein, IG-like domains, homodimer, immunoglobul domain, muscle protein, thick filament, contractIle protein; 2.24A {Homo sapiens} Back     alignment and structure
>3tf7_C 42F3 MUT7 SCFV (42F3 alpha chain, linker, 42F3 BE; IG and MHC, antigen recognition, TCR-PMHC, membrane receptor system; 2.75A {Mus musculus} Back     alignment and structure
>1xiw_B T-cell surface glycoprotein CD3 delta chain; CD3-epsilon, CD3-delta, UCHT1-SCFV, immunoglobulin fold, antibody-antigen complex; 1.90A {Homo sapiens} SCOP: b.1.1.4 Back     alignment and structure
>2jju_A Signal regulatory protein beta-1; immunoglobulin domain, immunoglobulin superfamily, immune system, transmembrane, paired receptor; 1.19A {Homo sapiens} PDB: 2jjv_A 2uv3_A* 2jjt_A* 2jjs_A* 2jjw_A Back     alignment and structure
>1nkr_A P58-CL42 KIR; inhibitory receptor, natural killer cells, immunological receptors, immunoglobulin fold; 1.70A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1m4k_A 1efx_D 2dli_A 2dl2_A 3h8n_A Back     alignment and structure
>1p6f_A NKP46, natural cytotoxicity triggering receptor 1; natural cytotoxicity receptor, NK cell receptor, immunoglobulin fold, immune system; 2.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>2or8_A Hepatitis A virus cellular receptor 1 homolog; beta barrel, immunoglobulin fold, IGV domain, TIM, immune system; 2.50A {Mus musculus} Back     alignment and structure
>1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>2q20_A VK1 O18/O8 germline light chain variable domain; Al, light chain amyloidosis, amyloid, immunoglobulin, protein fibril; 1.30A {Homo sapiens} PDB: 2kqm_A 3cdf_A 3cdc_A 2kqn_A 3cdy_A 2q1e_A 3dvi_A 1igm_L 1bww_A 1b0w_A 1bre_A 1qp1_A 3dvf_A 1rei_A 1wtl_A 1ar2_A 1fgv_L 2bx5_A 2uzi_L* 1bvk_A ... Back     alignment and structure
>3d9a_L Light chain of hyhel10 antibody fragment (FAB); lysozyme, antigen, allergen, antimic bacteriolytic enzyme, glycosidase, hydrolase; 1.20A {Mus musculus} PDB: 3hfm_L 1xgp_A 1xgq_A 1xgr_A 1xgt_A 1dqq_A 1dqm_L 1dqj_A 1nby_A 1nbz_A 1ndg_A 1ndm_A 1xgu_A 1fh5_L 1bm3_L 1opg_L 1mlb_A 1mlc_A 1rih_L 1p2c_A ... Back     alignment and structure
>1ry7_B FGFR-3, fibroblast growth factor receptor 3; FGF-FGFR complex, beta trefoil, IG domain, growth factor/growth factor receptor complex; 3.20A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 Back     alignment and structure
>1pz5_B Heavy chain of FAB (SYA/J6); antibody-antigen structure, peptide-carbohydrate mimicry, VA design, immune system; 1.80A {Mus musculus} SCOP: b.1.1.1 b.1.1.2 PDB: 1m7d_B* 1m71_B* 1m7i_B* 1r24_B 1uz6_F 1uz8_B* 1clz_H* Back     alignment and structure
>3pl6_D MBP peptide / T-cell receptor beta chain chimera; TCR-MHC complex, immunoglobulin fold, immune receptor, membr immune system; HET: NAG; 2.55A {Homo sapiens} Back     alignment and structure
>2xzc_L FAB A.17 light chain; immune system; HET: XOP; 1.36A {Homo sapiens} PDB: 2xza_L* 3kdm_L* 3nps_C 1dn0_A 1qlr_A* 2v7n_A 3eo0_A 3eo1_A 2agj_L* 2fx7_L 1tzg_L 2fx8_L 2fx9_L* 1u6a_L 3hi1_L* 3kym_A 3kyk_L 3qwo_L* 3ixt_L* 3qeg_L ... Back     alignment and structure
>3khq_A B-cell antigen receptor complex-associated protei chain; CD79B, CD79A, IG-beta, BCR, IG domain, V-SET, immunoglobulin protein binding; HET: FLC GSH; 1.70A {Mus musculus} PDB: 3kho_A* Back     alignment and structure
>1uct_A Immunoglobulin alpha FC receptor; beta stands, immune system; 2.10A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 PDB: 1ovz_A* 1ow0_C* Back     alignment and structure
>2y25_A Myomesin; structural protein, sarcomere, M-BAND, immunoglobulin-like D; 3.50A {Homo sapiens} Back     alignment and structure
>3moq_A NEW antigen receptor variable domain, P3(40) PEPT amyloid beta A4 protein; AB-ignar, AB-12Y-2, glycoprotein, membran protease inhibitor; 2.05A {Orectolobus maculatus} PDB: 2z8w_C 2z8v_C 1ves_A 1ver_A Back     alignment and structure
>1f97_A Junction adhesion molecule; immunoglobulin superfamily, beta-sandwich fold, cell adhesion; 2.50A {Mus musculus} SCOP: b.1.1.1 b.1.1.4 Back     alignment and structure
>2jll_A NCAM2, neural cell adhesion molecule 2; immunoglobulin domain, immunoglobulin superfamily, transmembrane, phosphoprotein, membrane, glycoprotein; HET: NAG; 2.30A {Homo sapiens} PDB: 2xyc_A* 2jlk_A* 2doc_A Back     alignment and structure
>2iep_A Muscle-specific kinase receptor; beta-sandwich, signaling protein,transferase; 2.21A {Rattus norvegicus} Back     alignment and structure
>1tvd_A T cell receptor, ES204 V delta; immunoreceptor, TCR, delta chain, variable domain; 1.90A {Homo sapiens} SCOP: b.1.1.1 Back     alignment and structure
>3mj8_L Stimulatory hamster antibody HL4E10 FAB light CHA; hamster IGG, immune system; 2.94A {Cricetulus migratorius} PDB: 3mj9_L* Back     alignment and structure
>2p1y_A Bispecific alpha/beta TCR; autoimmunity, immunoglobulin fold, diabody, immune system; 2.42A {Mus musculus} PDB: 1bwm_A Back     alignment and structure
>4dep_C Interleukin-1 receptor accessory protein; B-trefoil, immunoglobulin, immune system, extracellular; HET: NAG; 3.10A {Homo sapiens} PDB: 3o4o_B* Back     alignment and structure
>3auv_A SC-DSFV derived from the G6-FAB; SC-DSFV (disulfide-stabilized SCFV), SCFV, monovalent antibo antibody engineering, immune system; 2.40A {Homo sapiens} PDB: 2kh2_B 3iy0_L Back     alignment and structure
>2e27_L Anti-ciguatoxin antibody, light chain; immunoglobulin fold, immune system; HET: AB0; 1.70A {Mus musculus} PDB: 3iy1_A Back     alignment and structure
>2wim_A N-CAM 2, NCAM2, neural cell adhesion molecule 2; cell membrane, transmembrane, immunoglobulin; HET: NDG NAG; 3.00A {Homo sapiens} Back     alignment and structure
>3bdb_A Novel immune-type receptor 11; immunoglobulin variable domain-like beta-sandwich, stalk region, immune system; 2.80A {Ictalurus punctatus} Back     alignment and structure
>3tf7_C 42F3 MUT7 SCFV (42F3 alpha chain, linker, 42F3 BE; IG and MHC, antigen recognition, TCR-PMHC, membrane receptor system; 2.75A {Mus musculus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 694
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 9e-15
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-14
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-07
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-07
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-06
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-14
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-14
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-11
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-07
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 7e-05
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.004
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 3e-11
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-08
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 6e-08
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-09
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-07
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 8e-06
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 2e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-07
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 8e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.001
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 8e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 9e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 6e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 1e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.001
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 0.004
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 4e-06
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 8e-06
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 2e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.001
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.003
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.004
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 8e-05
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 7e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-04
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 0.001
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 0.001
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 1e-04
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 6e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 3e-04
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 4e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 6e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 7e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 0.002
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: Decorin
species: Cow (Bos taurus) [TaxId: 9913]
 Score = 73.5 bits (179), Expect = 9e-15
 Identities = 68/286 (23%), Positives = 118/286 (41%), Gaps = 20/286 (6%)

Query: 100 LDCTLSNVTVLPGKFLEGVTLHGLVISSGELKNISDGAFIGLSSPLQALGLPNNLLSVVP 159
           + C+   +  +P        L  L + + ++  I DG F  L + L  L L NN +S + 
Sbjct: 15  VQCSDLGLEKVPKDLPPDTAL--LDLQNNKITEIKDGDFKNLKN-LHTLILINNKISKIS 71

Query: 160 TSALAPLAPNLDRLDLSHNQLYKLENTSFKGLSSLNFLDLSYNKLMTLSQDCLAPLVTLR 219
             A APL   L+RL LS NQL +L     K L  L   +    K+     + L   + + 
Sbjct: 72  PGAFAPL-VKLERLYLSKNQLKELPEKMPKTLQELRVHENEITKVRKSVFNGL-NQMIVV 129

Query: 220 VLRLQGNRLTVSVVAALQGLRSVTDLDLSHNLLAGPLGPSTVPR--LSSLKVLSIAHNQF 277
            L     + +     A QG++ ++ + ++   +      +T+P+    SL  L +  N+ 
Sbjct: 130 ELGTNPLKSSGIENGAFQGMKKLSYIRIADTNI------TTIPQGLPPSLTELHLDGNKI 183

Query: 278 SSVRRGALAGLDKLTSLSCHHNQIDVLEDHSFRALSTLSHLDLAHNRIVAVSGASLAHLS 337
           + V   +L GL+ L  L    N I  +++ S      L  L L +N++V V G  LA   
Sbjct: 184 TKVDAASLKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLNNNKLVKVPG-GLADHK 242

Query: 338 NLTTLDLSHNFLRALTQDLITP------LKSLQELRLDDNDISMEP 377
            +  + L +N + A+  +   P        S   + L  N +    
Sbjct: 243 YIQVVYLHNNNISAIGSNDFCPPGYNTKKASYSGVSLFSNPVQYWE 288


>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query694
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.96
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.96
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.94
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.93
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.93
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.92
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.92
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.91
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.9
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.87
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.84
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.81
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.79
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.78
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.77
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.76
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.75
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.71
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.71
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.7
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.69
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.68
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.63
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.52
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.46
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.44
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.43
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.42
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.41
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.39
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.39
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.38
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.37
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.34
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.18
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.18
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.37
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.25
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.4
d1qz1a3100 Neural cell adhesion molecule (NCAM) {Rat (Rattus 96.79
d2c9aa196 Receptor-type tyrosine-protein phosphatase mu {Hum 96.78
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.73
d1vcaa290 Vascular cell adhesion molecule-1 (VCAM-1) {Human 96.62
d3dara197 Fibroblast growth factor receptor, FGFR {Human (Ho 96.61
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 96.59
d2nxyb284 CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9 96.47
d1cs6a391 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 96.37
d1olza192 Semaphorin 4d Ig-like domain {Human (Homo sapiens) 96.37
d1epfa197 Neural cell adhesion molecule (NCAM) {Rat (Rattus 96.35
d1biha489 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 96.29
d1fhga_102 Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103 96.23
d1cs6a2105 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 96.19
d1gsma190 Mucosal addressin cell adhesion molecule-1 (MADCAM 96.18
d1rhfa191 Tyrosine-protein kinase receptor tyro3, N-terminal 96.1
d1epfa292 Neural cell adhesion molecule (NCAM) {Rat (Rattus 96.07
d1gl4b_89 Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 96.04
d1iray1101 Type-1 interleukin-1 receptor {Human (Homo sapiens 96.02
d1wiua_93 Twitchin {Nematode (Caenorhabditis elegans) [TaxId 95.93
d1biha2111 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 95.89
d1cs6a489 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 95.86
d1biha397 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 95.8
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 95.79
d1g1ca_98 Titin {Human (Homo sapiens), different modules [Ta 95.78
d1wwca_105 NT3 binding domain of trkC receptor {Human (Homo s 95.68
d1he7a_107 High affinity nerve growth factor receptor TrkA, d 95.68
d2fdbp2109 Fibroblast growth factor receptor, FGFR {Human (Ho 95.63
d1biha194 Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} 95.62
d1cs6a197 Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} 95.55
d1l6za1107 Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), N-t 95.53
d1f97a2110 Junction adhesion molecule, JAM, C-terminal domain 95.49
d1x44a190 Myosin-binding protein C, slow-type {Human (Homo s 95.36
d1l6za296 Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), C-t 95.23
d1tnna_91 Titin {Human (Homo sapiens), different modules [Ta 95.23
d2avga1110 Cardiac myosin binding protein C, different domain 95.18
d2aw2a1104 B- and T-lymphocyte attenuator CD272 {Human (Homo 95.17
d2cqva1101 Telokin {Human (Homo sapiens) [TaxId: 9606]} 95.09
d1wwbx_103 Ligand binding domain of trkB receptor {Human (Hom 95.06
d2oz4a384 Intercellular adhesion molecule-1, ICAM-1 {Human ( 95.03
d1koaa197 Twitchin {Nematode (Caenorhabditis elegans) [TaxId 94.92
d2fcba288 Fc gamma receptor ectodomain (CD32) {Human (Homo s 94.89
d3b5ha1101 Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 960 94.75
d2ifga192 High affinity nerve growth factor receptor TrkA, d 94.67
d1fnla289 Fc gamma receptor ectodomain (CD32) {Human (Homo s 94.62
d1n26a193 Interleukin-6 receptor alpha chain, N-terminal dom 94.61
d1f97a1102 Junction adhesion molecule, JAM, N-terminal domain 94.33
d1nbqa1105 Junction adhesion molecule, JAM, N-terminal domain 94.21
d2crya1115 Kin of IRRE-like protein 3, KIRREL3 {Human (Homo s 94.14
d1iray2103 Type-1 interleukin-1 receptor {Human (Homo sapiens 94.12
d1iray3107 Type-1 interleukin-1 receptor {Human (Homo sapiens 94.08
d1gxea_130 Cardiac myosin binding protein C, different domain 93.93
d1iama1103 Intercellular cell adhesion molecule-1 (ICAM-1) {H 93.88
d1rhfa285 Tyrosine-protein kinase receptor tyro3, second dom 93.62
d1hnga198 CD2, first domain {Rat (Rattus norvegicus) [TaxId: 93.57
d2dava1113 Myosin-binding protein C, slow-type {Human (Homo s 93.53
d1nbqa2104 Junction adhesion molecule, JAM, C-terminal domain 93.21
d1f2qa289 IgE high affinity receptor alpha subunit {Human (H 93.21
d1pd6a_94 Cardiac myosin binding protein C, different domain 92.83
d1fnla184 Fc gamma receptor ectodomain (CD32) {Human (Homo s 92.23
d1pkoa_126 Myelin oligodendrocyte glycoprotein (MOG) {Rat (Ra 91.28
d1zxqa1106 Intercellular cell adhesion molecule-2 (ICAM-2) {H 90.99
d2fcba185 Fc gamma receptor ectodomain (CD32) {Human (Homo s 90.39
d1eaja_124 Coxsackie virus and adenovirus receptor (Car), dom 88.66
d1ccza193 CD2-binding domain of CD58, N-terminal domain {Hum 87.98
d1tiua_89 Twitchin {Human (Homo sapiens), Ig repeat 27 [TaxI 87.9
d1f2qa182 IgE high affinity receptor alpha subunit {Human (H 87.81
d1dr9a1105 CD80, N-terminal domain {Human (Homo sapiens) [Tax 86.54
d1ncna_110 CD86 (b7-2), N-terminal domain {Human (Homo sapien 85.25
d1neua_119 Myelin membrane adhesion molecule P0 {Rat (Rattus 81.35
d2nxyb197 CD4 V-set domains {Human (Homo sapiens) [TaxId: 96 80.4
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Ngr ectodomain-like
domain: Decorin
species: Cow (Bos taurus) [TaxId: 9913]
Probab=99.96  E-value=7.8e-28  Score=251.07  Aligned_cols=271  Identities=24%  Similarity=0.347  Sum_probs=229.2

Q ss_pred             EEEcCCCCCCCCCccccCCCCccEEEccCCCCCCCCcchhcCCCCCccEEEccCCCCCCCCccccccCCCCccEEEccCC
Q psy8879          99 LLDCTLSNVTVLPGKFLEGVTLHGLVISSGELKNISDGAFIGLSSPLQALGLPNNLLSVVPTSALAPLAPNLDRLDLSHN  178 (694)
Q Consensus        99 ~Ldls~n~l~~lp~~~~~~~~L~~L~Ls~n~i~~i~~~~F~~l~~~L~~L~Ls~N~L~~lp~~~~~~l~~~L~~L~Ls~N  178 (694)
                      .+||++++++.+|..+.  +++++|++++|+|+.+++.+|.++. +|++|++++|.+..+++..|.++ ++|++|++++|
T Consensus        14 ~~~C~~~~L~~lP~~l~--~~l~~L~Ls~N~i~~l~~~~f~~l~-~L~~L~l~~n~~~~i~~~~f~~l-~~L~~L~l~~n   89 (305)
T d1xkua_          14 VVQCSDLGLEKVPKDLP--PDTALLDLQNNKITEIKDGDFKNLK-NLHTLILINNKISKISPGAFAPL-VKLERLYLSKN   89 (305)
T ss_dssp             EEECTTSCCCSCCCSCC--TTCCEEECCSSCCCCBCTTTTTTCT-TCCEEECCSSCCCCBCTTTTTTC-TTCCEEECCSS
T ss_pred             EEEecCCCCCccCCCCC--CCCCEEECcCCcCCCcChhHhhccc-cccccccccccccccchhhhhCC-CccCEecccCC
Confidence            46777778888888764  5789999999999999888888776 49999999999999988889988 89999999999


Q ss_pred             CCCCCCcccccCCCCccEEEecCCCCCCCCccccCCCCCCcEEeccCCccc--chhhhhhccCcccccccCCCCcCCCCC
Q psy8879         179 QLYKLENTSFKGLSSLNFLDLSYNKLMTLSQDCLAPLVTLRVLRLQGNRLT--VSVVAALQGLRSVTDLDLSHNLLAGPL  256 (694)
Q Consensus       179 ~L~~i~~~~f~~L~~L~~L~Ls~N~l~~i~~~~f~~L~~L~~L~Ls~N~l~--~~~~~~~~~L~~L~~L~Ls~N~l~~~i  256 (694)
                      +++.++...   ...++.|++.+|.+..+.+..+.....+..++...|...  ...+..+..+++|+++++++|.+.. +
T Consensus        90 ~l~~l~~~~---~~~l~~L~~~~n~l~~l~~~~~~~~~~~~~l~~~~n~~~~~~~~~~~~~~l~~L~~l~l~~n~l~~-l  165 (305)
T d1xkua_          90 QLKELPEKM---PKTLQELRVHENEITKVRKSVFNGLNQMIVVELGTNPLKSSGIENGAFQGMKKLSYIRIADTNITT-I  165 (305)
T ss_dssp             CCSBCCSSC---CTTCCEEECCSSCCCBBCHHHHTTCTTCCEEECCSSCCCGGGBCTTGGGGCTTCCEEECCSSCCCS-C
T ss_pred             ccCcCccch---hhhhhhhhccccchhhhhhhhhhccccccccccccccccccCCCccccccccccCccccccCCccc-c
Confidence            998887543   357889999999999998888888888889988887654  2345678888999999999998874 4


Q ss_pred             CCCCCCCccccceeeccCCcccccccccccCCcccceecccCCccccccchhhhcccccccccCCCCccccccccchhcc
Q psy8879         257 GPSTVPRLSSLKVLSIAHNQFSSVRRGALAGLDKLTSLSCHHNQIDVLEDHSFRALSTLSHLDLAHNRIVAVSGASLAHL  336 (694)
Q Consensus       257 ~p~~~~~l~~L~~L~Ls~N~L~~i~~~~~~~L~~L~~L~Ls~N~L~~i~~~~f~~l~~L~~L~Ls~N~L~~i~~~~f~~l  336 (694)
                       +..  ..++|+.|++++|......+..|.+++.+++|++++|.++.+++..|.++++|++|+|++|+|+.+ |..|.++
T Consensus       166 -~~~--~~~~L~~L~l~~n~~~~~~~~~~~~~~~l~~L~~s~n~l~~~~~~~~~~l~~L~~L~L~~N~L~~l-p~~l~~l  241 (305)
T d1xkua_         166 -PQG--LPPSLTELHLDGNKITKVDAASLKGLNNLAKLGLSFNSISAVDNGSLANTPHLRELHLNNNKLVKV-PGGLADH  241 (305)
T ss_dssp             -CSS--CCTTCSEEECTTSCCCEECTGGGTTCTTCCEEECCSSCCCEECTTTGGGSTTCCEEECCSSCCSSC-CTTTTTC
T ss_pred             -Ccc--cCCccCEEECCCCcCCCCChhHhhccccccccccccccccccccccccccccceeeeccccccccc-ccccccc
Confidence             332  257899999999999999888999999999999999999999999999999999999999999998 4578999


Q ss_pred             cccCeeecCCCCCCCcChhhhC------CCCCCCEEEccCCCCC--CCCcccc
Q psy8879         337 SNLTTLDLSHNFLRALTQDLIT------PLKSLQELRLDDNDIS--MEPECIY  381 (694)
Q Consensus       337 ~~L~~L~Ls~N~L~~l~~~~~~------~l~~L~~L~Ls~N~L~--~l~~~~f  381 (694)
                      ++|+.|+|++|+|+.++...|.      .+.+|+.|+|++|+|+  .+++..|
T Consensus       242 ~~L~~L~Ls~N~i~~i~~~~f~~~~~~~~~~~L~~L~L~~N~~~~~~~~~~~f  294 (305)
T d1xkua_         242 KYIQVVYLHNNNISAIGSNDFCPPGYNTKKASYSGVSLFSNPVQYWEIQPSTF  294 (305)
T ss_dssp             SSCCEEECCSSCCCCCCTTSSSCSSCCTTSCCCSEEECCSSSSCGGGSCGGGG
T ss_pred             cCCCEEECCCCccCccChhhccCcchhcccCCCCEEECCCCcCccCcCCHhHh
Confidence            9999999999999998776553      4688999999999987  3444444



>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1qz1a3 b.1.1.4 (A:190-289) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2c9aa1 b.1.1.4 (A:184-279) Receptor-type tyrosine-protein phosphatase mu {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1vcaa2 b.1.1.4 (A:1-90) Vascular cell adhesion molecule-1 (VCAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3dara1 b.1.1.4 (A:153-249) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR2a [TaxId: 9606]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2nxyb2 b.1.1.3 (B:1098-1181) CD4 C2-set domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cs6a3 b.1.1.4 (A:209-299) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1olza1 b.1.1.4 (A:537-628) Semaphorin 4d Ig-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1epfa1 b.1.1.4 (A:1-97) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1biha4 b.1.1.4 (A:307-395) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d1fhga_ b.1.1.4 (A:) Telokin {Turkey (Meleagris gallopavo) [TaxId: 9103]} Back     information, alignment and structure
>d1cs6a2 b.1.1.4 (A:104-208) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1gsma1 b.1.1.4 (A:1-90) Mucosal addressin cell adhesion molecule-1 (MADCAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rhfa1 b.1.1.1 (A:7-97) Tyrosine-protein kinase receptor tyro3, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1epfa2 b.1.1.4 (A:98-189) Neural cell adhesion molecule (NCAM) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gl4b_ b.1.1.4 (B:) Perlecan Ig3 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1iray1 b.1.1.4 (Y:1-101) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wiua_ b.1.1.4 (A:) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1biha2 b.1.1.4 (A:99-209) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d1cs6a4 b.1.1.4 (A:300-388) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1biha3 b.1.1.4 (A:210-306) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1g1ca_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Back     information, alignment and structure
>d1wwca_ b.1.1.4 (A:) NT3 binding domain of trkC receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1he7a_ b.1.1.4 (A:) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fdbp2 b.1.1.4 (P:2252-2360) Fibroblast growth factor receptor, FGFR {Human (Homo sapiens), FGFR1 [TaxId: 9606]} Back     information, alignment and structure
>d1biha1 b.1.1.4 (A:5-98) Hemolin {Moth (Hyalophora cecropia) [TaxId: 7123]} Back     information, alignment and structure
>d1cs6a1 b.1.1.4 (A:7-103) Axonin-1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1l6za1 b.1.1.1 (A:1-107) Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1f97a2 b.1.1.4 (A:129-238) Junction adhesion molecule, JAM, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x44a1 b.1.1.4 (A:8-97) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l6za2 b.1.1.4 (A:108-203) Biliary glycoprotein C (CD66a, CEACAM1A[1,4]), C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tnna_ b.1.1.4 (A:) Titin {Human (Homo sapiens), different modules [TaxId: 9606]} Back     information, alignment and structure
>d2avga1 b.1.1.4 (A:1-110) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2aw2a1 b.1.1.1 (A:34-137) B- and T-lymphocyte attenuator CD272 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqva1 b.1.1.4 (A:8-108) Telokin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwbx_ b.1.1.4 (X:) Ligand binding domain of trkB receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2oz4a3 b.1.1.4 (A:367-450) Intercellular adhesion molecule-1, ICAM-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koaa1 b.1.1.4 (A:6265-6361) Twitchin {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2fcba2 b.1.1.4 (A:91-178) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIb [TaxId: 9606]} Back     information, alignment and structure
>d3b5ha1 b.1.1.4 (A:103-203) Cervical EMMPRIN {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga1 b.1.1.4 (A:192-283) High affinity nerve growth factor receptor TrkA, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnla2 b.1.1.4 (A:87-175) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]} Back     information, alignment and structure
>d1n26a1 b.1.1.4 (A:1-93) Interleukin-6 receptor alpha chain, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f97a1 b.1.1.1 (A:27-128) Junction adhesion molecule, JAM, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nbqa1 b.1.1.1 (A:25-129) Junction adhesion molecule, JAM, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2crya1 b.1.1.1 (A:8-122) Kin of IRRE-like protein 3, KIRREL3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iray2 b.1.1.4 (Y:102-204) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iray3 b.1.1.4 (Y:205-311) Type-1 interleukin-1 receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gxea_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iama1 b.1.1.3 (A:83-185) Intercellular cell adhesion molecule-1 (ICAM-1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rhfa2 b.1.1.4 (A:98-182) Tyrosine-protein kinase receptor tyro3, second domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hnga1 b.1.1.1 (A:2-99) CD2, first domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2dava1 b.1.1.4 (A:8-120) Myosin-binding protein C, slow-type {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nbqa2 b.1.1.4 (A:130-233) Junction adhesion molecule, JAM, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f2qa2 b.1.1.4 (A:86-174) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pd6a_ b.1.1.4 (A:) Cardiac myosin binding protein C, different domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fnla1 b.1.1.4 (A:3-86) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), III [TaxId: 9606]} Back     information, alignment and structure
>d1pkoa_ b.1.1.1 (A:) Myelin oligodendrocyte glycoprotein (MOG) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1zxqa1 b.1.1.3 (A:87-192) Intercellular cell adhesion molecule-2 (ICAM-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcba1 b.1.1.4 (A:6-90) Fc gamma receptor ectodomain (CD32) {Human (Homo sapiens), IIb [TaxId: 9606]} Back     information, alignment and structure
>d1eaja_ b.1.1.1 (A:) Coxsackie virus and adenovirus receptor (Car), domain 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ccza1 b.1.1.1 (A:1-93) CD2-binding domain of CD58, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tiua_ b.1.1.4 (A:) Twitchin {Human (Homo sapiens), Ig repeat 27 [TaxId: 9606]} Back     information, alignment and structure
>d1f2qa1 b.1.1.4 (A:4-85) IgE high affinity receptor alpha subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dr9a1 b.1.1.1 (A:1-105) CD80, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ncna_ b.1.1.1 (A:) CD86 (b7-2), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1neua_ b.1.1.1 (A:) Myelin membrane adhesion molecule P0 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2nxyb1 b.1.1.1 (B:1001-1097) CD4 V-set domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure