Psyllid ID: psy8892

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-------830-------840-------850-------860-------870-------880-------890-------900-------910-------920-------930-------940-------950-------960-------970-------980-------990------1000------1010------1020------1030------1040------1050------1060------1070------1080------1090------1100------1110------1120------1130------1140------1150------1160------1170------1180---
MEYTWLLLVFIVGAQGQVFRRIVDRIIKDNLLTPSDAVPDLKSFAEEYDFIVVGSGSGGSVVANRLTENSNWTVLLLEAGPEEIILDEIPLFVSHIVSSDFNWGYTTEKTDGICKGMKNQRCNWPRGKVMGGTSVTNYMVYTRGVPHDYDGWAAPKIPTGKVMGGTSVTNYMVYTRGVPHDYDGWAALGNIGWSFEEVLPYFKKSEDMKTAELKSSPYHGVGGYLKIERPLWRTPLAKCVLDAGHEMGYDIVDPSEPNAIGFSYVLANTGNGERYSASRAFLRPIRKRPNLKVAKRARVTKVLIDENDNLKRATGVEFFKNKQRHTVRARKEVILSAGALNSPQLLMLSGIGPRDHLEEMNIPVIQDLKVGYNLQDHVSMAGLVFLVNDSVTIVELLMLSGIGPRDHLEEMNIPVIEDLKVGYNLQDHVSMAGLVFLVNDSVTIVESQFQKPRYIVDYWFRRQGPYTSPGGAETMALISSKFENDKTRPDIELVFGPGALTGDSNGSLRSLLGISDKFYRKVYQPYFERQAYNIVPLILRPFSRGFVKLRSSNPFDSPKFYPNYLSDSRDLDVLIEAIKMCALFSLVCHLLVLSVAHAQSQLFRTECALFSLVCHLLLLSVAHAQSQLFRTFINMVSKDAILTPSNIVQDTKIFEKEYDFIVIGAGSGGSVIANRLTENPNWTVLLLEAGREESLLTDVPLFVSYMVDTDFNWGYKTEKDERFCRGMSDQTCNWPRGKAMGGTSVINYMVYSRGVPQDFDNWEALGNPGWSYRDVLPYFKKSEDISVSRLKGSPYHGIGGYLKVEQTSWRTPLSAAFLEAGSELGYDQVDHCENPIGFSYVLANKIRGARQSASKAFIRPIRKRHNLKVAKEARVTKILIDPITKRTYGVEFSKNRKSYTVKCRKEVILSAGTLNSPQLLMLSGVGPRPHLEELNIPVIQDLKVGYNMQDHLSMAGLVFLVNSSVTIVESKYTKPRYLMDFLVNGAGPLTLPGGAEALAFYPTKYAEDPNHPDMEIVFGPGALTGDSGGSLRKVLGISDKFYNKVYRPFAEREAYSIVPVLVRPRSRGFVRLSRGFVKLRSSNPFDSPKFYPNYLSDSRDLDVLIEAIKMAVELSETRAMQKYASKLLPVKFPGCEPYEFRSDEYWACAARQLTTNLHHQICPHIADAVDRRGEIMLSSPSTE
cccHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccEEEEccccHHHHHHHccccccccEEEEEcccccccccccccHHHHccccccccccccccccccccccccccEEEcccccccccccccccEEEEcccccccccccccccccccccccccccccEEEEcccccccHHHHHccccccccccccHHHHHccccccccccccccccccccEEEEccccccHHHHHHHHHHHHcccccccccccccEEEcccEEccccccccccccccccccccccccEEEcccEEEEEEEEccccccEEEEEEEEEccEEEEEEEccEEEEcccccccHHHHHHcccccHHHHHHcccccEEccccccccccccccccEEEEEccccHHHHHHHHccccccccccccccccHHccccccccccccccccEEEEEcccccccccccccHHHHHHHHHHccccccccccccEEEEEEcccccccccccEEEEEccEEEccccccccHHHccccHHHHHHHcccccccccEEEEEEccccccEEEEEEccccccccccccccccccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHccccccccccccccHHHHHccccccccccccccccccccccccEEEEEEEcccccHHHHHHccccccccEEEEEcccccccccccHHHHHHccccccccccccccccccccccccccccccccccccccHHHHHHHHHHccccccHHHHHHccccccccccccHHHHHcccccccccccccccccccccEEEccccccHHHHHHHHHHHHccccccccccccEEEcccEEEcccccccccccccccccccccccEEEcccEEEEEEEEccccEEEEEEEEEccEEEEEEEccEEEEEccccccHHHHHHcccccHHHHHHcccccEEccccccccccccccccEEEEEcccccccccccccHHHHHHHHHccccccccccccEEEEEEEcccccccccccEEEEEcccccccccccccHHHccccHHHHHHHcccccccccEEEEEEEEccccccEEEEcccEEEcccccccccccccccccccHHHHHHHHHHHHHHHHHHccHHHHHHHccccccccccccccccccHHHHHHHHHHccccccccccccccccccccccEEccccccc
ccHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHccccEEEEEEcccHHHHHHHHHHccccccEEEEEEccccccHHHHHHHHHHHHcccccccEEEEcccccHHHcccccccccccccEcccccHHHHEEEEEccccccccccEEEcccccEEccccHHHHEHHEcccHHHHHHHHHcccccccHHHHHHHHHHHHHcccccccccccccccccEEEcccccccHHHHHHHHHHHHcccccccccccccccccccccEcccccEccHHHHHcHHHcccccEEEEcccEEEEEEEEccccccEEEEEEEEEEcEEEEEEEEEEEEEccccccHHHHHHHccEEcHHHHHHccccccEEccccccEEccEEcccEEEEcccccccHHHHccccHHHHHHHHHccccccccccccccHHHHccHHHEHHcccccccccccccccHHHHHHHHHHcccccccccccEEEEEEEcccccccccccEEEEEEcccccccccHHHHHHccccHHHHHHHHHHHcccccEEEEEccccccccEEEEEEcccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHcccccccccccccHHccccEEEEEEEcccHHHHHHHHHHHccccccEEEEcccccccHHcHHHHHHHHHcccccccEEEccccccHHHcccccccccccccEEcccHHHHHEHHEcccHHHHHHHHHcccccccHHHHHHHHHHHHHcccccccccccccccccEEEcccccccHHHHHHHHHHHHcccccccccccccccccccEEcccccEccHHHHHHcHHHcccccEEEEEEEEEEEEEcccccEEEEEEEEEccEEEEEEEEEEEEEccccccHHHHHHHccEEcHHHHHHccccccEEccccccEEcHHHEcEEEEEEcccEEEcccHcccHHHHHHHHHcccccccccccEEEEEEEEcccccccccccEEEEEEcccccccccHHHHHHccccHHHHHHHHcHHcccccEEEEEcccccccccccccccEEEEEEcccccccccccccccccHHHHHHHHHHHHHHHHHHccHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHccccccccccccccccccEEEEccccc
MEYTWLLLVFIVGAQGQVFRRIVDRIikdnlltpsdavpdlksfaeeYDFIVVGSGSGGSVVANRLTENSNWTVLLLeagpeeiildeiplFVSHIVssdfnwgyttektdgickgmknqrcnwprgkvmggtsvTNYMVYTrgvphdydgwaapkiptgkvmggtsvTNYMVYTrgvphdydgwaALGNIgwsfeevlpyfkksedmktaelksspyhgvggylkierplwrtplakCVLDaghemgydivdpsepnaiGFSYVLAntgngerysasRAFLrpirkrpnlkvakRARVTKVLIDendnlkratgveffknkqrhtVRARKEVILsagalnspqllmlsgigprdhleemnipviqdlkvgynlqdhvSMAGLVFLVNDSVTIVELLMlsgigprdhleemnipviedlkvgynlqdhvSMAGLVFLVNDsvtivesqfqkpryivdywfrrqgpytspggaETMALISSKfendktrpdielvfgpgaltgdsngslrsllgisdkfYRKVYqpyferqaynivplilrpfsrgfvklrssnpfdspkfypnylsdsrdLDVLIEAIKMCALFSLVCHLLVLSVAHAQSQLFRTECALFSLVCHLLLLSVAHAQSQLFRTFINMVskdailtpsnivqdtkifekEYDFIVIGAGSGGSVIAnrltenpnWTVLLLEAgreeslltdVPLFVSYMVdtdfnwgyktekderfcrgmsdqtcnwprgkamggtSVINYMVYsrgvpqdfdnwealgnpgwsyrdvlpyfkksedisvsrlkgspyhgiggylkveqtswrtpLSAAFLEAgselgydqvdhcenpiGFSYVLANKIRGARQSASKAFIRPIRKRHNLKVAKEARVTKIlidpitkrtygvefsknrksytvkcrKEVIlsagtlnspqllmlsgvgprphleelnipviqdlkvgynmqdHLSMAGLVFLVNSsvtiveskytkprYLMDFLVngagpltlpggaealafyptkyaedpnhpdmeivfgpgaltgdsggslrkvlgisdkfynkvyrpfaereaysivpvlvrprsrgfvrLSRGFvklrssnpfdspkfypnylsdsrdLDVLIEAIKMAVELSETRAMQKYASkllpvkfpgcepyefrsdEYWACAARQLTTNlhhqicphiadavdrrgeimlsspste
MEYTWLLLVFIVGAQGQVFRRIVDRiikdnlltpsdavPDLKSFAEEYDFIVVGSGSGGSVVANRLTENSNWTVLLLEAGPEEIILDEIPLFVSHIVSSDFNWGYTTEKTDGICkgmknqrcnwprgkvMGGTSVTNYMVYTRGVPHDYDGWAAPKIPTGKVMGGTSVTNYMVYTRGVPHDYDGWAALGNIGWSFEEVLPYFKKSEDMKTAelksspyhgvggyLKIERPLWRTPLAKCVLDAGHEMGYDIVDPSEPNAIGFSYVLANTGNGERYSASraflrpirkrpnlkvakrarvtkvlidendnlkratgveffknkqrhtvrARKEVIlsagalnspqlLMLSGIGPRDHLEEMNIPVIQDLKVGYNLQDHVSMAGLVFLVNDSVTIVELLMLSGIGPRDHLEEMNIPVIEDLKVGYNLQDHVSMAGLVFLVNDSVTIVESQFQKPRYIVDYWFRRQGPYTSPGGAETMALISSKFENDKTRPDIELVFgpgaltgdsngslRSLLGISDKFYRKVYQPYFERQAYNIVPLILRPFSRGFVKLRssnpfdspkfypNYLSDSRDLDVLIEAIKMCALFSLVCHLLVLSVAHAQSQLFRTECALFSLVCHLLLLSVAHAQSQLFRTFINMVSKDAILTPSNIVQDTKIFEKEYDFIVIGAGSGGSVIANRLTENPNWTVLLLEAGREESLLTDVPLFVSYMVDTDFNWGYKTEKDERFCRGMSDqtcnwprgkaMGGTSVINYMVYSRGVPQDFDNWEALGNPGWSYRDVLPYFKKsedisvsrlkgspyhgIGGYLKVEQTSWRTPLSAAFLEAGSELGYDQVDHCENPIGFSYVLANKIRGARQSaskafirpirkrhnlkvakearvtkilidpitkrtygvefsknrksytvkcRKEVIlsagtlnspqlLMLSGVGPRPHLEELNIPVIQDLKVGYNMQDHLSMAGLVFLVNSSVTIVESKYTKPRYLMDFLVNGAGPLTLPGGAEALAFYPTKYAEDPNHPDMEIVFGPGALTGDSGGSLRKVLGISDKFYNKVyrpfaereaysivpvlvrprsrgfVRLSRgfvklrssnpfdspkfypnylsDSRDLDVLIEAIKMAVELSETRAMQKYASKLLPVKFPGCEPYEFRSDEYWACAARQLTTNLHHQICPHIADAVDRRGEIMLSSPSTE
MEYTWLLLVFIVGAQGQVFRRIVDRIIKDNLLTPSDAVPDLKSFAEEYDFIvvgsgsggsvvANRLTENSNWTVLLLEAGPEEIILDEIPLFVSHIVSSDFNWGYTTEKTDGICKGMKNQRCNWPRGKVMGGTSVTNYMVYTRGVPHDYDGWAAPKIPTGKVMGGTSVTNYMVYTRGVPHDYDGWAALGNIGWSFEEVLPYFKKSEDMKTAELKSSPYHGVGGYLKIERPLWRTPLAKCVLDAGHEMGYDIVDPSEPNAIGFSYVLANTGNGERYSASRAFLRPIRKRPNLKVAKRARVTKVLIDENDNLKRATGVEFFKNKQRHTVRARKEVILSAGALNSPQLLMLSGIGPRDHLEEMNIPVIQDLKVGYNLQDHVSMAGLVFLVNDSVTIVELLMLSGIGPRDHLEEMNIPVIEDLKVGYNLQDHVSMAGLVFLVNDSVTIVESQFQKPRYIVDYWFRRQGPYTSPGGAETMALISSKFENDKTRPDIELVFGPGALTGDSNGSLRSLLGISDKFYRKVYQPYFERQAYNIVPLILRPFSRGFVKLRSSNPFDSPKFYPNYLSDSRDLDVLIEAIKMCALFSLVCHLLVLSVAHAQSQLFRTEcalfslvchllllsvahAQSQLFRTFINMVSKDAILTPSNIVQDTKIFEKEYDFivigagsggsviaNRLTENPNWTVLLLEAGREESLLTDVPLFVSYMVDTDFNWGYKTEKDERFCRGMSDQTCNWPRGKAMGGTSVINYMVYSRGVPQDFDNWEALGNPGWSYRDVLPYFKKSEDISVSRLKGSPYHGIGGYLKVEQTSWRTPLSAAFLEAGSELGYDQVDHCENPIGFSYVLANKIRGARQSASKAFIRPIRKRHNLKVAKEARVTKILIDPITKRTYGVEFSKNRKSYTVKCRKEVILSAGTLNSPQLLMLSGVGPRPHLEELNIPVIQDLKVGYNMQDHLSMAGLVFLVNSSVTIVESKYTKPRYLMDFLVNGAGPLTLPGGAEALAFYPTKYAEDPNHPDMEIVFGPGALTGDSGGSLRKVLGISDKFYNKVYRPFAEREAYSIVPVLVRPRSRGFVRLSRGFVKLRSSNPFDSPKFYPNYLSDSRDLDVLIEAIKMAVELSETRAMQKYASKLLPVKFPGCEPYEFRSDEYWACAARQLTTNLHHQICPHIADAVDRRGEIMLSSPSTE
**YTWLLLVFIVGAQGQVFRRIVDRIIKDNLLTPSDAVPDLKSFAEEYDFIVVGSGSGGSVVANRLTENSNWTVLLLEAGPEEIILDEIPLFVSHIVSSDFNWGYTTEKTDGICKGMKNQRCNWPRGKVMGGTSVTNYMVYTRGVPHDYDGWAAPKIPTGKVMGGTSVTNYMVYTRGVPHDYDGWAALGNIGWSFEEVLPYFKK***********SPYHGVGGYLKIERPLWRTPLAKCVLDAGHEMGYDIVDPSEPNAIGFSYVLANTGNGERYSASRAFLRPIRKRPNLKVAKRARVTKVLIDENDNLKRATGVEFFKNKQRHTVRARKEVILSAGALNSPQLLMLSGIGPRDHLEEMNIPVIQDLKVGYNLQDHVSMAGLVFLVNDSVTIVELLMLSGIGPRDHLEEMNIPVIEDLKVGYNLQDHVSMAGLVFLVNDSVTIVESQFQKPRYIVDYWFRRQGPYT**********************DIELVFGPGALTGDSNGSLRSLLGISDKFYRKVYQPYFERQAYNIVPLILRPFSRGFVKLRSSNPFDSPKFYPNYLSDSRDLDVLIEAIKMCALFSLVCHLLVLSVAHAQSQLFRTECALFSLVCHLLLLSVAHAQSQLFRTFINMVSKDAILTPSNIVQDTKIFEKEYDFIVIGAGSGGSVIANRLTENPNWTVLLLEAGREESLLTDVPLFVSYMVDTDFNWGYKTEKDERFCRGMSDQTCNWPRGKAMGGTSVINYMVYSRGVPQDFDNWEALGNPGWSYRDVLPYFKKSEDISVSRLKGSPYHGIGGYLKVEQTSWRTPLSAAFLEAGSELGYDQVDHCENPIGFSYVLANKIRGARQSASKAFIRPIRKRHNLKVAKEARVTKILIDPITKRTYGVEFSKNRKSYTVKCRKEVILSAGTLNSPQLLMLSGVGPRPHLEELNIPVIQDLKVGYNMQDHLSMAGLVFLVNSSVTIVESKYTKPRYLMDFLVNGAGPLTLPGGAEALAFYPTKYAEDPNHPDMEIVFGPGALTGDSGGSLRKVLGISDKFYNKVYRPFAEREAYSIVPVLVRPRSRGFVRLSRGFVKLRSSNPFDSPKFYPNYLSDSRDLDVLIEAIKMAVELSETRAMQKYASKLLPVKFPGCEPYEFRSDEYWACAARQLTTNLHHQICPHIADAVD*************
**YTWLLLVFIVGAQGQVFRRIVDRIIKDNLL**********SFAEEYDFIVVGSGSGGSVVANRLTENSNWTVLLLEAGPEEIILDEIPLFVSHIVSSDFNWGYTTEKTDGICKGMKNQRCNWPRGKVMGGTSVTNYMVYTRGVPHDYDGWAAPKIPTGKVMGGTSVTNYMVYTRGVPHDYDGWAALGNIGWSFEEVLPYFKKSEDMKTAELKSSPYHGVGGYLKIERPLWRTPLAKCVLDAGHEMGYDIVDPSEPNAIGFSYVLANTGNGERYSASRAFLRPIRKRPNLKVAKRARVTKVLIDENDNLKRATGVEFFKNKQRHTVRARKEVILSAGALNSPQLLMLSGIGPRDHLEEMNIPVIQDLKVGYNLQDHVSMAGLVFLVNDSVTIVELLMLSGIGPRDHLEEMNIPVIEDLKVGYNLQDHVSMAGLVFLVNDSVTIVESQFQKPRYIVDYWFRRQGPYTSPGGAETMALISSKFENDKTRPDIELVFGPGALTGDSNGSLRSLLGISDKFYRKVYQPYFERQAYNIVPLILRPFSRGFVKLRSSNPFDSPKFYPNYLSDSRDLDVLIEAIKMCALFSLVCHLLVLSVAHAQSQLFRTECALFSLVCHLLLLSVAHAQSQLFRTFINMVSKDAILTPSNIVQDTKIFEKEYDFIVIGAGSGGSVIANRLTENPNWTVLLLEAGREESLLTDVPLFVSYMVDTDFNWGYKTEKDERFCRGMSDQTCNWPRGKAMGGTSVINYMVYSRGVPQDFDNWEALGNPGWSYRDVLPYFKKSEDISVSRLKGSPYHGIGGYLKVEQTSWRTPLSAAFLEAGSELGYDQVDHCENPIGFSYVLANKIRGARQSASKAFIRPIRKRHNLKVAKEARVTKILIDPITKRTYGVEFSKNRKSYTVKCRKEVILSAGTLNSPQLLMLSGVGPRPHLEELNIPVIQDLKVGYNMQDHLSMAGLVFLVNSSVTIVESKYTKPRYLMDFLVNGAGPLTLPGGAEALAFYPTKYAEDPNHPDMEIVFGPGALTGDSGGSLRKVLGISDKFYNKVYRPFAEREAYSIVPVLVRPRSRGFVRLSRGFVKLRSSNPFDSPKFYPNYLSDSRDLDVLIEAIKMAVELSETRAMQKYASKLLPVKFPGCEPYEFRSDEYWACAARQLTTNLHHQICPHIADAVDRRGEI*LS*****
MEYTWLLLVFIVGAQGQVFRRIVDRIIKDNLLTPSDAVPDLKSFAEEYDFIVVGSGSGGSVVANRLTENSNWTVLLLEAGPEEIILDEIPLFVSHIVSSDFNWGYTTEKTDGICKGMKNQRCNWPRGKVMGGTSVTNYMVYTRGVPHDYDGWAAPKIPTGKVMGGTSVTNYMVYTRGVPHDYDGWAALGNIGWSFEEVLPYFKKSEDMKTAELKSSPYHGVGGYLKIERPLWRTPLAKCVLDAGHEMGYDIVDPSEPNAIGFSYVLANTGNGERYSASRAFLRPIRKRPNLKVAKRARVTKVLIDENDNLKRATGVEFFKNKQRHTVRARKEVILSAGALNSPQLLMLSGIGPRDHLEEMNIPVIQDLKVGYNLQDHVSMAGLVFLVNDSVTIVELLMLSGIGPRDHLEEMNIPVIEDLKVGYNLQDHVSMAGLVFLVNDSVTIVESQFQKPRYIVDYWFRRQGPYTSPGGAETMALISSKFENDKTRPDIELVFGPGALTGDSNGSLRSLLGISDKFYRKVYQPYFERQAYNIVPLILRPFSRGFVKLRSSNPFDSPKFYPNYLSDSRDLDVLIEAIKMCALFSLVCHLLVLSVAHAQSQLFRTECALFSLVCHLLLLSVAHAQSQLFRTFINMVSKDAILTPSNIVQDTKIFEKEYDFIVIGAGSGGSVIANRLTENPNWTVLLLEAGREESLLTDVPLFVSYMVDTDFNWGYKTEKDERFCRGMSDQTCNWPRGKAMGGTSVINYMVYSRGVPQDFDNWEALGNPGWSYRDVLPYFKKSEDISVSRLKGSPYHGIGGYLKVEQTSWRTPLSAAFLEAGSELGYDQVDHCENPIGFSYVLANKIRGARQSASKAFIRPIRKRHNLKVAKEARVTKILIDPITKRTYGVEFSKNRKSYTVKCRKEVILSAGTLNSPQLLMLSGVGPRPHLEELNIPVIQDLKVGYNMQDHLSMAGLVFLVNSSVTIVESKYTKPRYLMDFLVNGAGPLTLPGGAEALAFYPTKYAEDPNHPDMEIVFGPGALTGDSGGSLRKVLGISDKFYNKVYRPFAEREAYSIVPVLVRPRSRGFVRLSRGFVKLRSSNPFDSPKFYPNYLSDSRDLDVLIEAIKMAVELSETRAMQKYASKLLPVKFPGCEPYEFRSDEYWACAARQLTTNLHHQICPHIADAVDRRGEI********
MEYTWLLLVFIVGAQGQVFRRIVDRIIKDNLLTPSDAVPDLKSFAEEYDFIVVGSGSGGSVVANRLTENSNWTVLLLEAGPEEIILDEIPLFVSHIVSSDFNWGYTTEKTDGICKGMKNQRCNWPRGKVMGGTSVTNYMVYTRGVPHDYDGWAAPKIPTGKVMGGTSVTNYMVYTRGVPHDYDGWAALGNIGWSFEEVLPYFKKSEDMKTAELKSSPYHGVGGYLKIERPLWRTPLAKCVLDAGHEMGYDIVDPSEPNAIGFSYVLANTGNGERYSASRAFLRPIRKRPNLKVAKRARVTKVLIDENDNLKRATGVEFFKNKQRHTVRARKEVILSAGALNSPQLLMLSGIGPRDHLEEMNIPVIQDLKVGYNLQDHVSMAGLVFLVNDSVTIVELLMLSGIGPRDHLEEMNIPVIEDLKVGYNLQDHVSMAGLVFLVNDSVTIVESQFQKPRYIVDYWFRRQGPYTSPGGAETMALISSKFENDKTRPDIELVFGPGALTGDSNGSLRSLLGISDKFYRKVYQPYFERQAYNIVPLILRPFSRGFVKLRSSNPFDSPKFYPNYLSDSRDLDVLIEAIKMCALFSLVCHLLVLSVAHAQSQLFRTECALFSLVCHLLLLSVAHAQSQLFRTFINMVSKDAILTPSNIVQDTKIFEKEYDFIVIGAGSGGSVIANRLTENPNWTVLLLEAGREESLLTDVPLFVSYMVDTDFNWGYKTEKDERFCRGMSDQTCNWPRGKAMGGTSVINYMVYSRGVPQDFDNWEALGNPGWSYRDVLPYFKKSEDISVSRLKGSPYHGIGGYLKVEQTSWRTPLSAAFLEAGSELGYDQVDHCENPIGFSYVLANKIRGARQSASKAFIRPIRKRHNLKVAKEARVTKILIDPITKRTYGVEFSKNRKSYTVKCRKEVILSAGTLNSPQLLMLSGVGPRPHLEELNIPVIQDLKVGYNMQDHLSMAGLVFLVNSSVTIVESKYTKPRYLMDFLVNGAGPLTLPGGAEALAFYPTKYAEDPNHPDMEIVFGPGALTGDSGGSLRKVLGISDKFYNKVYRPFAEREAYSIVPVLVRPRSRGFVRLSRGFVKLRSSNPFDSPKFYPNYLSDSRDLDVLIEAIKMAVELSETRAMQKYASKLLPVKFPGCEPYEFRSDEYWACAARQLTTNLHHQICPHIADAVDRRGEIMLSS*S**
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEYTWLLLVFIVGAQGQVFRRIVDRIIKDNLLTPSDAVPDLKSFAEEYDFIVVGSGSGGSVVANRLTENSNWTVLLLEAGPEEIILDEIPLFVSHIVSSDFNWGYTTEKTDGICKGMKNQRCNWPRGKVMGGTSVTNYMVYTRGVPHDYDGWAAPKIPTGKVMGGTSVTNYMVYTRGVPHDYDGWAALGNIGWSFEEVLPYFKKSEDMKTAELKSSPYHGVGGYLKIERPLWRTPLAKCVLDAGHEMGYDIVDPSEPNAIGFSYVLANTGNGERYSASRAFLRPIRKRPNLKVAKRARVTKVLIDENDNLKRATGVEFFKNKQRHTVRARKEVILSAGALNSPQLLMLSGIGPRDHLEEMNIPVIQDLKVGYNLQDHVSMAGLVFLVNDSVTIVELLMLSGIGPRDHLEEMNIPVIEDLKVGYNLQDHVSMAGLVFLVNDSVTIVESQFQKPRYIVDYWFRRQGPYTSPGGAETMALISSKFENDKTRPDIELVFGPGALTGDSNGSLRSLLGISDKFYRKVYQPYFERQAYNIVPLILRPFSRGFVKLRSSNPFDSPKFYPNYLSDSRDLDVLIEAIKMCALFSLVCHLLVLSVAHAQSQLFRTECALFSLVCHLLLLSVAHAQSQLFRTFINMVSKDAILTPSNIVQDTKIFEKEYDFIVIGAGSGGSVIANRLTENPNWTVLLLEAGREESLLTDVPLFVSYMVDTDFNWGYKTEKDERFCRGMSDQTCNWPRGKAMGGTSVINYMVYSRGVPQDFDNWEALGNPGWSYRDVLPYFKKSEDISVSRLKGSPYHGIGGYLKVEQTSWRTPLSAAFLEAGSELGYDQVDHCENPIGFSYVLANKIRGARQSASKAFIRPIRKRHNLKVAKEARVTKILIDPITKRTYGVEFSKNRKSYTVKCRKEVILSAGTLNSPQLLMLSGVGPRPHLEELNIPVIQDLKVGYNMQDHLSMAGLVFLVNSSVTIVESKYTKPRYLMDFLVNGAGPLTLPGGAEALAFYPTKYAEDPNHPDMEIVFGPGALTGDSGGSLRKVLGISDKFYNKVYRPFAEREAYSIVPVLVRPRSRGFVRLSRGFVKLRSSNPFDSPKFYPNYLSDSRDLDVLIEAIKMAVELSETRAMQKYASKLLPVKFPGCEPYEFRSDEYWACAARQLTTNLHHQICPHIADAVDRRGEIMLSSPSTE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query1183 2.2.26 [Sep-21-2011]
P18172625 Glucose dehydrogenase [ac no N/A 0.404 0.766 0.392 1e-100
P18173625 Glucose dehydrogenase [ac no N/A 0.404 0.766 0.384 5e-97
Q8NE62594 Choline dehydrogenase, mi yes N/A 0.359 0.715 0.350 1e-60
Q6UPE0599 Choline dehydrogenase, mi yes N/A 0.362 0.716 0.338 2e-60
P64264528 Uncharacterized GMC-type yes N/A 0.360 0.808 0.321 3e-60
P64263528 Uncharacterized GMC-type yes N/A 0.360 0.808 0.321 3e-60
Q8BJ64596 Choline dehydrogenase, mi yes N/A 0.362 0.719 0.331 2e-59
Q9WWW2552 Alcohol dehydrogenase [ac yes N/A 0.361 0.775 0.331 1e-56
A4JJG6566 Choline dehydrogenase OS= no N/A 0.390 0.816 0.315 7e-55
Q00593558 Alcohol dehydrogenase [ac N/A N/A 0.361 0.767 0.323 3e-54
>sp|P18172|DHGL_DROPS Glucose dehydrogenase [acceptor] OS=Drosophila pseudoobscura pseudoobscura GN=Gld PE=3 SV=4 Back     alignment and function desciption
 Score =  366 bits (939), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 199/507 (39%), Positives = 293/507 (57%), Gaps = 28/507 (5%)

Query: 657  EYDFIVIGAGSGGSVIANRLTENPNWTVLLLEAGREESLLTDVPLFVSYMVDTDFNWGYK 716
            EYDFIVIG GS GSV+A+RL+E P W VLL+EAG +E +   +P      + +D ++ Y 
Sbjct: 64   EYDFIVIGGGSAGSVVASRLSEVPQWKVLLIEAGGDEPVGAQIPSMFLNFIGSDIDYRYN 123

Query: 717  TEKDERFCRGMSDQTCNWPRGKAMGGTSVINYMVYSRGVPQDFDNWEALGNPGWSYRDVL 776
            TE +   C    +Q C WPRGK +GGTSV+N M+Y RG  +D+D+W A GNPGWSY+DVL
Sbjct: 124  TEPERMACLSSMEQRCYWPRGKVLGGTSVMNGMMYIRGNREDYDDWAAQGNPGWSYQDVL 183

Query: 777  PYFKKSEDISVSRLKGSPYHGIGGYLKVEQTSWRTPLSAAFLEAGSELGYDQVD-HCENP 835
            P+FKKSED       G+ YH  GG L V +  +  PLS A L+AG E+G+   D + +N 
Sbjct: 184  PFFKKSEDNLELDAVGTEYHAKGGLLPVGKFPYNPPLSYALLKAGEEMGFSVQDLNGQNS 243

Query: 836  IGFSYVLANKIRGARQSASKAFIRPIRKRHNLKVAKEARVTKILIDPITKRTYGVEFSKN 895
             GF         G R S+++AF+RP R R+NL +     VTK+LI P TK   GVE S  
Sbjct: 244  TGFMIAQMTARNGIRYSSARAFLRPARMRNNLHILLNTTVTKVLIHPGTKNVVGVEVSDQ 303

Query: 896  RKSY-TVKCRKEVILSAGTLNSPQLLMLSGVGPRPHLEELNI-PVIQDLKVGYNMQDHLS 953
              S   +  +KEVI+S G +NSPQ+L+LSGVGP+  L+++N+ PV     VG N+ +H++
Sbjct: 304  FGSMRKILVKKEVIVSGGAVNSPQILLLSGVGPKEDLQKVNVRPVHHLPGVGKNLHNHVA 363

Query: 954  MAGLVFLVNSSVTIVESKYTKPRYLMDFLVNGAGPLTLPGGAEALAFYPTKYAEDPNHPD 1013
                 +  N  +   ++        M++L+   G ++  G ++  A   T++A+ PN PD
Sbjct: 364  -----YFTNFFIDDADTAPLNWATAMEYLLFRDGLMSGTGISDVTAKMATRWADRPNLPD 418

Query: 1014 MEIVFGPGALTGDSGGSLRKVLGISDKFYNKVYRPFAEREAYSIVPVLVRPRSRGFVRLS 1073
            +++ FG    +    G + ++L  + +             A  I P ++ P+       S
Sbjct: 419  LQLYFGGYLASCARTGQVGELLSNNSR-------------AIQIFPAVLNPK-------S 458

Query: 1074 RGFVKLRSSNPFDSPKFYPNYLSDSRDLDVLIEAIKMAVELSETRAMQKYASKLLPVKFP 1133
            RG++ LRS++P D P+ + NYL+D RD+  L+E IK A+ LS+T  +++Y  +L      
Sbjct: 459  RGYITLRSADPLDPPRIFANYLTDERDVKTLVEGIKFAIRLSQTSPLKQYGMRLDKTVVK 518

Query: 1134 GCEPYEFRSDEYWACAARQLTTNLHHQ 1160
            GCE + F SD YW CA RQ T   +HQ
Sbjct: 519  GCESHAFASDAYWECAVRQNTGPENHQ 545

Drosophila pseudoobscura pseudoobscura (taxid: 46245)
EC: 1EC: .EC: 1EC: .EC: 9EC: 9EC: .EC: 1EC: 0
>sp|P18173|DHGL_DROME Glucose dehydrogenase [acceptor] OS=Drosophila melanogaster GN=Gld PE=3 SV=3 Back     alignment and function description
>sp|Q8NE62|CHDH_HUMAN Choline dehydrogenase, mitochondrial OS=Homo sapiens GN=CHDH PE=2 SV=2 Back     alignment and function description
>sp|Q6UPE0|CHDH_RAT Choline dehydrogenase, mitochondrial OS=Rattus norvegicus GN=Chdh PE=1 SV=1 Back     alignment and function description
>sp|P64264|Y1310_MYCBO Uncharacterized GMC-type oxidoreductase Mb1310 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=Mb1310 PE=3 SV=1 Back     alignment and function description
>sp|P64263|Y1279_MYCTU Uncharacterized GMC-type oxidoreductase Rv1279/MT1316 OS=Mycobacterium tuberculosis GN=Rv1279 PE=3 SV=1 Back     alignment and function description
>sp|Q8BJ64|CHDH_MOUSE Choline dehydrogenase, mitochondrial OS=Mus musculus GN=Chdh PE=1 SV=1 Back     alignment and function description
>sp|Q9WWW2|ALKJ_PSEPU Alcohol dehydrogenase [acceptor] OS=Pseudomonas putida GN=alkJ PE=3 SV=1 Back     alignment and function description
>sp|A4JJG6|BETA_BURVG Choline dehydrogenase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=betA PE=3 SV=1 Back     alignment and function description
>sp|Q00593|ALKJ_PSEOL Alcohol dehydrogenase [acceptor] OS=Pseudomonas oleovorans GN=alkJ PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1183
193636655620 PREDICTED: glucose dehydrogenase [accept 0.459 0.875 0.589 0.0
1947679061197 GF19436 [Drosophila ananassae] gi|190622 0.861 0.851 0.354 0.0
91088309604 PREDICTED: similar to glucose dehydrogen 0.451 0.884 0.509 1e-159
170053146593 glucose dehydrogenase [Culex quinquefasc 0.427 0.853 0.510 1e-151
195396639626 GJ16796 [Drosophila virilis] gi|19414670 0.447 0.845 0.492 1e-150
195130080626 GI15372 [Drosophila mojavensis] gi|19390 0.447 0.845 0.494 1e-150
195432711626 GK19736 [Drosophila willistoni] gi|19416 0.447 0.845 0.489 1e-150
195354615626 GM12016 [Drosophila sechellia] gi|194129 0.447 0.845 0.487 1e-149
194894898626 GG19429 [Drosophila erecta] gi|190649789 0.447 0.845 0.487 1e-149
195478684626 GE16081 [Drosophila yakuba] gi|194188136 0.447 0.845 0.485 1e-149
>gi|193636655|ref|XP_001942555.1| PREDICTED: glucose dehydrogenase [acceptor]-like [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  676 bits (1743), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/558 (58%), Positives = 414/558 (74%), Gaps = 15/558 (2%)

Query: 611  SLVCHLLLLSVAHA---QSQLFRTFINMVSKDAIL--TPSNIVQDTKIFEKEYDFIVIGA 665
            S+V  +++++++ A    S  +  F  +V    +L  TP + V D     ++YDF+V+GA
Sbjct: 5    SVVFAVIVVTLSMAGSGHSMAYTVFQAVVEYYRMLGPTPKDAVPDAGFVRRQYDFVVVGA 64

Query: 666  GSGGSVIANRLTENPNWTVLLLEAGREESLLTDVPLFVSYMVDTDFNWGYKTEKDERFCR 725
            GSGGSV+ANRLTE   WTVLL+EAG EE+ +TDVPL VSY++ T F+WGY+TE+ E  C 
Sbjct: 65   GSGGSVVANRLTEVAGWTVLLIEAGGEENAMTDVPLLVSYLIGTGFDWGYRTEQQEGICG 124

Query: 726  GMSDQTCNWPRGKAMGGTSVINYMVYSRGVPQDFDNWEALGNPGWSYRDVLPYFKKSEDI 785
             M+D+ C WPRGK MGGTSVINYMVY+RGVP D+DNW  LGN GWSY +VLPYFKKSED+
Sbjct: 125  AMTDRKCLWPRGKVMGGTSVINYMVYTRGVPDDYDNWARLGNDGWSYAEVLPYFKKSEDV 184

Query: 786  SVSRLKGSPYHGIGGYLKVEQTSWRTPLSAAFLEAGSELGYD-QVDH-CENPIGFSYVLA 843
              S L  SPYHG GGYLKVE+ +W+T L   FL AG ELGYD   DH    P+GFSYVLA
Sbjct: 185  RQSPLTESPYHGRGGYLKVEEPTWKTKLGPVFLRAGRELGYDVPADHNGPRPLGFSYVLA 244

Query: 844  NKIRGARQSASKAFIRPIRKRHNLKVAKEARVTKILIDPITKRTYGVEFSKNRKSYTVKC 903
                G R SASKAF+RPIR R N  V K + VTKIL+DP TKR  GV+F KN ++  V  
Sbjct: 245  TTDHGTRCSASKAFLRPIRNRPNFTVTKNSLVTKILLDPHTKRATGVKFVKNGQTIVVHA 304

Query: 904  RKEVILSAGTLNSPQLLMLSGVGPRPHLEELNIPVIQDLKVGYNMQDHLSMAGLVFLVNS 963
            RKEVILSAG LN+PQ+LMLSG+GP  HL E+ +PV++DLKVGYN+QDH+SMAGLVFLVN 
Sbjct: 305  RKEVILSAGALNTPQILMLSGIGPADHLAEVGVPVVKDLKVGYNLQDHVSMAGLVFLVNQ 364

Query: 964  SVTIVESKYTKPRYLMDFLVNGAGPLTLPGGAEALAFYPTKYAEDPN-HPDMEIVFGPGA 1022
            SVTI+ES+Y  P+YL+ + V+G GP T+PGGAEALAF  T++A + +  PDME+VFGPGA
Sbjct: 365  SVTIIESRYRNPKYLLQYAVSGRGPFTIPGGAEALAFTATRHATNGSVAPDMELVFGPGA 424

Query: 1023 LTGDSGGSLRKVLGISDKFYNKVYRPFAEREAYSIVPVLVRPRSRGFVRLSRGFVKLRSS 1082
            LTGD+GGSLR++LG++D FY++VY  F E +A+ +VP+L+RP       LSRG VKLRS+
Sbjct: 425  LTGDTGGSLRRLLGMNDTFYDQVYGKFKEHDAWGLVPILLRP-------LSRGRVKLRSN 477

Query: 1083 NPFDSPKFYPNYLSDSRDLDVLIEAIKMAVELSETRAMQKYASKLLPVKFPGCEPYEFRS 1142
            NPF +P FY  YL+D RD + LIE IK A+ +SET A QKY S+LLP+ FPGCE  +F S
Sbjct: 478  NPFQAPMFYAGYLTDKRDRETLIEGIKQAIAVSETPAFQKYGSRLLPIPFPGCEHEQFMS 537

Query: 1143 DEYWACAARQLTTNLHHQ 1160
            D YW CA   ++TNLHHQ
Sbjct: 538  DAYWMCATGLVSTNLHHQ 555

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom:

>gi|194767906|ref|XP_001966055.1| GF19436 [Drosophila ananassae] gi|190622940|gb|EDV38464.1| GF19436 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|91088309|ref|XP_969421.1| PREDICTED: similar to glucose dehydrogenase [Tribolium castaneum] Back     alignment and taxonomy information
>gi|170053146|ref|XP_001862540.1| glucose dehydrogenase [Culex quinquefasciatus] gi|167873795|gb|EDS37178.1| glucose dehydrogenase [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|195396639|ref|XP_002056938.1| GJ16796 [Drosophila virilis] gi|194146705|gb|EDW62424.1| GJ16796 [Drosophila virilis] Back     alignment and taxonomy information
>gi|195130080|ref|XP_002009482.1| GI15372 [Drosophila mojavensis] gi|193907932|gb|EDW06799.1| GI15372 [Drosophila mojavensis] Back     alignment and taxonomy information
>gi|195432711|ref|XP_002064360.1| GK19736 [Drosophila willistoni] gi|194160445|gb|EDW75346.1| GK19736 [Drosophila willistoni] Back     alignment and taxonomy information
>gi|195354615|ref|XP_002043792.1| GM12016 [Drosophila sechellia] gi|194129018|gb|EDW51061.1| GM12016 [Drosophila sechellia] Back     alignment and taxonomy information
>gi|194894898|ref|XP_001978140.1| GG19429 [Drosophila erecta] gi|190649789|gb|EDV47067.1| GG19429 [Drosophila erecta] Back     alignment and taxonomy information
>gi|195478684|ref|XP_002100612.1| GE16081 [Drosophila yakuba] gi|194188136|gb|EDX01720.1| GE16081 [Drosophila yakuba] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query1183
FB|FBgn0030598626 CG9503 [Drosophila melanogaste 0.430 0.813 0.480 1.9e-131
FB|FBgn0039415616 CG6142 [Drosophila melanogaste 0.427 0.821 0.465 8.9e-125
FB|FBgn0030591865 CG9517 [Drosophila melanogaste 0.427 0.584 0.445 3.5e-124
FB|FBgn0030590 703 CG9518 [Drosophila melanogaste 0.433 0.729 0.420 3.4e-116
FB|FBgn0030592 726 CG9514 [Drosophila melanogaste 0.418 0.681 0.401 2e-104
FB|FBgn0030587616 CG9522 [Drosophila melanogaste 0.421 0.810 0.422 2.5e-104
FB|FBgn0030586626 CG12539 [Drosophila melanogast 0.434 0.821 0.409 3.3e-102
FB|FBgn0030589622 CG9519 [Drosophila melanogaste 0.421 0.802 0.404 2e-97
FB|FBgn0030588621 CG9521 [Drosophila melanogaste 0.436 0.830 0.378 3.2e-97
FB|FBgn0030596633 CG12398 [Drosophila melanogast 0.430 0.804 0.372 2.5e-88
FB|FBgn0030598 CG9503 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 1289 (458.8 bits), Expect = 1.9e-131, P = 1.9e-131
 Identities = 250/520 (48%), Positives = 338/520 (65%)

Query:   644 PSNIVQDTKIFEKEYDFXXXXXXXXXXXXXNRLTENPNWTVLLLEAGREESLLTDVPLFV 703
             PS++  D  I +  YDF             NRLTE  NW VLLLEAG +E+ LTDVPL  
Sbjct:    48 PSDVGGDD-ILD-HYDFIVIGAGSAGAVVANRLTEVENWNVLLLEAGGDETELTDVPLMA 105

Query:   704 SYMVDTDFNWGYKTEKDERFCRGMSDQTCNWPRGKAMGGTSVINYMVYSRGVPQDFDNWE 763
              Y+  +  +W YKTE     C  M    CNWPRGK +GG+SV+NYM+Y RG   D+DNWE
Sbjct:   106 GYLQLSKIDWQYKTEPSGTSCLAMQGGRCNWPRGKVLGGSSVLNYMLYLRGSKHDYDNWE 165

Query:   764 ALGNPGWSYRDVLPYFKKSEDISVSRLKGSPYHGIGGYLKVEQTSWRTPLSAAFLEAGSE 823
             A+GNP WSYRD L YFKKSED +   L  +PYH  GGYL V +  + TPL+A+F+EAG E
Sbjct:   166 AMGNPSWSYRDALYYFKKSEDNTNQYLANTPYHATGGYLTVGEAPYHTPLAASFVEAGVE 225

Query:   824 LGYDQVD-HCENPIGFSYVLANKIRGARQSASKAFIRPIRKRHNLKVAKEARVTKILIDP 882
             +GY+  D + E   GF        RG+R S SKAF+RP R R NL ++  + VT+I+IDP
Sbjct:   226 MGYENRDLNGEKMTGFMIAQGTTRRGSRCSTSKAFLRPARLRPNLHISMNSHVTRIMIDP 285

Query:   883 ITKRTYGVEFSKNRKSYTVKCRKEVILSAGTLNSPQLLMLSGVGPRPHLEELNIPVIQDL 942
             +TK  +GVEF K++K Y V+  KEV+LS G++NSPQLLMLSGVGPR  L +  IP+I++L
Sbjct:   286 VTKLAFGVEFVKDQKLYHVRATKEVVLSGGSVNSPQLLMLSGVGPRKELAKHRIPLIKEL 345

Query:   943 KVGYNMQDHLSMAGLVFLVNSSVTIVESKYTKPRYLMDFLVNGAGPLTLPGGAEALAFYP 1002
              VG N+QDH+ + GL FLVN  V+IVE+++     ++ ++V G GPLT+ GG E LA+  
Sbjct:   346 SVGENLQDHIGLGGLTFLVNQPVSIVENRFHTMSTVLQYVVFGQGPLTILGGVEGLAYVN 405

Query:  1003 TKYAEDP-NHPDMEIVFGPGALTGDSGGSLRKVLGISDKFYNKVYRPFAEREAYSIVPVL 1061
             TKYA    + PD+E  F  G+   D G  LRK  G++D FY  V+ P   R+A+SI+P+L
Sbjct:   406 TKYANSSLDWPDIEFHFVSGSTNSDGGSQLRKAHGLTDAFYRAVFEPINNRDAWSIIPML 465

Query:  1062 VRPRSRGFVRLSRGFVKLRSSNPFDSPKFYPNYLSDSRDLDVLIEAIKMAVELSETRAMQ 1121
             +RPRS G +RL       RS NPFD P  +PNYL+D  D+  LIE +K+AV LS T+AMQ
Sbjct:   466 LRPRSVGNIRL-------RSGNPFDYPYIFPNYLTDDFDMKTLIEGVKIAVALSLTKAMQ 518

Query:  1122 KYASKLLPVKFPGCEPYEFRSDEYWACAARQLTTNLHHQI 1161
             ++ S++  +++PGCE     +D +W C  R+ T+ ++H +
Sbjct:   519 RFGSRISSIRWPGCEQVPLFTDAFWECMVRRYTSTIYHPV 558
GO:0050660 "flavin adenine dinucleotide binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0006066 "alcohol metabolic process" evidence=IEA
GO:0008812 "choline dehydrogenase activity" evidence=IEA
FB|FBgn0039415 CG6142 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0030591 CG9517 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0030590 CG9518 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0030592 CG9514 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0030587 CG9522 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0030586 CG12539 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0030589 CG9519 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0030588 CG9521 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0030596 CG12398 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1183
PRK02106560 PRK02106, PRK02106, choline dehydrogenase; Validat 1e-100
PRK02106560 PRK02106, PRK02106, choline dehydrogenase; Validat 8e-94
COG2303542 COG2303, BetA, Choline dehydrogenase and related f 4e-85
COG2303542 COG2303, BetA, Choline dehydrogenase and related f 7e-81
TIGR01810532 TIGR01810, betA, choline dehydrogenase 3e-78
TIGR01810532 TIGR01810, betA, choline dehydrogenase 3e-68
TIGR03970487 TIGR03970, Rv0697, dehydrogenase, Rv0697 family 1e-50
TIGR03970487 TIGR03970, Rv0697, dehydrogenase, Rv0697 family 3e-47
pfam00732218 pfam00732, GMC_oxred_N, GMC oxidoreductase 6e-44
pfam00732218 pfam00732, GMC_oxred_N, GMC oxidoreductase 2e-41
PLN02785587 PLN02785, PLN02785, Protein HOTHEAD 2e-19
PLN02785587 PLN02785, PLN02785, Protein HOTHEAD 5e-19
pfam05199139 pfam05199, GMC_oxred_C, GMC oxidoreductase 9e-16
pfam05199139 pfam05199, GMC_oxred_C, GMC oxidoreductase 3e-09
>gnl|CDD|235000 PRK02106, PRK02106, choline dehydrogenase; Validated Back     alignment and domain information 
 Score =  329 bits (845), Expect = e-100
 Identities = 178/489 (36%), Positives = 252/489 (51%), Gaps = 68/489 (13%)

Query: 655  EKEYDFIVIGAGSGGSVIANRLTENPNWTVLLLEAGREE---SLLTDVPLFVSY-MVDTD 710
              EYD+I+IGAGS G V+ANRL+E+P+ +VLLLEAG  +        +P  +++ +    
Sbjct: 3    TMEYDYIIIGAGSAGCVLANRLSEDPDVSVLLLEAGGPDYRWDFFIQMPAALAFPLQGKR 62

Query: 711  FNWGYKTEKDERFCRGMSDQTCNWPRGKAMGGTSVINYMVYSRGVPQDFDNWEAL-GNPG 769
            +NW Y+TE +      M+++    PRGK +GG+S IN MVY RG   D+DNW  L G  G
Sbjct: 63   YNWAYETEPEP----HMNNRRMECPRGKVLGGSSSINGMVYIRGNAMDYDNWAELPGLEG 118

Query: 770  WSYRDVLPYFKKSEDISVSRLKG-SPYHGIGGYLKVEQTSWRT-PLSAAFLEAGSELGYD 827
            WSY D LPYFKK+E    +R  G   Y G  G L V +    T PL  AF+EAG + GY 
Sbjct: 119  WSYADCLPYFKKAE----TRDGGEDDYRGGDGPLSVTRGKPGTNPLFQAFVEAGVQAGYP 174

Query: 828  QVDHC-----ENPIGFSYVLANKIRGARQSASKAFIRPIRKRHNLKVAKEARVTKILIDP 882
            + D       E   GF  +      G R SA++A++ P  KR NL +   A   +IL + 
Sbjct: 175  RTDDLNGYQQE---GFGPMDRTVTNGRRWSAARAYLDPALKRPNLTIVTHALTDRILFEG 231

Query: 883  ITKRTYGVEFSKNRKSYTVKCRKEVILSAGTLNSPQLLMLSGVGPRPHLEELNIPVIQDL 942
              KR  GVE+ +     T + R+EVILSAG +NSPQLL LSG+GP  HL+EL IPV+ DL
Sbjct: 232  --KRAVGVEYERGGGRETARARREVILSAGAINSPQLLQLSGIGPAEHLKELGIPVVHDL 289

Query: 943  K-VGYNMQDHLSMAGLVFLVNSSVTIVES--KYTKPRYLMDFLVNGAGPLTLPGGA---- 995
              VG N+QDHL +  + +     V++  +   + KP+   ++L  G G      GA    
Sbjct: 290  PGVGENLQDHLEVY-IQYECKQPVSLYPALKWWNKPKIGAEWLFTGTGL-----GASNHF 343

Query: 996  EALAFYPTKYAEDPNHPDMEIVFGPGALTGDSGGSLRKVLGISDKFYNKVYRPFAEREAY 1055
            EA  F  ++     + P+++  F P A+  D  GS                    +   +
Sbjct: 344  EAGGFIRSR--AGVDWPNIQYHFLPVAIRYD--GSNA-----------------VKGHGF 382

Query: 1056 SIVPVLVRP-RSRGFVRLSRGFVKLRSSNPFDSPKFYPNYLSDSRDLDVLIEAIKMAVEL 1114
                  V P RS      SRG VKL+S++P   P    NY+S  +D     +AI++  E+
Sbjct: 383  Q---AHVGPMRSP-----SRGSVKLKSADPRAHPSILFNYMSTEQDWREFRDAIRLTREI 434

Query: 1115 SETRAMQKY 1123
                A+  Y
Sbjct: 435  MAQPALDPY 443

Length = 560
>gnl|CDD|235000 PRK02106, PRK02106, choline dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|225186 COG2303, BetA, Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|225186 COG2303, BetA, Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|233581 TIGR01810, betA, choline dehydrogenase Back     alignment and domain information
>gnl|CDD|233581 TIGR01810, betA, choline dehydrogenase Back     alignment and domain information
>gnl|CDD|234421 TIGR03970, Rv0697, dehydrogenase, Rv0697 family Back     alignment and domain information
>gnl|CDD|234421 TIGR03970, Rv0697, dehydrogenase, Rv0697 family Back     alignment and domain information
>gnl|CDD|216089 pfam00732, GMC_oxred_N, GMC oxidoreductase Back     alignment and domain information
>gnl|CDD|216089 pfam00732, GMC_oxred_N, GMC oxidoreductase Back     alignment and domain information
>gnl|CDD|215420 PLN02785, PLN02785, Protein HOTHEAD Back     alignment and domain information
>gnl|CDD|215420 PLN02785, PLN02785, Protein HOTHEAD Back     alignment and domain information
>gnl|CDD|218493 pfam05199, GMC_oxred_C, GMC oxidoreductase Back     alignment and domain information
>gnl|CDD|218493 pfam05199, GMC_oxred_C, GMC oxidoreductase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 1183
KOG1238|consensus623 100.0
KOG1238|consensus623 100.0
TIGR01810532 betA choline dehydrogenase. This enzyme is a membe 100.0
PRK02106560 choline dehydrogenase; Validated 100.0
PRK02106560 choline dehydrogenase; Validated 100.0
TIGR01810532 betA choline dehydrogenase. This enzyme is a membe 100.0
COG2303542 BetA Choline dehydrogenase and related flavoprotei 100.0
PLN02785587 Protein HOTHEAD 100.0
COG2303542 BetA Choline dehydrogenase and related flavoprotei 100.0
PLN02785587 Protein HOTHEAD 100.0
PF00732296 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR0001 100.0
PF00732296 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR0001 100.0
TIGR02462544 pyranose_ox pyranose oxidase. Pyranose oxidase (al 100.0
TIGR02462544 pyranose_ox pyranose oxidase. Pyranose oxidase (al 99.96
PF05199144 GMC_oxred_C: GMC oxidoreductase; InterPro: IPR0078 99.78
PF05199144 GMC_oxred_C: GMC oxidoreductase; InterPro: IPR0078 99.69
PRK07121492 hypothetical protein; Validated 99.37
PRK12845564 3-ketosteroid-delta-1-dehydrogenase; Reviewed 99.36
PRK12835584 3-ketosteroid-delta-1-dehydrogenase; Reviewed 99.36
PRK07121492 hypothetical protein; Validated 99.34
PRK12835584 3-ketosteroid-delta-1-dehydrogenase; Reviewed 99.31
PRK12844557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 99.29
PRK12837513 3-ketosteroid-delta-1-dehydrogenase; Provisional 99.28
PRK12845564 3-ketosteroid-delta-1-dehydrogenase; Reviewed 99.28
PRK12837513 3-ketosteroid-delta-1-dehydrogenase; Provisional 99.27
PF00890417 FAD_binding_2: FAD binding domain of the Pfam fami 99.27
PRK08274466 tricarballylate dehydrogenase; Validated 99.26
PRK06481506 fumarate reductase flavoprotein subunit; Validated 99.24
PF00890417 FAD_binding_2: FAD binding domain of the Pfam fami 99.24
PRK08274466 tricarballylate dehydrogenase; Validated 99.23
PRK06481506 fumarate reductase flavoprotein subunit; Validated 99.22
PRK12844557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 99.2
PRK07843557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 99.19
PRK06175433 L-aspartate oxidase; Provisional 99.18
PRK07573 640 sdhA succinate dehydrogenase flavoprotein subunit; 99.17
PRK07395553 L-aspartate oxidase; Provisional 99.17
PRK07804541 L-aspartate oxidase; Provisional 99.15
PRK08958 588 sdhA succinate dehydrogenase flavoprotein subunit; 99.15
PRK12834549 putative FAD-binding dehydrogenase; Reviewed 99.14
PRK06175433 L-aspartate oxidase; Provisional 99.14
PTZ00306 1167 NADH-dependent fumarate reductase; Provisional 99.14
PRK11101546 glpA sn-glycerol-3-phosphate dehydrogenase subunit 99.14
PRK12843578 putative FAD-binding dehydrogenase; Reviewed 99.14
PRK06452566 sdhA succinate dehydrogenase flavoprotein subunit; 99.14
PLN00128 635 Succinate dehydrogenase [ubiquinone] flavoprotein 99.13
PRK12843578 putative FAD-binding dehydrogenase; Reviewed 99.13
PRK11101546 glpA sn-glycerol-3-phosphate dehydrogenase subunit 99.12
PRK07843557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 99.12
PRK06263543 sdhA succinate dehydrogenase flavoprotein subunit; 99.12
PRK09078 598 sdhA succinate dehydrogenase flavoprotein subunit; 99.1
PTZ00139 617 Succinate dehydrogenase [ubiquinone] flavoprotein 99.1
TIGR01813439 flavo_cyto_c flavocytochrome c. This model describ 99.09
PLN02815 594 L-aspartate oxidase 99.09
TIGR01813439 flavo_cyto_c flavocytochrome c. This model describ 99.09
PRK08641 589 sdhA succinate dehydrogenase flavoprotein subunit; 99.08
PRK07804541 L-aspartate oxidase; Provisional 99.08
PRK12834549 putative FAD-binding dehydrogenase; Reviewed 99.08
PRK12839572 hypothetical protein; Provisional 99.07
PRK06134581 putative FAD-binding dehydrogenase; Reviewed 99.06
COG2081408 Predicted flavoproteins [General function predicti 99.06
PRK12842574 putative succinate dehydrogenase; Reviewed 99.06
PRK05945 575 sdhA succinate dehydrogenase flavoprotein subunit; 99.05
PRK12842574 putative succinate dehydrogenase; Reviewed 99.05
PRK06134581 putative FAD-binding dehydrogenase; Reviewed 99.05
PRK06452566 sdhA succinate dehydrogenase flavoprotein subunit; 99.05
PF01266358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 99.04
PLN02815594 L-aspartate oxidase 99.04
PRK12839572 hypothetical protein; Provisional 99.04
PRK07395553 L-aspartate oxidase; Provisional 99.04
PRK07057 591 sdhA succinate dehydrogenase flavoprotein subunit; 99.04
TIGR01373407 soxB sarcosine oxidase, beta subunit family, heter 99.03
PLN00128635 Succinate dehydrogenase [ubiquinone] flavoprotein 99.02
PRK08626 657 fumarate reductase flavoprotein subunit; Provision 99.02
PRK06263543 sdhA succinate dehydrogenase flavoprotein subunit; 99.02
PF01266358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 99.01
PRK08958588 sdhA succinate dehydrogenase flavoprotein subunit; 99.01
PRK07573640 sdhA succinate dehydrogenase flavoprotein subunit; 99.01
PRK07803 626 sdhA succinate dehydrogenase flavoprotein subunit; 99.01
PRK06854 608 adenylylsulfate reductase subunit alpha; Validated 99.0
PTZ00139617 Succinate dehydrogenase [ubiquinone] flavoprotein 99.0
TIGR01812 566 sdhA_frdA_Gneg succinate dehydrogenase or fumarate 98.99
PRK09078598 sdhA succinate dehydrogenase flavoprotein subunit; 98.99
PRK09077536 L-aspartate oxidase; Provisional 98.99
COG0579429 Predicted dehydrogenase [General function predicti 98.98
PTZ003061167 NADH-dependent fumarate reductase; Provisional 98.98
TIGR00551488 nadB L-aspartate oxidase. L-aspartate oxidase is t 98.98
PRK09231 582 fumarate reductase flavoprotein subunit; Validated 98.98
PRK08275554 putative oxidoreductase; Provisional 98.98
PRK08205 583 sdhA succinate dehydrogenase flavoprotein subunit; 98.98
TIGR01176 580 fum_red_Fp fumarate reductase, flavoprotein subuni 98.97
PRK05945575 sdhA succinate dehydrogenase flavoprotein subunit; 98.97
PTZ00383497 malate:quinone oxidoreductase; Provisional 98.97
PRK12409410 D-amino acid dehydrogenase small subunit; Provisio 98.96
COG0579429 Predicted dehydrogenase [General function predicti 98.96
PF03486409 HI0933_like: HI0933-like protein; InterPro: IPR004 98.96
TIGR00551488 nadB L-aspartate oxidase. L-aspartate oxidase is t 98.95
TIGR02061 614 aprA adenosine phosphosulphate reductase, alpha su 98.94
TIGR01811 603 sdhA_Bsu succinate dehydrogenase or fumarate reduc 98.93
PRK06069 577 sdhA succinate dehydrogenase flavoprotein subunit; 98.93
COG2081408 Predicted flavoproteins [General function predicti 98.92
PRK07512513 L-aspartate oxidase; Provisional 98.92
PRK07057591 sdhA succinate dehydrogenase flavoprotein subunit; 98.92
PRK08071510 L-aspartate oxidase; Provisional 98.92
PRK08626657 fumarate reductase flavoprotein subunit; Provision 98.91
PRK09231582 fumarate reductase flavoprotein subunit; Validated 98.91
TIGR01812566 sdhA_frdA_Gneg succinate dehydrogenase or fumarate 98.9
PRK08641589 sdhA succinate dehydrogenase flavoprotein subunit; 98.9
PRK07803626 sdhA succinate dehydrogenase flavoprotein subunit; 98.89
PF03486409 HI0933_like: HI0933-like protein; InterPro: IPR004 98.89
TIGR01176580 fum_red_Fp fumarate reductase, flavoprotein subuni 98.89
PRK06854608 adenylylsulfate reductase subunit alpha; Validated 98.88
PRK06069577 sdhA succinate dehydrogenase flavoprotein subunit; 98.88
PRK07512513 L-aspartate oxidase; Provisional 98.87
PRK08071510 L-aspartate oxidase; Provisional 98.87
PRK09077536 L-aspartate oxidase; Provisional 98.87
PRK08205583 sdhA succinate dehydrogenase flavoprotein subunit; 98.86
PRK12409410 D-amino acid dehydrogenase small subunit; Provisio 98.86
COG0578532 GlpA Glycerol-3-phosphate dehydrogenase [Energy pr 98.86
PRK08275554 putative oxidoreductase; Provisional 98.86
PRK13800 897 putative oxidoreductase/HEAT repeat-containing pro 98.85
PRK11728393 hydroxyglutarate oxidase; Provisional 98.85
TIGR03329460 Phn_aa_oxid putative aminophosphonate oxidoreducta 98.85
PLN02661357 Putative thiazole synthesis 98.84
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 98.83
PRK05257494 malate:quinone oxidoreductase; Validated 98.83
PLN02661357 Putative thiazole synthesis 98.81
TIGR01373407 soxB sarcosine oxidase, beta subunit family, heter 98.81
TIGR01377380 soxA_mon sarcosine oxidase, monomeric form. Sarcos 98.81
PF01946230 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K. 98.81
TIGR01320483 mal_quin_oxido malate:quinone-oxidoreductase. This 98.8
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 98.8
COG1053562 SdhA Succinate dehydrogenase/fumarate reductase, f 98.8
PRK00711416 D-amino acid dehydrogenase small subunit; Validate 98.79
PLN02464627 glycerol-3-phosphate dehydrogenase 98.79
PRK11259376 solA N-methyltryptophan oxidase; Provisional 98.78
TIGR01811603 sdhA_Bsu succinate dehydrogenase or fumarate reduc 98.78
PTZ00383497 malate:quinone oxidoreductase; Provisional 98.78
PRK11728393 hydroxyglutarate oxidase; Provisional 98.78
TIGR03329460 Phn_aa_oxid putative aminophosphonate oxidoreducta 98.77
TIGR02485432 CobZ_N-term precorrin 3B synthase CobZ. CobZ is es 98.77
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 98.76
TIGR02061614 aprA adenosine phosphosulphate reductase, alpha su 98.76
TIGR01377380 soxA_mon sarcosine oxidase, monomeric form. Sarcos 98.75
PRK08401466 L-aspartate oxidase; Provisional 98.75
COG0029518 NadB Aspartate oxidase [Coenzyme metabolism] 98.74
PRK00711416 D-amino acid dehydrogenase small subunit; Validate 98.74
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, convert 98.74
COG0578532 GlpA Glycerol-3-phosphate dehydrogenase [Energy pr 98.74
TIGR03364365 HpnW_proposed FAD dependent oxidoreductase TIGR033 98.72
PRK13800897 putative oxidoreductase/HEAT repeat-containing pro 98.72
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, convert 98.72
PRK12266508 glpD glycerol-3-phosphate dehydrogenase; Reviewed 98.72
PLN02464627 glycerol-3-phosphate dehydrogenase 98.71
KOG2820|consensus399 98.71
PRK13369502 glycerol-3-phosphate dehydrogenase; Provisional 98.7
TIGR01320483 mal_quin_oxido malate:quinone-oxidoreductase. This 98.7
PRK08401466 L-aspartate oxidase; Provisional 98.7
PRK13339497 malate:quinone oxidoreductase; Reviewed 98.69
PF01946230 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K. 98.67
PRK05257494 malate:quinone oxidoreductase; Validated 98.67
COG1053562 SdhA Succinate dehydrogenase/fumarate reductase, f 98.66
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 98.65
PF12831428 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 98.63
TIGR02485432 CobZ_N-term precorrin 3B synthase CobZ. CobZ is es 98.6
PRK10157428 putative oxidoreductase FixC; Provisional 98.59
PRK12266508 glpD glycerol-3-phosphate dehydrogenase; Reviewed 98.59
PRK13369502 glycerol-3-phosphate dehydrogenase; Provisional 98.57
PF12831428 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 98.57
COG0029518 NadB Aspartate oxidase [Coenzyme metabolism] 98.56
PRK11259376 solA N-methyltryptophan oxidase; Provisional 98.55
PRK01747662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 98.53
PRK13977576 myosin-cross-reactive antigen; Provisional 98.52
PRK13339497 malate:quinone oxidoreductase; Reviewed 98.51
COG3380331 Predicted NAD/FAD-dependent oxidoreductase [Genera 98.51
COG3573552 Predicted oxidoreductase [General function predict 98.5
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy produc 98.5
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy produc 98.49
COG1233487 Phytoene dehydrogenase and related proteins [Secon 98.49
TIGR03364365 HpnW_proposed FAD dependent oxidoreductase TIGR033 98.49
PRK05192618 tRNA uridine 5-carboxymethylaminomethyl modificati 98.48
PTZ00363443 rab-GDP dissociation inhibitor; Provisional 98.47
PRK13977576 myosin-cross-reactive antigen; Provisional 98.46
PRK10157428 putative oxidoreductase FixC; Provisional 98.46
PRK10015429 oxidoreductase; Provisional 98.43
PRK05192618 tRNA uridine 5-carboxymethylaminomethyl modificati 98.41
PTZ00363443 rab-GDP dissociation inhibitor; Provisional 98.39
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [ 98.39
TIGR02730493 carot_isom carotene isomerase. Members of this fam 98.38
PRK10015429 oxidoreductase; Provisional 98.37
COG1233487 Phytoene dehydrogenase and related proteins [Secon 98.37
KOG4254|consensus561 98.37
KOG2844|consensus856 98.37
TIGR02730493 carot_isom carotene isomerase. Members of this fam 98.35
PRK01747662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 98.33
KOG0042|consensus 680 98.33
TIGR03378419 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase 98.32
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 98.31
PLN02172461 flavin-containing monooxygenase FMO GS-OX 98.31
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [ 98.31
COG3573552 Predicted oxidoreductase [General function predict 98.29
TIGR02734502 crtI_fam phytoene desaturase. Phytoene is converte 98.29
PRK06185407 hypothetical protein; Provisional 98.28
KOG2844|consensus 856 98.28
KOG2415|consensus621 98.28
PRK06185407 hypothetical protein; Provisional 98.28
KOG2415|consensus621 98.28
KOG2404|consensus477 98.26
PF06039488 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro 98.25
PF06039488 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro 98.24
COG3380331 Predicted NAD/FAD-dependent oxidoreductase [Genera 98.24
PRK07364415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 98.23
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 98.2
TIGR00275400 flavoprotein, HI0933 family. The model when search 98.2
PRK05329422 anaerobic glycerol-3-phosphate dehydrogenase subun 98.19
KOG2404|consensus477 98.19
PF01134392 GIDA: Glucose inhibited division protein A; InterP 98.18
PLN02985514 squalene monooxygenase 98.15
PLN02172461 flavin-containing monooxygenase FMO GS-OX 98.15
PRK07364415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 98.14
KOG0042|consensus680 98.14
TIGR02734502 crtI_fam phytoene desaturase. Phytoene is converte 98.14
PF01134392 GIDA: Glucose inhibited division protein A; InterP 98.12
COG2509486 Uncharacterized FAD-dependent dehydrogenases [Gene 98.11
TIGR02733492 desat_CrtD C-3',4' desaturase CrtD. Members of thi 98.09
PRK07208479 hypothetical protein; Provisional 98.08
KOG2665|consensus453 98.08
KOG2853|consensus509 98.08
TIGR02733492 desat_CrtD C-3',4' desaturase CrtD. Members of thi 98.07
TIGR00275400 flavoprotein, HI0933 family. The model when search 98.06
KOG2820|consensus399 98.05
KOG4254|consensus561 98.04
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 98.04
PRK05329422 anaerobic glycerol-3-phosphate dehydrogenase subun 98.03
PRK05675 570 sdhA succinate dehydrogenase flavoprotein subunit; 98.03
PRK07208479 hypothetical protein; Provisional 98.03
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 98.02
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 98.01
PLN00093450 geranylgeranyl diphosphate reductase; Provisional 98.01
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 97.99
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 97.98
TIGR03378419 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase 97.98
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 97.97
KOG2665|consensus453 97.97
PF01494356 FAD_binding_3: FAD binding domain; InterPro: IPR00 97.97
PRK07045388 putative monooxygenase; Reviewed 97.96
PRK08244493 hypothetical protein; Provisional 97.96
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 97.96
PRK06847375 hypothetical protein; Provisional 97.95
PRK11445351 putative oxidoreductase; Provisional 97.94
TIGR00136617 gidA glucose-inhibited division protein A. GidA, t 97.94
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 97.93
PLN02985514 squalene monooxygenase 97.93
PLN02697529 lycopene epsilon cyclase 97.9
KOG2853|consensus509 97.89
PRK09126392 hypothetical protein; Provisional 97.89
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 97.88
PRK07045388 putative monooxygenase; Reviewed 97.87
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 97.87
PRK11445351 putative oxidoreductase; Provisional 97.87
PRK06184502 hypothetical protein; Provisional 97.86
PRK06126545 hypothetical protein; Provisional 97.86
TIGR02023388 BchP-ChlP geranylgeranyl reductase. This model rep 97.86
PLN02463447 lycopene beta cyclase 97.85
COG2072443 TrkA Predicted flavoprotein involved in K+ transpo 97.85
PRK08244493 hypothetical protein; Provisional 97.84
TIGR00136617 gidA glucose-inhibited division protein A. GidA, t 97.82
TIGR02731453 phytoene_desat phytoene desaturase. Plants and cya 97.81
PRK06834488 hypothetical protein; Provisional 97.81
PRK07190487 hypothetical protein; Provisional 97.8
TIGR02028398 ChlP geranylgeranyl reductase. This model represen 97.8
KOG1298|consensus509 97.8
PRK05976472 dihydrolipoamide dehydrogenase; Validated 97.79
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 97.79
PRK06183538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 97.79
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 97.78
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 97.78
PLN02697529 lycopene epsilon cyclase 97.78
TIGR01816 565 sdhA_forward succinate dehydrogenase, flavoprotein 97.77
KOG2852|consensus380 97.77
PRK07233434 hypothetical protein; Provisional 97.77
TIGR03377516 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase 97.77
TIGR02360390 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. 97.76
PRK06847375 hypothetical protein; Provisional 97.76
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 97.75
PRK06183538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 97.75
COG2509486 Uncharacterized FAD-dependent dehydrogenases [Gene 97.73
PRK06184502 hypothetical protein; Provisional 97.73
PRK06834488 hypothetical protein; Provisional 97.73
TIGR03377516 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase 97.72
PRK08163396 salicylate hydroxylase; Provisional 97.72
PRK06126545 hypothetical protein; Provisional 97.71
TIGR01790388 carotene-cycl lycopene cyclase family protein. Thi 97.71
KOG2852|consensus380 97.71
KOG1298|consensus509 97.69
PRK07588391 hypothetical protein; Provisional 97.69
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 97.69
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 97.67
PRK07236386 hypothetical protein; Provisional 97.67
PRK08132547 FAD-dependent oxidoreductase; Provisional 97.67
TIGR02360390 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. 97.64
COG0445621 GidA Flavin-dependent tRNA uridine 5-carboxymethyl 97.64
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 97.64
TIGR01984382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 97.63
TIGR02732474 zeta_caro_desat carotene 7,8-desaturase. Carotene 97.62
KOG2311|consensus679 97.61
PRK08163396 salicylate hydroxylase; Provisional 97.61
PRK07190487 hypothetical protein; Provisional 97.61
TIGR02732474 zeta_caro_desat carotene 7,8-desaturase. Carotene 97.59
PRK05675570 sdhA succinate dehydrogenase flavoprotein subunit; 97.59
PTZ00058561 glutathione reductase; Provisional 97.56
COG2072443 TrkA Predicted flavoprotein involved in K+ transpo 97.56
PRK07538413 hypothetical protein; Provisional 97.56
PLN00093450 geranylgeranyl diphosphate reductase; Provisional 97.51
KOG1399|consensus448 97.49
COG0445 621 GidA Flavin-dependent tRNA uridine 5-carboxymethyl 97.49
PRK08132547 FAD-dependent oxidoreductase; Provisional 97.48
COG2907447 Predicted NAD/FAD-binding protein [General functio 97.47
COG2907447 Predicted NAD/FAD-binding protein [General functio 97.47
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 97.47
COG3075421 GlpB Anaerobic glycerol-3-phosphate dehydrogenase 97.46
PLN02612567 phytoene desaturase 97.45
PRK07538413 hypothetical protein; Provisional 97.45
TIGR02023388 BchP-ChlP geranylgeranyl reductase. This model rep 97.45
PF00743531 FMO-like: Flavin-binding monooxygenase-like; Inter 97.45
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 97.43
PRK06116450 glutathione reductase; Validated 97.42
PTZ00367567 squalene epoxidase; Provisional 97.4
COG0562374 Glf UDP-galactopyranose mutase [Cell envelope biog 97.39
PF00743531 FMO-like: Flavin-binding monooxygenase-like; Inter 97.39
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 97.38
KOG2311|consensus 679 97.38
PRK06370463 mercuric reductase; Validated 97.34
PRK07845466 flavoprotein disulfide reductase; Reviewed 97.34
PF04820454 Trp_halogenase: Tryptophan halogenase; InterPro: I 97.34
TIGR01816565 sdhA_forward succinate dehydrogenase, flavoprotein 97.34
PLN02487569 zeta-carotene desaturase 97.34
PF05834374 Lycopene_cycl: Lycopene cyclase protein; InterPro: 97.33
PRK06475400 salicylate hydroxylase; Provisional 97.33
KOG1399|consensus448 97.33
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 97.32
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 97.31
PRK05976472 dihydrolipoamide dehydrogenase; Validated 97.31
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 97.3
PRK07494388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 97.29
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 97.28
PRK08013400 oxidoreductase; Provisional 97.26
TIGR02028398 ChlP geranylgeranyl reductase. This model represen 97.26
TIGR02352337 thiamin_ThiO glycine oxidase ThiO. This family con 97.25
PRK07608388 ubiquinone biosynthesis hydroxylase family protein 97.25
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 97.24
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 97.23
COG0562374 Glf UDP-galactopyranose mutase [Cell envelope biog 97.21
PRK06116450 glutathione reductase; Validated 97.2
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 97.2
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 97.18
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 97.18
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 97.17
TIGR00031377 UDP-GALP_mutase UDP-galactopyranose mutase. The ge 97.16
COG0492305 TrxB Thioredoxin reductase [Posttranslational modi 97.16
PF01494356 FAD_binding_3: FAD binding domain; InterPro: IPR00 97.16
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 97.16
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductas 97.16
PRK06370463 mercuric reductase; Validated 97.15
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 97.14
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 97.13
TIGR01988385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 97.11
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 97.11
PRK06327475 dihydrolipoamide dehydrogenase; Validated 97.1
KOG2960|consensus328 97.09
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 97.09
TIGR02352337 thiamin_ThiO glycine oxidase ThiO. This family con 97.08
PRK07494388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 97.07
PRK06475400 salicylate hydroxylase; Provisional 97.07
KOG0029|consensus501 97.07
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 97.06
PRK07608388 ubiquinone biosynthesis hydroxylase family protein 97.05
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 97.04
PRK09897534 hypothetical protein; Provisional 97.03
PF04820454 Trp_halogenase: Tryptophan halogenase; InterPro: I 97.02
TIGR01989437 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T 97.02
PRK08013400 oxidoreductase; Provisional 97.02
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 97.02
PRK09126392 hypothetical protein; Provisional 97.01
PF05834374 Lycopene_cycl: Lycopene cyclase protein; InterPro: 97.01
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 97.01
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 97.0
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 97.0
PTZ00052499 thioredoxin reductase; Provisional 96.99
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 96.99
PRK14694468 putative mercuric reductase; Provisional 96.99
TIGR01984382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 96.98
TIGR02053463 MerA mercuric reductase. This model represents the 96.98
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 96.96
TIGR00031377 UDP-GALP_mutase UDP-galactopyranose mutase. The ge 96.95
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 96.95
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 96.95
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 96.94
COG0492305 TrxB Thioredoxin reductase [Posttranslational modi 96.93
PLN02576496 protoporphyrinogen oxidase 96.93
PRK06292460 dihydrolipoamide dehydrogenase; Validated 96.93
PLN02463447 lycopene beta cyclase 96.92
PTZ00058561 glutathione reductase; Provisional 96.92
PF06100500 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross 96.92
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit 96.9
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 96.9
PRK06996398 hypothetical protein; Provisional 96.9
PRK13748561 putative mercuric reductase; Provisional 96.89
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductas 96.88
PLN02268435 probable polyamine oxidase 96.88
KOG0405|consensus478 96.87
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 96.86
PRK07233434 hypothetical protein; Provisional 96.85
PLN02546558 glutathione reductase 96.85
PRK06327475 dihydrolipoamide dehydrogenase; Validated 96.83
PRK08294634 phenol 2-monooxygenase; Provisional 96.83
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 96.82
PLN02507499 glutathione reductase 96.82
TIGR01789370 lycopene_cycl lycopene cyclase. This model represe 96.82
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 96.81
PTZ00153659 lipoamide dehydrogenase; Provisional 96.8
TIGR01988385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 96.78
PRK06292460 dihydrolipoamide dehydrogenase; Validated 96.76
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 96.76
KOG0029|consensus501 96.75
PRK11883451 protoporphyrinogen oxidase; Reviewed 96.73
PLN02927668 antheraxanthin epoxidase/zeaxanthin epoxidase 96.73
PRK09897534 hypothetical protein; Provisional 96.72
TIGR01790388 carotene-cycl lycopene cyclase family protein. Thi 96.72
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 96.71
TIGR02053463 MerA mercuric reductase. This model represents the 96.71
PRK06753373 hypothetical protein; Provisional 96.7
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 96.69
PLN02576496 protoporphyrinogen oxidase 96.67
TIGR00562462 proto_IX_ox protoporphyrinogen oxidase. This prote 96.66
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 96.66
PLN02568539 polyamine oxidase 96.65
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 96.65
PTZ00367567 squalene epoxidase; Provisional 96.63
TIGR01989437 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T 96.63
COG1231450 Monoamine oxidase [Amino acid transport and metabo 96.63
COG3349485 Uncharacterized conserved protein [Function unknow 96.62
PTZ00052499 thioredoxin reductase; Provisional 96.62
PRK05335436 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 96.61
PRK10262321 thioredoxin reductase; Provisional 96.6
PF07992201 Pyr_redox_2: Pyridine nucleotide-disulphide oxidor 96.59
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 96.59
PLN02268435 probable polyamine oxidase 96.59
PLN02546558 glutathione reductase 96.57
PRK13748561 putative mercuric reductase; Provisional 96.56
PRK07236386 hypothetical protein; Provisional 96.55
PRK14694468 putative mercuric reductase; Provisional 96.55
PLN02507499 glutathione reductase 96.53
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 96.51
PRK11883451 protoporphyrinogen oxidase; Reviewed 96.51
PRK06996398 hypothetical protein; Provisional 96.51
TIGR033151012 Se_ygfK putative selenate reductase, YgfK subunit. 96.5
PLN02568539 polyamine oxidase 96.5
TIGR03197381 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouri 96.48
PLN02676487 polyamine oxidase 96.47
TIGR00562462 proto_IX_ox protoporphyrinogen oxidase. This prote 96.46
PRK12831464 putative oxidoreductase; Provisional 96.44
PRK14727479 putative mercuric reductase; Provisional 96.44
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 96.44
TIGR01789370 lycopene_cycl lycopene cyclase. This model represe 96.43
PRK07588391 hypothetical protein; Provisional 96.43
PRK08294634 phenol 2-monooxygenase; Provisional 96.43
PRK05868372 hypothetical protein; Validated 96.43
PF06100500 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross 96.39
PTZ00153659 lipoamide dehydrogenase; Provisional 96.39
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 96.38
PRK06753373 hypothetical protein; Provisional 96.38
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 96.38
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 96.36
PRK12416463 protoporphyrinogen oxidase; Provisional 96.35
PF07992201 Pyr_redox_2: Pyridine nucleotide-disulphide oxidor 96.32
TIGR01372985 soxA sarcosine oxidase, alpha subunit family, hete 96.31
TIGR03197381 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouri 96.29
COG3349485 Uncharacterized conserved protein [Function unknow 96.25
PRK13512438 coenzyme A disulfide reductase; Provisional 96.18
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 96.18
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 96.16
PRK10262321 thioredoxin reductase; Provisional 96.16
PRK05335436 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 96.11
TIGR00137433 gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo 96.11
PF13454156 NAD_binding_9: FAD-NAD(P)-binding 96.11
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 96.1
TIGR02731453 phytoene_desat phytoene desaturase. Plants and cya 96.09
KOG2614|consensus420 96.09
PRK12778752 putative bifunctional 2-polyprenylphenol hydroxyla 96.08
COG3075421 GlpB Anaerobic glycerol-3-phosphate dehydrogenase 96.07
COG1231450 Monoamine oxidase [Amino acid transport and metabo 96.07
PRK14727479 putative mercuric reductase; Provisional 96.06
PRK05868372 hypothetical protein; Validated 96.06
PLN02927668 antheraxanthin epoxidase/zeaxanthin epoxidase 96.04
PRK127751006 putative trifunctional 2-polyprenylphenol hydroxyl 96.0
COG1148622 HdrA Heterodisulfide reductase, subunit A and rela 95.99
PLN02676487 polyamine oxidase 95.98
COG1148622 HdrA Heterodisulfide reductase, subunit A and rela 95.95
TIGR03862376 flavo_PP4765 uncharacterized flavoprotein, PP_4765 95.94
COG1232444 HemY Protoporphyrinogen oxidase [Coenzyme metaboli 95.94
>KOG1238|consensus Back     alignment and domain information 
Probab=100.00  E-value=4.7e-92  Score=805.67  Aligned_cols=513  Identities=43%  Similarity=0.771  Sum_probs=471.1

Q ss_pred             cccceEEeeCCCchHHHHHHHHhcCCCCeEEEEcCCCCCCCCcccccccccccCCCCccCccccCccccccCCCCCeeec
Q psy8892         655 EKEYDFIVIGAGSGGSVIANRLTENPNWTVLLLEAGREESLLTDVPLFVSYMVDTDFNWGYKTEKDERFCRGMSDQTCNW  734 (1183)
Q Consensus       655 ~~~~D~VVIGsG~aG~~~A~~Lae~~G~~VlvLE~G~~~~~~~~~p~~~~~~~~~~~~w~~~~~~~~~~~~~~~~~~~~~  734 (1183)
                      ..+|||||||||.|||++|.+|+|++.++|||||+|+.+.-...+|.....+..+.++|.|.++|+...|+.+.++.|.|
T Consensus        55 ~~~yDyIVVGgGtAGcvlAarLSEn~~~~VLLLEaGg~~~~~~~~p~~~~~~q~s~~dw~y~t~Ps~~ac~~m~~~~c~w  134 (623)
T KOG1238|consen   55 DSSYDYIVVGGGTAGCVLAARLSENPNWSVLLLEAGGDPPLYSDPPLLAANLQLSLYDWSYHTEPSQHACLAMSEDRCYW  134 (623)
T ss_pred             ccCCCEEEECCCchhHHHHHhhccCCCceEEEEecCCCCcccccchHHHHHhccccccccCcCccChhhhhhhcCCceec
Confidence            46899999999999999999999988899999999998866778887778888999999999999999999999999999


Q ss_pred             cccceecCcccccceeEeeCCccccchhhccCCCCCCccchHHHHHHhhcccCCCCCCCCCCCCCCccccccCCCCChHH
Q psy8892         735 PRGKAMGGTSVINYMVYSRGVPQDFDNWEALGNPGWSYRDVLPYFKKSEDISVSRLKGSPYHGIGGYLKVEQTSWRTPLS  814 (1183)
Q Consensus       735 ~~G~~lGGsS~~n~~~~~r~~~~d~~~w~~~g~~gw~~~~l~py~~k~e~~~~~~~~~~~~~~~~G~~~~~~~~~~~~~~  814 (1183)
                      +|||++||+|++|+|+|.|+.+.|||.|++.|++||+|++++|||+|+|....+.....++|+..|+..+....+..++.
T Consensus       135 pRGrVLGGsS~iN~m~Y~RG~r~Dyd~W~~~gnpgW~y~~vl~yf~k~E~~~~~~~~~~~y~~~~g~~~ve~~~~~~~~~  214 (623)
T KOG1238|consen  135 PRGRVLGGSSVLNAMFYVRGNRRDYDRWAAEGNPGWSYDEVLPYFKKSEDKVVPDPELTPYHGAGGPLLVEAGVYPNNLF  214 (623)
T ss_pred             CccceecccccccceEEecCCccchHHHHHhcCCCCCHHHHHHHHHHHhhccCCCcccCcccccCCcceeccccccCchh
Confidence            99999999999999999999999999999999999999999999999999887766677799999999999999999999


Q ss_pred             HHHHHHHHHCCCCCCCC-CCCCceeeeecccccCCccchHHHhhhhhhhc-CCCcEEEcCcEEEEEEEcCCCCeEEEEEE
Q psy8892         815 AAFLEAGSELGYDQVDH-CENPIGFSYVLANKIRGARQSASKAFIRPIRK-RHNLKVAKEARVTKILIDPITKRTYGVEF  892 (1183)
Q Consensus       815 ~~~~~~~~~~G~~~~d~-~~~~~g~~~~~~~~~~g~r~~~~~~~L~~~~~-~~g~~i~~~t~V~~I~~~~~~gra~GV~~  892 (1183)
                      ..+.++..++|.+..|+ +....|+.+.+.+..+|.|+++..+|+.++.. |+|+++..++.|++|++|..+.++.||++
T Consensus       215 ~~~~~ag~e~G~~~~D~nG~~~tg~~~l~~t~~~g~R~s~~~a~l~~~~~~R~NL~~~~~~~vtrvl~D~~~~~a~gv~~  294 (623)
T KOG1238|consen  215 TAFHRAGTEIGGSIFDRNGERHTGASLLQYTIRNGIRVSLAKAYLKPIRLTRPNLHISRNAAVTRVLIDPAGKRAKGVEF  294 (623)
T ss_pred             hHhHHhHHhcCCCccCCCCccccchhhhhccccCCEEEEehhhhhhhhhccCccccccccceEEEEEEcCCCceEEEEEE
Confidence            99999999999888899 88899999999999999999999999999887 89999999999999999977789999999


Q ss_pred             eeC-CeEEEEEeccEEEEccCccCcHHHHHHcCCCCccchhhcCCCccccCC-CCcccccccccceEEEEEcCccccccc
Q psy8892         893 SKN-RKSYTVKCRKEVILSAGTLNSPQLLMLSGVGPRPHLEELNIPVIQDLK-VGYNMQDHLSMAGLVFLVNSSVTIVES  970 (1183)
Q Consensus       893 ~~~-~~~~~i~A~k~VILAaGa~~tp~lL~~SGIG~~~~l~~~gi~v~~dlp-VG~nl~dh~~~~~~~~~~~~~~~~~~~  970 (1183)
                      ... ++.++|+|+||||||||+++||||||+|||||+++|+++||||+.||| ||+|||||+..+.+++..+ +.+....
T Consensus       295 ~~~~~~~~~v~a~kEVILSAGAi~SPQLLMLSGIGP~~~L~~~gIpvv~dLP~VG~nLqDH~~~~~~~~~~~-~~~~~~~  373 (623)
T KOG1238|consen  295 VRDGGKEHTVKARKEVILSAGAINSPQLLMLSGIGPADHLKKLGIPVVLDLPGVGQNLQDHPMNPGFVFSTN-PVELSLI  373 (623)
T ss_pred             EecCceeeeecccceEEEeccccCCHHHHHHcCCCcHHHHHhcCCCeeccCcccccccccccccceeeecCC-Ccccccc
Confidence            987 799999999999999999999999999999999999999999999999 9999999999755555544 4443444


Q ss_pred             ccCChHHHHHHHhcCCCCCCCccccceEEEeecCCCCCCC-CCCeeEeecCCcccCCCCCcchhhcccccccccccccCC
Q psy8892         971 KYTKPRYLMDFLVNGAGPLTLPGGAEALAFYPTKYAEDPN-HPDMEIVFGPGALTGDSGGSLRKVLGISDKFYNKVYRPF 1049 (1183)
Q Consensus       971 ~~~~~~~~~~~~~~~~G~~~~~~~~~~~~~~~~~~~~~~~-~pd~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 1049 (1183)
                      .+.....+.+|+..++||+++.+ .+..+|+++.....+. +||+|+++.+..+..+....+++..+   ++|++++...
T Consensus       374 ~~~~~~~~~~yl~~~~G~~~~~~-~e~~~f~~t~~~~~~~~~PD~~~~~~~~~~~~~~~~~~~~~~~---~~y~~~~~~~  449 (623)
T KOG1238|consen  374 RLVGITTVGQYLEGGSGPLASPG-VETLGFINTVSSNLSLDWPDIELHFVAGSLSSDGLTALRKALG---EIYQALFGEL  449 (623)
T ss_pred             ccccchHHHHHHHcCCCCcccCc-ceeeEEeccccccCcCCCCCeeEEeccccccccchhhhhhhcc---hHHHHhhhhh
Confidence            44556789999999999999644 8999999998877554 99999999888887776555665555   6777777777


Q ss_pred             CCCCeEEEEEeeccccCCCcccCcceEEEecCCCCCCCCeeecCCCCChhhHHHHHHHHHHHHHHHcChhhhHhhhccCC
Q psy8892        1050 AEREAYSIVPVLVRPRSRGFVRLSRGFVKLRSSNPFDSPKFYPNYLSDSRDLDVLIEAIKMAVELSETRAMQKYASKLLP 1129 (1183)
Q Consensus      1050 ~~~~~~~~~~~l~~P~SrG~~~~~~~~V~l~s~dp~~~P~I~~~yls~~~D~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ 1129 (1183)
                      ...+.++++..+++|+|||       +|+|+|+||++.|.|+||||+||.|++++++|||.+.++.++++|++++..+..
T Consensus       450 ~~~~~~~i~~~~l~P~SrG-------~l~L~s~nP~~~P~I~~NY~~~p~Dv~~~vegi~~~~~l~~s~af~~~~~r~~~  522 (623)
T KOG1238|consen  450 TNSDSFVIFPKLLRPKSRG-------RLKLRSTNPRDNPLITPNYFTHPEDVATLVEGIRTIIRLSNSKAFQRFGARLWK  522 (623)
T ss_pred             hcCceeEEeehhcCCCccc-------eEEecCCCCCcCceeccCcCCCHHHHHHHHHHHHHHHHHHcCHHHHHhcchhcc
Confidence            7777899999999999999       999999999999999999999999999999999999999999999999999998


Q ss_pred             ccCCCCCCCCCCCHHHHHHHHHhcCCCCcccccccccccCCCCcEEEcCC
Q psy8892        1130 VKFPGCEPYEFRSDEYWACAARQLTTNLHHQICPHIADAVDRRGEIMLSS 1179 (1183)
Q Consensus      1130 ~~~p~~~~~~~~s~~~~~~~i~~~~~t~~H~~gTc~Mg~~~~~~~Vvd~~ 1179 (1183)
                      .+.|+|+.+...||++|+||+|+.+.|.||++|||+|||.-|...|||+.
T Consensus       523 ~~~~~c~~~~~~sd~yw~c~~R~~~~TiyH~~GtckMGp~~D~~aVVD~~  572 (623)
T KOG1238|consen  523 KPVPGCDLLAFLSDAYWECFCRHTVVTIYHYSGTCKMGPSSDPTAVVDPQ  572 (623)
T ss_pred             ccCCCcccccCCCHHHHHHHHHhccceeeccCCceEeCCccCCCcccCCc
Confidence            89999999999999999999999999999999999999999999999873

>KOG1238|consensus Back     alignment and domain information
>TIGR01810 betA choline dehydrogenase Back     alignment and domain information
>PRK02106 choline dehydrogenase; Validated Back     alignment and domain information
>PRK02106 choline dehydrogenase; Validated Back     alignment and domain information
>TIGR01810 betA choline dehydrogenase Back     alignment and domain information
>COG2303 BetA Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02785 Protein HOTHEAD Back     alignment and domain information
>COG2303 BetA Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02785 Protein HOTHEAD Back     alignment and domain information
>PF00732 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR000172 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ] Back     alignment and domain information
>PF00732 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR000172 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ] Back     alignment and domain information
>TIGR02462 pyranose_ox pyranose oxidase Back     alignment and domain information
>TIGR02462 pyranose_ox pyranose oxidase Back     alignment and domain information
>PF05199 GMC_oxred_C: GMC oxidoreductase; InterPro: IPR007867 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ] Back     alignment and domain information
>PF05199 GMC_oxred_C: GMC oxidoreductase; InterPro: IPR007867 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ] Back     alignment and domain information
>PRK07121 hypothetical protein; Validated Back     alignment and domain information
>PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK07121 hypothetical protein; Validated Back     alignment and domain information
>PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional Back     alignment and domain information
>PF00890 FAD_binding_2: FAD binding domain of the Pfam family Back     alignment and domain information
>PRK08274 tricarballylate dehydrogenase; Validated Back     alignment and domain information
>PRK06481 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PF00890 FAD_binding_2: FAD binding domain of the Pfam family Back     alignment and domain information
>PRK08274 tricarballylate dehydrogenase; Validated Back     alignment and domain information
>PRK06481 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK06175 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07395 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK07804 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK12834 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK06175 L-aspartate oxidase; Provisional Back     alignment and domain information
>PTZ00306 NADH-dependent fumarate reductase; Provisional Back     alignment and domain information
>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional Back     alignment and domain information
>PRK12843 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit Back     alignment and domain information
>PRK12843 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional Back     alignment and domain information
>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional Back     alignment and domain information
>TIGR01813 flavo_cyto_c flavocytochrome c Back     alignment and domain information
>PLN02815 L-aspartate oxidase Back     alignment and domain information
>TIGR01813 flavo_cyto_c flavocytochrome c Back     alignment and domain information
>PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07804 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK12834 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK12839 hypothetical protein; Provisional Back     alignment and domain information
>PRK06134 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>PRK12842 putative succinate dehydrogenase; Reviewed Back     alignment and domain information
>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK12842 putative succinate dehydrogenase; Reviewed Back     alignment and domain information
>PRK06134 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>PLN02815 L-aspartate oxidase Back     alignment and domain information
>PRK12839 hypothetical protein; Provisional Back     alignment and domain information
>PRK07395 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form Back     alignment and domain information
>PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit Back     alignment and domain information
>PRK08626 fumarate reductase flavoprotein subunit; Provisional Back     alignment and domain information
>PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06854 adenylylsulfate reductase subunit alpha; Validated Back     alignment and domain information
>PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional Back     alignment and domain information
>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup Back     alignment and domain information
>PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK09077 L-aspartate oxidase; Provisional Back     alignment and domain information
>COG0579 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PTZ00306 NADH-dependent fumarate reductase; Provisional Back     alignment and domain information
>TIGR00551 nadB L-aspartate oxidase Back     alignment and domain information
>PRK09231 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PRK08275 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit Back     alignment and domain information
>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PTZ00383 malate:quinone oxidoreductase; Provisional Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>COG0579 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>TIGR00551 nadB L-aspartate oxidase Back     alignment and domain information
>TIGR02061 aprA adenosine phosphosulphate reductase, alpha subunit Back     alignment and domain information
>TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup Back     alignment and domain information
>PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>PRK07512 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08071 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK08626 fumarate reductase flavoprotein subunit; Provisional Back     alignment and domain information
>PRK09231 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup Back     alignment and domain information
>PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit Back     alignment and domain information
>PRK06854 adenylylsulfate reductase subunit alpha; Validated Back     alignment and domain information
>PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07512 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK08071 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK09077 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK08275 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase Back     alignment and domain information
>PLN02661 Putative thiazole synthesis Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>PRK05257 malate:quinone oxidoreductase; Validated Back     alignment and domain information
>PLN02661 Putative thiazole synthesis Back     alignment and domain information
>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form Back     alignment and domain information
>TIGR01377 soxA_mon sarcosine oxidase, monomeric form Back     alignment and domain information
>PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K Back     alignment and domain information
>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>COG1053 SdhA Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>PLN02464 glycerol-3-phosphate dehydrogenase Back     alignment and domain information
>PRK11259 solA N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup Back     alignment and domain information
>PTZ00383 malate:quinone oxidoreductase; Provisional Back     alignment and domain information
>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase Back     alignment and domain information
>TIGR02485 CobZ_N-term precorrin 3B synthase CobZ Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>TIGR02061 aprA adenosine phosphosulphate reductase, alpha subunit Back     alignment and domain information
>TIGR01377 soxA_mon sarcosine oxidase, monomeric form Back     alignment and domain information
>PRK08401 L-aspartate oxidase; Provisional Back     alignment and domain information
>COG0029 NadB Aspartate oxidase [Coenzyme metabolism] Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>PLN02464 glycerol-3-phosphate dehydrogenase Back     alignment and domain information
>KOG2820|consensus Back     alignment and domain information
>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase Back     alignment and domain information
>PRK08401 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK13339 malate:quinone oxidoreductase; Reviewed Back     alignment and domain information
>PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K Back     alignment and domain information
>PRK05257 malate:quinone oxidoreductase; Validated Back     alignment and domain information
>COG1053 SdhA Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>TIGR02485 CobZ_N-term precorrin 3B synthase CobZ Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>COG0029 NadB Aspartate oxidase [Coenzyme metabolism] Back     alignment and domain information
>PRK11259 solA N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>PRK13977 myosin-cross-reactive antigen; Provisional Back     alignment and domain information
>PRK13339 malate:quinone oxidoreductase; Reviewed Back     alignment and domain information
>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>COG3573 Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 Back     alignment and domain information
>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information
>PTZ00363 rab-GDP dissociation inhibitor; Provisional Back     alignment and domain information
>PRK13977 myosin-cross-reactive antigen; Provisional Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>PRK10015 oxidoreductase; Provisional Back     alignment and domain information
>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information
>PTZ00363 rab-GDP dissociation inhibitor; Provisional Back     alignment and domain information
>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>PRK10015 oxidoreductase; Provisional Back     alignment and domain information
>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG4254|consensus Back     alignment and domain information
>KOG2844|consensus Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>KOG0042|consensus Back     alignment and domain information
>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>COG3573 Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>KOG2844|consensus Back     alignment and domain information
>KOG2415|consensus Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>KOG2415|consensus Back     alignment and domain information
>KOG2404|consensus Back     alignment and domain information
>PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle Back     alignment and domain information
>PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle Back     alignment and domain information
>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>TIGR00275 flavoprotein, HI0933 family Back     alignment and domain information
>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>KOG2404|consensus Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>PLN02985 squalene monooxygenase Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>KOG0042|consensus Back     alignment and domain information
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD Back     alignment and domain information
>PRK07208 hypothetical protein; Provisional Back     alignment and domain information
>KOG2665|consensus Back     alignment and domain information
>KOG2853|consensus Back     alignment and domain information
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD Back     alignment and domain information
>TIGR00275 flavoprotein, HI0933 family Back     alignment and domain information
>KOG2820|consensus Back     alignment and domain information
>KOG4254|consensus Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>PRK05675 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07208 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>KOG2665|consensus Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>TIGR00136 gidA glucose-inhibited division protein A Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>PLN02985 squalene monooxygenase Back     alignment and domain information
>PLN02697 lycopene epsilon cyclase Back     alignment and domain information
>KOG2853|consensus Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>PRK06126 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>TIGR00136 gidA glucose-inhibited division protein A Back     alignment and domain information
>TIGR02731 phytoene_desat phytoene desaturase Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>KOG1298|consensus Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>PLN02697 lycopene epsilon cyclase Back     alignment and domain information
>TIGR01816 sdhA_forward succinate dehydrogenase, flavoprotein subunit, E Back     alignment and domain information
>KOG2852|consensus Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03377 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase, anaerobic, A subunit Back     alignment and domain information
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03377 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase, anaerobic, A subunit Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK06126 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01790 carotene-cycl lycopene cyclase family protein Back     alignment and domain information
>KOG2852|consensus Back     alignment and domain information
>KOG1298|consensus Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase Back     alignment and domain information
>COG0445 GidA Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>TIGR02732 zeta_caro_desat carotene 7,8-desaturase Back     alignment and domain information
>KOG2311|consensus Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02732 zeta_caro_desat carotene 7,8-desaturase Back     alignment and domain information
>PRK05675 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>KOG1399|consensus Back     alignment and domain information
>COG0445 GidA Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>COG2907 Predicted NAD/FAD-binding protein [General function prediction only] Back     alignment and domain information
>COG2907 Predicted NAD/FAD-binding protein [General function prediction only] Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>COG3075 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PLN02612 phytoene desaturase Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PTZ00367 squalene epoxidase; Provisional Back     alignment and domain information
>COG0562 Glf UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>KOG2311|consensus Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan Back     alignment and domain information
>TIGR01816 sdhA_forward succinate dehydrogenase, flavoprotein subunit, E Back     alignment and domain information
>PLN02487 zeta-carotene desaturase Back     alignment and domain information
>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>KOG1399|consensus Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>TIGR02352 thiamin_ThiO glycine oxidase ThiO Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>COG0562 Glf UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>TIGR00031 UDP-GALP_mutase UDP-galactopyranose mutase Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>KOG2960|consensus Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>TIGR02352 thiamin_ThiO glycine oxidase ThiO Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>KOG0029|consensus Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK09897 hypothetical protein; Provisional Back     alignment and domain information
>PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan Back     alignment and domain information
>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 Back     alignment and domain information
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>TIGR00031 UDP-GALP_mutase UDP-galactopyranose mutase Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN02576 protoporphyrinogen oxidase Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>PF06100 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross-reactive antigen like family ; InterPro: IPR010354 Members of this family are thought to have structural features in common with the beta chain of the class II antigens, as well as myosin, and may play an important role in the pathogenesis [] Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>PRK06996 hypothetical protein; Provisional Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>PLN02268 probable polyamine oxidase Back     alignment and domain information
>KOG0405|consensus Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK08294 phenol 2-monooxygenase; Provisional Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>TIGR01789 lycopene_cycl lycopene cyclase Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>KOG0029|consensus Back     alignment and domain information
>PRK11883 protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information
>PRK09897 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01790 carotene-cycl lycopene cyclase family protein Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>PLN02576 protoporphyrinogen oxidase Back     alignment and domain information
>TIGR00562 proto_IX_ox protoporphyrinogen oxidase Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>PLN02568 polyamine oxidase Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>PTZ00367 squalene epoxidase; Provisional Back     alignment and domain information
>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 Back     alignment and domain information
>COG1231 Monoamine oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>COG3349 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>PLN02268 probable polyamine oxidase Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>PRK11883 protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>PRK06996 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>PLN02568 polyamine oxidase Back     alignment and domain information
>TIGR03197 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain Back     alignment and domain information
>PLN02676 polyamine oxidase Back     alignment and domain information
>TIGR00562 proto_IX_ox protoporphyrinogen oxidase Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>TIGR01789 lycopene_cycl lycopene cyclase Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>PRK08294 phenol 2-monooxygenase; Provisional Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>PF06100 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross-reactive antigen like family ; InterPro: IPR010354 Members of this family are thought to have structural features in common with the beta chain of the class II antigens, as well as myosin, and may play an important role in the pathogenesis [] Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>PRK12416 protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>TIGR03197 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain Back     alignment and domain information
>COG3349 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase Back     alignment and domain information
>PF13454 NAD_binding_9: FAD-NAD(P)-binding Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>TIGR02731 phytoene_desat phytoene desaturase Back     alignment and domain information
>KOG2614|consensus Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>COG3075 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>COG1231 Monoamine oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>PLN02676 polyamine oxidase Back     alignment and domain information
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>TIGR03862 flavo_PP4765 uncharacterized flavoprotein, PP_4765 family Back     alignment and domain information
>COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1183
3fim_B566 Crystal Structure Of Aryl-Alcohol-Oxidase From Pleu 7e-43
3nne_A546 Crystal Structure Of Choline Oxidase S101a Mutant L 4e-31
2jbv_A546 Crystal Structure Of Choline Oxidase Reveals Insigh 4e-31
3ljp_A546 Crystal Structure Of Choline Oxidase V464a Mutant L 6e-31
3t37_A526 Crystal Structure Of Pyridoxine 4-Oxidase From Meso 3e-30
1gpe_A587 Glucose Oxidase From Penicillium Amagasakiense Leng 9e-25
3q9t_A577 Crystal Structure Analysis Of Formate Oxidase Lengt 4e-24
1cf3_A583 Glucose Oxidase From Apergillus Niger Length = 583 3e-23
1ju2_A536 Crystal Structure Of The Hydroxynitrile Lyase From 7e-16
3gdn_A521 Almond Hydroxynitrile Lyase In Complex With Benzald 7e-16
3red_A521 3.0 A Structure Of The Prunus Mume Hydroxynitrile L 3e-13
1kdg_A546 Crystal Structure Of The Flavin Domain Of Cellobios 3e-05
1naa_A541 Cellobiose Dehydrogenase Flavoprotein Fragment In C 4e-05
>pdb|3FIM|B Chain B, Crystal Structure Of Aryl-Alcohol-Oxidase From Pleurotus Eryingii Length = 566 Back     alignment and structure 
Iteration: 1

 Score =  172 bits (437), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 141/502 (28%), Positives = 232/502 (46%), Gaps = 67/502 (13%)
Query: 657  EYDFXXXXXXXXXXXXXNRLTENPNWTVLLLEAG--REESLLTDVPLFVSYMV-DTDFNW 713
            ++D+              RLTE+P+ +VL+LEAG   E  L  + PL    +V ++ F+W
Sbjct: 2    DFDYVVVGAGNAGNVVAARLTEDPDVSVLVLEAGVSDENVLGAEAPLLAPGLVPNSIFDW 61
Query: 714  GYKTEKDERFCRGMSDQTCNWPRGKAMGGTSVINYMVYSRGVPQDFDNWEAL-GNPGWSY 772
             Y T        G + ++  +PRG+ +GG+S ++YMV  RG  +DFD + A+ G+ GW++
Sbjct: 62   NYTTTAQA----GYNGRSIAYPRGRMLGGSSSVHYMVMMRGSTEDFDRYAAVTGDEGWNW 117
Query: 773  RDVLPYFKKSEDI-------SVSRLKGSPYHGIGGYLKVEQTSWRTPLS----AAFLEAG 821
             ++  + +K+E +       + S       HG  G + +    + TPL     A   E  
Sbjct: 118  DNIQQFVRKNEMVVPPADNHNTSGEFIPAVHGTNGSVSISLPGFPTPLDDRVLATTQEQS 177
Query: 822  SELGYDQVDHCENPIGFSYVLANKIRGARQSASKAFIRPIRKRHNLKVAKEARVTKILID 881
             E  ++      +P+G S+ +A+   G R S+S A++RP + R NL V   A+VTK++  
Sbjct: 178  EEFFFNPDMGTGHPLGISWSIASVGNGQRSSSSTAYLRPAQSRPNLSVLINAQVTKLVNS 237
Query: 882  PITKRTYG---VEFSKNR--KSYTVKCRKEVILSAGTLNSPQLLMLSGVGPRPHLEELNI 936
              T        VE+++     + TV  +KEV+LSAG++ +P LL LSG+G    L  + I
Sbjct: 238  GTTNGLPAFRCVEYAEQEGAPTTTVCAKKEVVLSAGSVGTPILLQLSGIGDENDLSSVGI 297
Query: 937  -PVIQDLKVGYNMQDHLSMAGLVFLVNSSVT------------IVESKYTKPRY--LMDF 981
              ++ +  VG N+ DHL +    F VNS+ T            +   ++T  R   L   
Sbjct: 298  DTIVNNPSVGRNLSDHLLLPA-AFFVNSNQTFDNIFRDSSEFNVDLDQWTNTRTGPLTAL 356
Query: 982  LVNGAGPLTLPGGAEALAFYPTKYAEDPNHPDMEIVFGPGALTGDSGGSLRKVLGISDKF 1041
            + N    L LP  +     +P   A  PN    E +F                   +  F
Sbjct: 357  IANHLAWLRLPSNSSIFQTFPDP-AAGPNSAHWETIFS------------------NQWF 397
Query: 1042 YNKVYRPFAEREAYSIVPVLVRPRSRGFVRLSRGFVKLRSSNPFDSPKFYPNYLSDSRDL 1101
            +  + RP       S+   L+ P       ++RG +KL +SNPFD P   P YLS   D+
Sbjct: 398  HPAIPRP-DTGSFMSVTNALISP-------VARGDIKLATSNPFDKPLINPQYLSTEFDI 449
Query: 1102 DVLIEAIKMAVELSETRAMQKY 1123
              +I+A+K  +     +A   +
Sbjct: 450  FTMIQAVKSNLRFLSGQAWADF 471
>pdb|3NNE|A Chain A, Crystal Structure Of Choline Oxidase S101a Mutant Length = 546 Back     alignment and structure
>pdb|2JBV|A Chain A, Crystal Structure Of Choline Oxidase Reveals Insights Into The Catalytic Mechanism Length = 546 Back     alignment and structure
>pdb|3LJP|A Chain A, Crystal Structure Of Choline Oxidase V464a Mutant Length = 546 Back     alignment and structure
>pdb|3T37|A Chain A, Crystal Structure Of Pyridoxine 4-Oxidase From Mesorbium Loti Length = 526 Back     alignment and structure
>pdb|1GPE|A Chain A, Glucose Oxidase From Penicillium Amagasakiense Length = 587 Back     alignment and structure
>pdb|3Q9T|A Chain A, Crystal Structure Analysis Of Formate Oxidase Length = 577 Back     alignment and structure
>pdb|1CF3|A Chain A, Glucose Oxidase From Apergillus Niger Length = 583 Back     alignment and structure
>pdb|1JU2|A Chain A, Crystal Structure Of The Hydroxynitrile Lyase From Almond Length = 536 Back     alignment and structure
>pdb|3GDN|A Chain A, Almond Hydroxynitrile Lyase In Complex With Benzaldehyde Length = 521 Back     alignment and structure
>pdb|3RED|A Chain A, 3.0 A Structure Of The Prunus Mume Hydroxynitrile Lyase Isozyme-1 Length = 521 Back     alignment and structure
>pdb|1KDG|A Chain A, Crystal Structure Of The Flavin Domain Of Cellobiose Dehydrogenase Length = 546 Back     alignment and structure
>pdb|1NAA|A Chain A, Cellobiose Dehydrogenase Flavoprotein Fragment In Complex With Cellobionolactam Length = 541 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query1183
3fim_B566 ARYL-alcohol oxidase; AAO, lignin degradation, oxi 0.0
3fim_B566 ARYL-alcohol oxidase; AAO, lignin degradation, oxi 1e-165
1gpe_A587 Protein (glucose oxidase); oxidoreductase(flavopro 1e-180
1gpe_A587 Protein (glucose oxidase); oxidoreductase(flavopro 1e-158
3q9t_A577 Choline dehydrogenase and related flavoproteins; g 1e-173
3q9t_A577 Choline dehydrogenase and related flavoproteins; g 1e-150
3qvp_A583 Glucose oxidase; oxidoreductase; HET: NAG BMA MAN 1e-169
3qvp_A583 Glucose oxidase; oxidoreductase; HET: NAG BMA MAN 1e-153
3t37_A526 Probable dehydrogenase; BET alpha beta fold, ADP b 1e-149
3t37_A526 Probable dehydrogenase; BET alpha beta fold, ADP b 1e-135
2jbv_A546 Choline oxidase; alcohol oxidation, flavoenyzme ox 1e-144
2jbv_A546 Choline oxidase; alcohol oxidation, flavoenyzme ox 1e-130
1ju2_A536 HydroxynitrIle lyase; flavin, GMC oxidoreductase, 1e-142
1ju2_A536 HydroxynitrIle lyase; flavin, GMC oxidoreductase, 1e-121
1kdg_A546 CDH, cellobiose dehydrogenase; GMC oxidoreductase, 1e-120
1kdg_A546 CDH, cellobiose dehydrogenase; GMC oxidoreductase, 1e-119
1n4w_A504 CHOD, cholesterol oxidase; flavoenzyme, steroid me 7e-29
1n4w_A504 CHOD, cholesterol oxidase; flavoenzyme, steroid me 3e-28
3pl8_A623 Pyranose 2-oxidase; substrate complex, H167A mutan 3e-27
3pl8_A623 Pyranose 2-oxidase; substrate complex, H167A mutan 4e-22
1coy_A507 Cholesterol oxidase; oxidoreductase(oxygen recepto 6e-27
1coy_A507 Cholesterol oxidase; oxidoreductase(oxygen recepto 3e-23
1vt4_I1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-14
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-06
4at0_A510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 2e-05
1v0j_A399 UDP-galactopyranose mutase; flavoprotein, isomeras 2e-04
1v0j_A399 UDP-galactopyranose mutase; flavoprotein, isomeras 8e-04
3hdq_A397 UDP-galactopyranose mutase; substrate and inhibito 3e-04
>3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii} Length = 566 Back     alignment and structure
 Score =  549 bits (1416), Expect = 0.0
 Identities = 146/530 (27%), Positives = 239/530 (45%), Gaps = 50/530 (9%)

Query: 657  EYDFIVIGAGSGGSVIANRLTENPNWTVLLLEAGREES--LLTDVPLFVSYMV-DTDFNW 713
            ++D++V+GAG+ G+V+A RLTE+P+ +VL+LEAG  +   L  + PL    +V ++ F+W
Sbjct: 2    DFDYVVVGAGNAGNVVAARLTEDPDVSVLVLEAGVSDENVLGAEAPLLAPGLVPNSIFDW 61

Query: 714  GYKTEKDERFCRGMSDQTCNWPRGKAMGGTSVINYMVYSRGVPQDFDNWEAL-GNPGWSY 772
             Y T        G + ++  +PRG+ +GG+S ++YMV  RG  +DFD + A+ G+ GW++
Sbjct: 62   NYTTTAQA----GYNGRSIAYPRGRMLGGSSSVHYMVMMRGSTEDFDRYAAVTGDEGWNW 117

Query: 773  RDVLPYFKKSED-------ISVSRLKGSPYHGIGGYLKVEQTSWRTPLSAAFLEAGSELG 825
             ++  + +K+E         + S       HG  G + +    + TPL    L    E  
Sbjct: 118  DNIQQFVRKNEMVVPPADNHNTSGEFIPAVHGTNGSVSISLPGFPTPLDDRVLATTQEQS 177

Query: 826  YD---QVDH-CENPIGFSYVLANKIRGARQSASKAFIRPIRKRHNLKVAKEARVTKILID 881
             +     D    +P+G S+ +A+   G R S+S A++RP + R NL V   A+VTK++  
Sbjct: 178  EEFFFNPDMGTGHPLGISWSIASVGNGQRSSSSTAYLRPAQSRPNLSVLINAQVTKLVNS 237

Query: 882  PITK-----RTYGVEFSKNRKSYTVKCRKEVILSAGTLNSPQLLMLSGVGPRPHLEELNI 936
              T      R       +   + TV  +KEV+LSAG++ +P LL LSG+G    L  + I
Sbjct: 238  GTTNGLPAFRCVEYAEQEGAPTTTVCAKKEVVLSAGSVGTPILLQLSGIGDENDLSSVGI 297

Query: 937  PVIQDLK-VGYNMQDHLSMAGLVFLVNSSVTI---VESKYTKPRYLMDFLVNGAGPLTLP 992
              I +   VG N+ DHL +    F VNS+ T              L  +     GPLT  
Sbjct: 298  DTIVNNPSVGRNLSDHL-LLPAAFFVNSNQTFDNIFRDSSEFNVDLDQWTNTRTGPLTAL 356

Query: 993  GGAEALAFYPTKYAEDPNHPDMEIVFGPGALTGDSGGSLRKVLGISDKFYNKVYRPFAER 1052
              A  LA+              +   GP         S       S+++++         
Sbjct: 357  -IANHLAWLRLPSNSSIFQTFPDPAAGP--------NSAHWETIFSNQWFHPAIPRPDTG 407

Query: 1053 EAYSIVPVLVRPRSRGFVRLSRGFVKLRSSNPFDSPKFYPNYLSDSRDLDVLIEAIKMAV 1112
               S+   L+ P +RG ++       L +SNPFD P   P YLS   D+  +I+A+K  +
Sbjct: 408  SFMSVTNALISPVARGDIK-------LATSNPFDKPLINPQYLSTEFDIFTMIQAVKSNL 460

Query: 1113 ELSETRAMQKYASKLLPVKFPGCEPYEFRSDEYWACAARQLTTNLHHQIC 1162
                 +A   +  +      P     +   D       R     + H + 
Sbjct: 461  RFLSGQAWADFVIRPF---DPRLR--DPTDDAAIESYIRDNANTIFHPVG 505
>3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii} Length = 566 Back     alignment and structure
>1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1 Length = 587 Back     alignment and structure
>1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1 Length = 587 Back     alignment and structure
>3q9t_A Choline dehydrogenase and related flavoproteins; glucose-methanol-choline oxidoreductase family, formate OXID formyl-FAD, oxidoreductase; HET: FAY; 2.24A {Aspergillus oryzae} Length = 577 Back     alignment and structure
>3q9t_A Choline dehydrogenase and related flavoproteins; glucose-methanol-choline oxidoreductase family, formate OXID formyl-FAD, oxidoreductase; HET: FAY; 2.24A {Aspergillus oryzae} Length = 577 Back     alignment and structure
>3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* Length = 583 Back     alignment and structure
>3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* Length = 583 Back     alignment and structure
>3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti} Length = 526 Back     alignment and structure
>3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti} Length = 526 Back     alignment and structure
>2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A* Length = 546 Back     alignment and structure
>2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A* Length = 546 Back     alignment and structure
>1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A* Length = 536 Back     alignment and structure
>1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A* Length = 536 Back     alignment and structure
>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* Length = 546 Back     alignment and structure
>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* Length = 546 Back     alignment and structure
>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Length = 504 Back     alignment and structure
>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Length = 504 Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Length = 623 Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Length = 623 Back     alignment and structure
>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Length = 507 Back     alignment and structure
>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Length = 507 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Length = 510 Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Length = 399 Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Length = 399 Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Length = 397 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1183
3fim_B566 ARYL-alcohol oxidase; AAO, lignin degradation, oxi 100.0
3q9t_A577 Choline dehydrogenase and related flavoproteins; g 100.0
3qvp_A583 Glucose oxidase; oxidoreductase; HET: NAG BMA MAN 100.0
3fim_B566 ARYL-alcohol oxidase; AAO, lignin degradation, oxi 100.0
3qvp_A583 Glucose oxidase; oxidoreductase; HET: NAG BMA MAN 100.0
3q9t_A577 Choline dehydrogenase and related flavoproteins; g 100.0
1gpe_A587 Protein (glucose oxidase); oxidoreductase(flavopro 100.0
2jbv_A546 Choline oxidase; alcohol oxidation, flavoenyzme ox 100.0
3t37_A526 Probable dehydrogenase; BET alpha beta fold, ADP b 100.0
1gpe_A587 Protein (glucose oxidase); oxidoreductase(flavopro 100.0
3t37_A526 Probable dehydrogenase; BET alpha beta fold, ADP b 100.0
2jbv_A546 Choline oxidase; alcohol oxidation, flavoenyzme ox 100.0
1ju2_A536 HydroxynitrIle lyase; flavin, GMC oxidoreductase, 100.0
1ju2_A536 HydroxynitrIle lyase; flavin, GMC oxidoreductase, 100.0
1kdg_A546 CDH, cellobiose dehydrogenase; GMC oxidoreductase, 100.0
1kdg_A546 CDH, cellobiose dehydrogenase; GMC oxidoreductase, 100.0
1n4w_A504 CHOD, cholesterol oxidase; flavoenzyme, steroid me 100.0
1coy_A507 Cholesterol oxidase; oxidoreductase(oxygen recepto 100.0
1n4w_A504 CHOD, cholesterol oxidase; flavoenzyme, steroid me 100.0
1coy_A507 Cholesterol oxidase; oxidoreductase(oxygen recepto 100.0
3pl8_A623 Pyranose 2-oxidase; substrate complex, H167A mutan 100.0
3pl8_A623 Pyranose 2-oxidase; substrate complex, H167A mutan 99.97
4at0_A510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 99.51
4at0_A510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 99.49
1qo8_A566 Flavocytochrome C3 fumarate reductase; oxidoreduct 99.2
1qo8_A566 Flavocytochrome C3 fumarate reductase; oxidoreduct 99.19
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 99.19
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 99.17
2h88_A 621 Succinate dehydrogenase flavoprotein subunit; comp 99.15
2bs2_A 660 Quinol-fumarate reductase flavoprotein subunit A; 99.09
2wdq_A 588 Succinate dehydrogenase flavoprotein subunit; succ 99.07
3dme_A369 Conserved exported protein; structural genomics, P 99.07
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 99.05
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 99.02
3dme_A369 Conserved exported protein; structural genomics, P 99.02
2h88_A621 Succinate dehydrogenase flavoprotein subunit; comp 99.0
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 98.99
2bs2_A660 Quinol-fumarate reductase flavoprotein subunit A; 98.99
3dje_A438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 98.97
3da1_A561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 98.97
1chu_A540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 98.97
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 98.96
3gyx_A 662 Adenylylsulfate reductase; oxidoreductase; HET: FA 98.96
2wdq_A588 Succinate dehydrogenase flavoprotein subunit; succ 98.95
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 98.95
1jnr_A 643 Adenylylsulfate reductase; oxidoreductase; HET: FA 98.94
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 98.93
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 98.91
3da1_A561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 98.91
1kf6_A 602 Fumarate reductase flavoprotein; respiration, fuma 98.9
3dje_A438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 98.9
2gag_B405 Heterotetrameric sarcosine oxidase beta-subunit; f 98.89
2gag_B405 Heterotetrameric sarcosine oxidase beta-subunit; f 98.89
2rgh_A571 Alpha-glycerophosphate oxidase; flavoprotein oxida 98.87
1chu_A540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 98.87
2rgh_A571 Alpha-glycerophosphate oxidase; flavoprotein oxida 98.84
3gyx_A662 Adenylylsulfate reductase; oxidoreductase; HET: FA 98.84
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 98.82
1kf6_A602 Fumarate reductase flavoprotein; respiration, fuma 98.82
2i0z_A447 NAD(FAD)-utilizing dehydrogenases; structural geno 98.81
1pj5_A830 N,N-dimethylglycine oxidase; channelling, FAD bind 98.8
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 98.79
1pj5_A 830 N,N-dimethylglycine oxidase; channelling, FAD bind 98.79
1jnr_A643 Adenylylsulfate reductase; oxidoreductase; HET: FA 98.76
3ps9_A676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 98.75
2i0z_A447 NAD(FAD)-utilizing dehydrogenases; structural geno 98.73
3ps9_A676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 98.73
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 98.72
3axb_A448 Putative oxidoreductase; dinucleotide-binding fold 98.72
4dgk_A501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 98.72
3oz2_A397 Digeranylgeranylglycerophospholipid reductase; str 98.71
3nlc_A549 Uncharacterized protein VP0956; FAD-binding protei 98.7
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 98.7
3axb_A448 Putative oxidoreductase; dinucleotide-binding fold 98.7
4dgk_A501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 98.69
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 98.69
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 98.66
3pvc_A689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 98.66
2qcu_A501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 98.65
3nlc_A549 Uncharacterized protein VP0956; FAD-binding protei 98.65
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 98.64
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 98.63
3pvc_A689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 98.63
2e5v_A472 L-aspartate oxidase; archaea, oxidoreductase; HET: 98.63
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 98.63
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 98.62
2qcu_A501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 98.61
2e5v_A472 L-aspartate oxidase; archaea, oxidoreductase; HET: 98.61
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 98.6
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 98.6
3oz2_A397 Digeranylgeranylglycerophospholipid reductase; str 98.59
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 98.59
2gqf_A401 Hypothetical protein HI0933; structural genomics, 98.58
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 98.49
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 98.49
3atr_A453 Conserved archaeal protein; saturating double bond 98.47
2gqf_A401 Hypothetical protein HI0933; structural genomics, 98.47
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 98.46
2zxi_A637 TRNA uridine 5-carboxymethylaminomethyl modificat 98.45
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 98.44
3i3l_A591 Alkylhalidase CMLS; flavin-dependent halogenase, c 98.42
3atr_A453 Conserved archaeal protein; saturating double bond 98.39
3ces_A651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 98.38
2zxi_A 637 TRNA uridine 5-carboxymethylaminomethyl modificat 98.37
3p1w_A475 Rabgdi protein; GDI RAB, malaria, structural genom 98.36
3i3l_A 591 Alkylhalidase CMLS; flavin-dependent halogenase, c 98.36
2gmh_A584 Electron transfer flavoprotein-ubiquinone oxidored 98.35
3e1t_A512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 98.34
3e1t_A512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 98.34
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 98.33
3ces_A651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 98.32
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 98.26
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 98.26
2gmh_A584 Electron transfer flavoprotein-ubiquinone oxidored 98.26
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 98.25
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 98.24
3cp8_A641 TRNA uridine 5-carboxymethylaminomethyl modificati 98.23
2qa1_A500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 98.23
2cul_A232 Glucose-inhibited division protein A-related PROT 98.21
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 98.21
3c4n_A405 Uncharacterized protein DR_0571; alpha-beta protei 98.18
3c4n_A405 Uncharacterized protein DR_0571; alpha-beta protei 98.17
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 98.16
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 98.15
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 98.15
3ihg_A535 RDME; flavoenzyme, anthracycline, polyketide biosy 98.15
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 98.14
3ihg_A535 RDME; flavoenzyme, anthracycline, polyketide biosy 98.14
3cp8_A641 TRNA uridine 5-carboxymethylaminomethyl modificati 98.12
2cul_A232 Glucose-inhibited division protein A-related PROT 98.11
2qa2_A499 CABE, polyketide oxygenase CABE; FAD, angucycline, 98.1
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 98.09
2qa1_A500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 98.08
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 98.04
3fmw_A570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 98.01
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 98.0
3fmw_A570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 98.0
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 97.99
2qa2_A499 CABE, polyketide oxygenase CABE; FAD, angucycline, 97.99
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 97.98
2bry_A497 NEDD9 interacting protein with calponin homology a 97.97
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 97.95
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 97.95
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 97.92
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 97.92
3i6d_A470 Protoporphyrinogen oxidase; protein-inhibitor comp 97.91
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 97.9
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 97.9
2dkh_A639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 97.9
3gwf_A540 Cyclohexanone monooxygenase; flavoprotein biocatal 97.88
2dkh_A639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 97.87
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 97.87
2bry_A497 NEDD9 interacting protein with calponin homology a 97.87
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 97.87
4ap3_A549 Steroid monooxygenase; oxidoreductase, baeyer-vill 97.86
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 97.84
4ap3_A549 Steroid monooxygenase; oxidoreductase, baeyer-vill 97.83
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 97.82
3uox_A545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 97.81
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 97.81
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 97.8
1w4x_A542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 97.8
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 97.79
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 97.79
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 97.78
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 97.78
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 97.78
3i6d_A470 Protoporphyrinogen oxidase; protein-inhibitor comp 97.78
4fk1_A304 Putative thioredoxin reductase; structural genomic 97.77
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 97.77
1w4x_A542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 97.76
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 97.76
3gwf_A540 Cyclohexanone monooxygenase; flavoprotein biocatal 97.75
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 97.75
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 97.74
2r0c_A549 REBC; flavin adenine dinucleotide, monooxygenase, 97.74
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 97.73
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 97.68
2r0c_A549 REBC; flavin adenine dinucleotide, monooxygenase, 97.68
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 97.68
2bcg_G453 Secretory pathway GDP dissociation inhibitor; RABG 97.65
4gut_A776 Lysine-specific histone demethylase 1B; histone de 97.65
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 97.65
3uox_A545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 97.64
4fk1_A304 Putative thioredoxin reductase; structural genomic 97.62
3fpz_A326 Thiazole biosynthetic enzyme; FAD, mitochondrion, 97.62
1c0p_A363 D-amino acid oxidase; alpha-beta-alpha motif, flav 97.61
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 97.6
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 97.6
4gde_A513 UDP-galactopyranose mutase; flavin adenine dinucle 97.6
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 97.59
3fpz_A326 Thiazole biosynthetic enzyme; FAD, mitochondrion, 97.58
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 97.56
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 97.54
3p1w_A475 Rabgdi protein; GDI RAB, malaria, structural genom 97.53
4gde_A513 UDP-galactopyranose mutase; flavin adenine dinucle 97.53
2bcg_G453 Secretory pathway GDP dissociation inhibitor; RABG 97.48
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 97.47
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 97.45
1c0p_A363 D-amino acid oxidase; alpha-beta-alpha motif, flav 97.4
1v0j_A399 UDP-galactopyranose mutase; flavoprotein, isomeras 97.37
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 97.35
3hdq_A397 UDP-galactopyranose mutase; substrate and inhibito 97.35
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 97.27
1y56_A493 Hypothetical protein PH1363; dehydrogenase, protei 97.27
3c96_A410 Flavin-containing monooxygenase; FAD, oxidoreducta 97.26
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 97.26
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 97.25
3g3e_A351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 97.25
1s3e_A520 Amine oxidase [flavin-containing] B; human monoami 97.23
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 97.23
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 97.23
1v0j_A399 UDP-galactopyranose mutase; flavoprotein, isomeras 97.22
2b9w_A424 Putative aminooxidase; isomerase, conjugated linol 97.21
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 97.21
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 97.2
1d5t_A433 Guanine nucleotide dissociation inhibitor; ultra-h 97.2
1i8t_A367 UDP-galactopyranose mutase; rossman fold, FAD, con 97.19
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 97.18
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 97.17
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 97.17
4b63_A501 L-ornithine N5 monooxygenase; oxidoreductase, side 97.17
4b63_A501 L-ornithine N5 monooxygenase; oxidoreductase, side 97.17
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 97.17
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 97.17
2jae_A489 L-amino acid oxidase; oxidoreductase, dimerisation 97.16
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 97.15
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 97.14
3h28_A430 Sulfide-quinone reductase; monotopic membrane prot 97.13
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 97.12
2ivd_A478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 97.12
1sez_A504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 97.11
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 97.1
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 97.1
2e1m_A376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 97.1
3hdq_A397 UDP-galactopyranose mutase; substrate and inhibito 97.09
1s3e_A520 Amine oxidase [flavin-containing] B; human monoami 97.08
4dna_A463 Probable glutathione reductase; structural genomic 97.08
2vvm_A495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 97.08
3nks_A477 Protoporphyrinogen oxidase; FAD containing protein 97.05
1rsg_A516 FMS1 protein; FAD binding motif, oxidoreductase; H 97.05
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 97.04
3c96_A410 Flavin-containing monooxygenase; FAD, oxidoreducta 97.04
1i8t_A367 UDP-galactopyranose mutase; rossman fold, FAD, con 97.04
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 97.03
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 97.03
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 97.01
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 97.0
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 97.0
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 97.0
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 96.99
2ywl_A180 Thioredoxin reductase related protein; uncharacter 96.99
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 96.99
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 96.98
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 96.98
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 96.98
3ihm_A430 Styrene monooxygenase A; rossman fold, anti-parall 96.98
1d5t_A433 Guanine nucleotide dissociation inhibitor; ultra-h 96.97
2aqj_A538 Tryptophan halogenase, pRNA; flavin-dependent halo 96.97
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 96.96
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 96.96
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 96.94
1rsg_A516 FMS1 protein; FAD binding motif, oxidoreductase; H 96.94
2b9w_A424 Putative aminooxidase; isomerase, conjugated linol 96.94
2yg5_A453 Putrescine oxidase; oxidoreductase, flavin; HET: F 96.93
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 96.93
2yg5_A453 Putrescine oxidase; oxidoreductase, flavin; HET: F 96.93
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 96.93
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 96.92
2e4g_A550 Tryptophan halogenase; flavin-binding, rebeccamyci 96.9
2jae_A489 L-amino acid oxidase; oxidoreductase, dimerisation 96.9
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 96.88
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 96.88
3g5s_A443 Methylenetetrahydrofolate--tRNA-(uracil-5-)- methy 96.88
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 96.87
1ojt_A482 Surface protein; redox-active center, glycolysis, 96.87
1sez_A504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 96.87
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 96.86
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 96.86
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 96.86
2vvm_A495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 96.86
3nks_A477 Protoporphyrinogen oxidase; FAD containing protein 96.86
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 96.84
2e1m_A376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 96.84
2ivd_A478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 96.83
3g3e_A351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 96.83
3lov_A475 Protoporphyrinogen oxidase; structural genomics, J 96.82
4dna_A463 Probable glutathione reductase; structural genomic 96.81
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 96.79
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 96.78
2weu_A511 Tryptophan 5-halogenase; regioselectivity, antifun 96.78
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 96.77
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 96.77
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 96.77
2bi7_A384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 96.77
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 96.76
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 96.76
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 96.75
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 96.75
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 96.73
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 96.71
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 96.71
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 96.7
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 96.7
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 96.7
2ywl_A180 Thioredoxin reductase related protein; uncharacter 96.69
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 96.69
1ojt_A482 Surface protein; redox-active center, glycolysis, 96.69
2pyx_A526 Tryptophan halogenase; structural genomics, JOI fo 96.69
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 96.68
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 96.68
2iid_A498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 96.67
4dsg_A484 UDP-galactopyranose mutase; rossmann fold, flavin 96.67
3c4a_A381 Probable tryptophan hydroxylase VIOD; alpha-beta p 96.67
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 96.66
3r9u_A315 Thioredoxin reductase; structural genomics, center 96.66
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 96.66
4hb9_A412 Similarities with probable monooxygenase; flavin, 96.66
3lov_A475 Protoporphyrinogen oxidase; structural genomics, J 96.65
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 96.64
3ihm_A430 Styrene monooxygenase A; rossman fold, anti-parall 96.64
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 96.64
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 96.63
1b37_A472 Protein (polyamine oxidase); flavin-dependent amin 96.63
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 96.62
2bi7_A384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 96.62
1fec_A490 Trypanothione reductase; redox-active center, oxid 96.61
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 96.6
2aqj_A538 Tryptophan halogenase, pRNA; flavin-dependent halo 96.6
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 96.57
1pn0_A665 Phenol 2-monooxygenase; two dimers, TLS refinement 96.55
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 96.55
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 96.54
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 96.54
3g5s_A443 Methylenetetrahydrofolate--tRNA-(uracil-5-)- methy 96.54
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 96.51
1vg0_A650 RAB proteins geranylgeranyltransferase component A 96.51
4dsg_A484 UDP-galactopyranose mutase; rossmann fold, flavin 96.5
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 96.48
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 96.48
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 96.47
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 96.45
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 96.44
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 96.44
3hyw_A430 Sulfide-quinone reductase; monotopic membrane prot 96.44
3c4a_A381 Probable tryptophan hydroxylase VIOD; alpha-beta p 96.43
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 96.41
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 96.4
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 96.39
2pyx_A526 Tryptophan halogenase; structural genomics, JOI fo 96.38
2e4g_A550 Tryptophan halogenase; flavin-binding, rebeccamyci 96.36
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 96.36
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 96.36
2weu_A511 Tryptophan 5-halogenase; regioselectivity, antifun 96.33
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 96.33
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 96.32
3r9u_A315 Thioredoxin reductase; structural genomics, center 96.31
2iid_A498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 96.3
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 96.29
4hb9_A412 Similarities with probable monooxygenase; flavin, 96.29
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 96.28
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 96.25
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 96.25
1b37_A472 Protein (polyamine oxidase); flavin-dependent amin 96.24
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 96.21
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 96.18
2z3y_A662 Lysine-specific histone demethylase 1; chromatin, 96.14
1fec_A490 Trypanothione reductase; redox-active center, oxid 96.13
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 96.11
4gut_A776 Lysine-specific histone demethylase 1B; histone de 96.1
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 96.06
1pn0_A 665 Phenol 2-monooxygenase; two dimers, TLS refinement 96.05
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 95.98
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 95.96
2xag_A852 Lysine-specific histone demethylase 1; amine oxida 95.95
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 95.94
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 95.93
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 95.92
2gag_A965 Heterotetrameric sarcosine oxidase alpha-subunit; 95.89
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 95.88
3h28_A430 Sulfide-quinone reductase; monotopic membrane prot 95.87
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 95.85
3sx6_A437 Sulfide-quinone reductase, putative; sulfide:quino 95.84
1vg0_A 650 RAB proteins geranylgeranyltransferase component A 95.81
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 95.79
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 95.76
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 95.74
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 95.7
1gte_A1025 Dihydropyrimidine dehydrogenase; electron transfer 95.69
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 95.69
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 95.66
1y56_A493 Hypothetical protein PH1363; dehydrogenase, protei 95.66
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 95.64
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 95.53
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 95.49
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 95.48
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 95.47
2z3y_A662 Lysine-specific histone demethylase 1; chromatin, 95.47
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 95.43
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 95.38
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 95.34
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 95.31
1cjc_A460 Protein (adrenodoxin reductase); flavoenzyme, MAD 95.3
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 95.25
2xag_A852 Lysine-specific histone demethylase 1; amine oxida 95.25
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 95.21
3sx6_A437 Sulfide-quinone reductase, putative; sulfide:quino 95.17
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 95.09
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 94.96
3ayj_A721 Pro-enzyme of L-phenylalanine oxidase; amino acid 94.87
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 94.79
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 94.59
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 94.57
1cjc_A460 Protein (adrenodoxin reductase); flavoenzyme, MAD 94.49
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 94.45
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 94.33
3vrd_B401 FCCB subunit, flavocytochrome C flavin subunit; su 94.18
3ayj_A 721 Pro-enzyme of L-phenylalanine oxidase; amino acid 94.06
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 93.94
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 93.8
3vrd_B401 FCCB subunit, flavocytochrome C flavin subunit; su 93.65
4g6h_A502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 93.57
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 93.45
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 93.44
4g6h_A502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 93.19
3hyw_A430 Sulfide-quinone reductase; monotopic membrane prot 93.01
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 87.81
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 87.59
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 87.28
1lss_A140 TRK system potassium uptake protein TRKA homolog; 87.19
1id1_A153 Putative potassium channel protein; RCK domain, E. 85.11
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 83.86
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 83.06
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 82.31
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 82.09
3ado_A319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 81.92
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 81.65
1lss_A140 TRK system potassium uptake protein TRKA homolog; 81.64
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 80.91
3i83_A320 2-dehydropantoate 2-reductase; structural genomics 80.74
>3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii} Back     alignment and structure
Probab=100.00  E-value=6.3e-80  Score=747.09  Aligned_cols=486  Identities=30%  Similarity=0.484  Sum_probs=412.6

Q ss_pred             cceEEeeCCCchHHHHHHHHhcCCCCeEEEEcCCCCC--CCCccccccccccc-CCCCccCccccCccccccCCCCCeee
Q psy8892         657 EYDFIVIGAGSGGSVIANRLTENPNWTVLLLEAGREE--SLLTDVPLFVSYMV-DTDFNWGYKTEKDERFCRGMSDQTCN  733 (1183)
Q Consensus       657 ~~D~VVIGsG~aG~~~A~~Lae~~G~~VlvLE~G~~~--~~~~~~p~~~~~~~-~~~~~w~~~~~~~~~~~~~~~~~~~~  733 (1183)
                      +|||||||+|+||+++|.+|+|+++++|||||||+..  .....+|....... ++.++|.|.+.+|..    +.++.+.
T Consensus         2 ~yD~IIVG~G~aG~v~A~rLse~~~~~VlllEaG~~~~~~~~~~~p~~~~~~~~~~~~~w~~~t~pq~~----~~~r~~~   77 (566)
T 3fim_B            2 DFDYVVVGAGNAGNVVAARLTEDPDVSVLVLEAGVSDENVLGAEAPLLAPGLVPNSIFDWNYTTTAQAG----YNGRSIA   77 (566)
T ss_dssp             CEEEEESCCSTTHHHHHHHHTTSTTCCEEEECSSBCCTTCGGGTSGGGSGGGSSSSTTBCCCBCCCCGG----GTTCCCB
T ss_pred             CcCEEEECCcHHHHHHHHHHHhCcCCcEEEEecCCcccCCCceeCcchHHHhcCCCccccccccccCCC----CCCceEe
Confidence            6999999999999999999999779999999999865  33456676655554 478999999999987    8999999


Q ss_pred             ccccceecCcccccceeEeeCCccccchhhcc-CCCCCCccchHHHHHHhhcccCCCC-------CCCCCCCCCCccccc
Q psy8892         734 WPRGKAMGGTSVINYMVYSRGVPQDFDNWEAL-GNPGWSYRDVLPYFKKSEDISVSRL-------KGSPYHGIGGYLKVE  805 (1183)
Q Consensus       734 ~~~G~~lGGsS~~n~~~~~r~~~~d~~~w~~~-g~~gw~~~~l~py~~k~e~~~~~~~-------~~~~~~~~~G~~~~~  805 (1183)
                      |++||++||+|++|+|+|.|+.+.|||.|+++ |+++|+|++++|||+|+|++..+..       .+...|+..||+.++
T Consensus        78 ~~rGk~lGGsS~iN~m~~~Rg~~~d~d~W~~~~G~~gWs~~~~~pyf~k~E~~~~~~~~~~~~~~~~~~~hG~~Gp~~v~  157 (566)
T 3fim_B           78 YPRGRMLGGSSSVHYMVMMRGSTEDFDRYAAVTGDEGWNWDNIQQFVRKNEMVVPPADNHNTSGEFIPAVHGTNGSVSIS  157 (566)
T ss_dssp             CCCBCBTTGGGGTSCCBCCCCCHHHHHHHHHHHTCTTSSHHHHHHHHHHHEEECCCTTCCCCTTTSCGGGSCBSSSEEEB
T ss_pred             ccCCcEEcCcccccceEEecCCHHHHHHHHhcCCCCCcCHHHHHHHHHHHhccCCccccccccccCCccccCCCCCeeee
Confidence            99999999999999999999999999999998 9999999999999999999876522       134689999999999


Q ss_pred             cCCCCChHHHHHHHHHHHC--CCCCC-CC-CCCCceeeeecccccCCccchHHHhhhhhhhcCCCcEEEcCcEEEEEEEc
Q psy8892         806 QTSWRTPLSAAFLEAGSEL--GYDQV-DH-CENPIGFSYVLANKIRGARQSASKAFIRPIRKRHNLKVAKEARVTKILID  881 (1183)
Q Consensus       806 ~~~~~~~~~~~~~~~~~~~--G~~~~-d~-~~~~~g~~~~~~~~~~g~r~~~~~~~L~~~~~~~g~~i~~~t~V~~I~~~  881 (1183)
                      .+.+..+....|+++++++  |++.. |+ .+...|+++++..+.+|.|+++..+||.++.+++|++|++++.|+||+++
T Consensus       158 ~~~~~~~~~~~~~~a~~~~~~G~~~~~d~n~~~~~G~~~~~~~~~~g~R~sa~~ayL~p~~~r~NL~Vlt~a~V~rIl~~  237 (566)
T 3fim_B          158 LPGFPTPLDDRVLATTQEQSEEFFFNPDMGTGHPLGISWSIASVGNGQRSSSSTAYLRPAQSRPNLSVLINAQVTKLVNS  237 (566)
T ss_dssp             SCSSCCTHHHHHHHHHHHTHHHHCBCSCGGGSCCCEEEECCBSEETTEECCHHHHTHHHHTTCTTEEEESSCEEEEEECC
T ss_pred             cCCCCCHHHHHHHHHHHHHhcCCCccCCCCCCCcceEEeeeeecCCCEEcCHHHHHhhhhccCCCeEEECCCEEEEEEee
Confidence            9988889999999999999  99875 66 67788999999888899999999999999989999999999999999998


Q ss_pred             ---CCCCeEEEEEEeeC-C-eEEEEEeccEEEEccCccCcHHHHHHcCCCCccchhhcCCCccccCC-CCcccccccccc
Q psy8892         882 ---PITKRTYGVEFSKN-R-KSYTVKCRKEVILSAGTLNSPQLLMLSGVGPRPHLEELNIPVIQDLK-VGYNMQDHLSMA  955 (1183)
Q Consensus       882 ---~~~gra~GV~~~~~-~-~~~~i~A~k~VILAaGa~~tp~lL~~SGIG~~~~l~~~gi~v~~dlp-VG~nl~dh~~~~  955 (1183)
                         ++++||+||++... + +.++|+|+||||||||+|+||||||+|||||+++|+++||+|++||| ||+|||||+.+ 
T Consensus       238 ~~~~g~~rA~GVe~~~~~g~~~~~v~A~kEVILsAGai~SPqlL~lSGIGp~~~L~~~gI~vv~dlPgVG~NLqDH~~~-  316 (566)
T 3fim_B          238 GTTNGLPAFRCVEYAEQEGAPTTTVCAKKEVVLSAGSVGTPILLQLSGIGDENDLSSVGIDTIVNNPSVGRNLSDHLLL-  316 (566)
T ss_dssp             EEETTEEECCEEEEESSTTSCCEEEEEEEEEEECCHHHHHHHHHHHTTEECHHHHHHTTCCCSEECTTTTCSBBCCEEE-
T ss_pred             cCCCCCCEEEEEEEEECCCceEEEEEeeeEEEEecCCcCChHHHHhcCCCChHHHhhcCCCceecCcchhhhhhcCccc-
Confidence               22268999999864 5 77899999999999999999999999999999999999999999999 99999999986 


Q ss_pred             eEEEEEcCcccccc---cccCChHHHHHHHhcCCCCCCCccccceEEEeecCCCC-----------CCCCCCeeEeecCC
Q psy8892         956 GLVFLVNSSVTIVE---SKYTKPRYLMDFLVNGAGPLTLPGGAEALAFYPTKYAE-----------DPNHPDMEIVFGPG 1021 (1183)
Q Consensus       956 ~~~~~~~~~~~~~~---~~~~~~~~~~~~~~~~~G~~~~~~~~~~~~~~~~~~~~-----------~~~~pd~~~~~~~~ 1021 (1183)
                      .+.|..+...+...   ..........+|+.+++||++. ...+..+|++++...           ....||+++++.+.
T Consensus       317 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~G~l~~-~~~~~~~f~~~~~~~~~~~~~~~~~~~~~~pd~~~~~~~~  395 (566)
T 3fim_B          317 PAAFFVNSNQTFDNIFRDSSEFNVDLDQWTNTRTGPLTA-LIANHLAWLRLPSNSSIFQTFPDPAAGPNSAHWETIFSNQ  395 (566)
T ss_dssp             CCEEEESCSCSSGGGGTCHHHHHHHHHHHHHHSCSGGGC-CSCSEEEEECCCTTCGGGGTSCCCSSSTTSCSEEEEEESS
T ss_pred             eEEEEeCCCcccchhhcChHHHHHHHHHHHhcCCCCccc-ChhhheeeeccccchhhhhhhccccccCCCCCEEEEeccc
Confidence            77787765432210   1111124568999999999994 567788999875311           11268888776543


Q ss_pred             cccCCCCCcchhhcccccccccccccCCCCCCeEEEEEeeccccCCCcccCcceEEEecCCCCCCCCeeecCCCCChhhH
Q psy8892        1022 ALTGDSGGSLRKVLGISDKFYNKVYRPFAEREAYSIVPVLVRPRSRGFVRLSRGFVKLRSSNPFDSPKFYPNYLSDSRDL 1101 (1183)
Q Consensus      1022 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~P~SrG~~~~~~~~V~l~s~dp~~~P~I~~~yls~~~D~ 1101 (1183)
                      ....                   .+......+++++.+++++|+|||       +|+|+|+||++.|+||||||++|.|+
T Consensus       396 ~~~~-------------------~~~~~~~~~~~~~~~~l~~P~SrG-------~V~L~s~dp~~~P~i~~~yl~~~~D~  449 (566)
T 3fim_B          396 WFHP-------------------AIPRPDTGSFMSVTNALISPVARG-------DIKLATSNPFDKPLINPQYLSTEFDI  449 (566)
T ss_dssp             CCCT-------------------TSCCCSSCCEEEEEEEESSCSCCB-------EEECSSSCTTSCCEEECCTTCSHHHH
T ss_pred             chhh-------------------cccCCCCCCEEEEEEeecCCccce-------EEEecCCCCCCCceeccccCCCccHH
Confidence            2111                   001112346889999999999999       99999999999999999999999999


Q ss_pred             HHHHHHHHHHHHHHcChhhhHhhhccCCccCCCCCCCCCCCHHHHHHHHHhcCCCCcccccccccccCCCCcEEEcCC
Q psy8892        1102 DVLIEAIKMAVELSETRAMQKYASKLLPVKFPGCEPYEFRSDEYWACAARQLTTNLHHQICPHIADAVDRRGEIMLSS 1179 (1183)
Q Consensus      1102 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~s~~~~~~~i~~~~~t~~H~~gTc~Mg~~~~~~~Vvd~~ 1179 (1183)
                      +.|++++|++++++++++|+++...+.   .|++  ...+|||+|+||||+.+.|.||++|||+||+++++..|||+.
T Consensus       450 ~~~~~~~~~~~~i~~~~~~~~~~~~~~---~P~~--~~~~sd~~~~~~ir~~~~t~~H~~GTc~Mg~~~~~~~VVD~~  522 (566)
T 3fim_B          450 FTMIQAVKSNLRFLSGQAWADFVIRPF---DPRL--RDPTDDAAIESYIRDNANTIFHPVGTASMSPRGASWGVVDPD  522 (566)
T ss_dssp             HHHHHHHHHHHHHHTSGGGTTTEEEES---SGGG--SCTTCHHHHHHHHHHHCEECSCCBCTTCBCCTTCSSCSBCTT
T ss_pred             HHHHHHHHHHHHHHhCcccCCcccccc---CCCc--ccccchHHHHHHHhhcccccccccCccccCCcccCCccCCCC
Confidence            999999999999999999999876543   4552  246899999999999999999999999999988776888875
>3q9t_A Choline dehydrogenase and related flavoproteins; glucose-methanol-choline oxidoreductase family, formate OXID formyl-FAD, oxidoreductase; HET: FAY; 2.24A {Aspergillus oryzae} Back     alignment and structure
>3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* Back     alignment and structure
>3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii} Back     alignment and structure
>3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* Back     alignment and structure
>3q9t_A Choline dehydrogenase and related flavoproteins; glucose-methanol-choline oxidoreductase family, formate OXID formyl-FAD, oxidoreductase; HET: FAY; 2.24A {Aspergillus oryzae} Back     alignment and structure
>1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1 Back     alignment and structure
>2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A* Back     alignment and structure
>3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti} Back     alignment and structure
>1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1 Back     alignment and structure
>3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti} Back     alignment and structure
>2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A* Back     alignment and structure
>1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A* Back     alignment and structure
>1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A* Back     alignment and structure
>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* Back     alignment and structure
>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* Back     alignment and structure
>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Back     alignment and structure
>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Back     alignment and structure
>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Back     alignment and structure
>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Back     alignment and structure
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Back     alignment and structure
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure
>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* Back     alignment and structure
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>3fpz_A Thiazole biosynthetic enzyme; FAD, mitochondrion, N thiamine biosynthesis, transit peptide, biosynthetic protei; HET: AHZ; 1.82A {Saccharomyces cerevisiae} Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>3fpz_A Thiazole biosynthetic enzyme; FAD, mitochondrion, N thiamine biosynthesis, transit peptide, biosynthetic protei; HET: AHZ; 1.82A {Saccharomyces cerevisiae} Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>3g5s_A Methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TRMFO; tRNA methyltransferase FAD folate, FAD, flavoprotein; HET: MSE FAD GSH; 1.05A {Thermus thermophilus} PDB: 3g5q_A* 3g5r_A* Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Back     alignment and structure
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>3g5s_A Methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TRMFO; tRNA methyltransferase FAD folate, FAD, flavoprotein; HET: MSE FAD GSH; 1.05A {Thermus thermophilus} PDB: 3g5q_A* 3g5r_A* Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 1183
d1gpea1391 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penic 4e-67
d1gpea1391 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penic 7e-63
d1cf3a1385 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Asper 4e-64
d1cf3a1385 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Asper 1e-63
d1ju2a1351 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase { 9e-60
d1ju2a1351 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase { 1e-50
d2f5va1379 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {W 2e-47
d2f5va1379 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {W 1e-45
d3coxa1370 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of 9e-45
d3coxa1370 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of 1e-43
d1kdga1360 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain 5e-43
d1kdga1360 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain 7e-40
d1n4wa1367 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of 1e-40
d1n4wa1367 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of 4e-39
d1cf3a2196 d.16.1.1 (A:325-520) Glucose oxidase {Aspergillus 4e-22
d1cf3a2196 d.16.1.1 (A:325-520) Glucose oxidase {Aspergillus 1e-14
d1gpea2196 d.16.1.1 (A:329-524) Glucose oxidase {Penicillium 3e-21
d1gpea2196 d.16.1.1 (A:329-524) Glucose oxidase {Penicillium 2e-14
d1ju2a2170 d.16.1.1 (A:294-463) Hydroxynitrile lyase {Almond 3e-17
d1ju2a2170 d.16.1.1 (A:294-463) Hydroxynitrile lyase {Almond 2e-09
d1kdga2181 d.16.1.1 (A:513-693) Flavoprotein domain of flavoc 8e-14
d1kdga2181 d.16.1.1 (A:513-693) Flavoprotein domain of flavoc 7e-13
d2bcgg1297 c.3.1.3 (G:5-301) Guanine nucleotide dissociation 2e-09
d2bcgg1297 c.3.1.3 (G:5-301) Guanine nucleotide dissociation 8e-08
d1d5ta1336 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide di 2e-06
d1d5ta1336 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide di 1e-05
d1feca1240 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductas 4e-06
d1feca1240 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductas 8e-04
d1aoga1238 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductas 8e-06
d1aoga1238 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductas 8e-04
d2gmha1380 c.3.1.2 (A:4-236,A:336-482) Electron transfer flav 5e-05
d2gmha1380 c.3.1.2 (A:4-236,A:336-482) Electron transfer flav 0.002
d1rp0a1278 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi 8e-05
d1rp0a1278 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi 8e-05
d1ebda1223 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehyd 1e-04
d1ebda1223 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehyd 0.002
d1i8ta1298 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mu 4e-04
d1i8ta1298 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mu 0.002
d1b5qa1347 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Mai 5e-04
d1gesa1217 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase 6e-04
d1ryia1276 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO { 8e-04
d2i0za1251 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {B 0.001
d2i0za1251 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {B 0.004
d3lada1229 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehyd 0.001
d3lada1229 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehyd 0.003
d1onfa1259 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase 0.003
d1y0pa2308 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 ( 0.003
d1ojta1229 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide deh 0.003
d1v59a1233 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehyd 0.003
d1dxla1221 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehyd 0.003
d2gf3a1281 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bac 0.003
d1h6va1235 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin 0.004
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Length = 391 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD-linked reductases, N-terminal domain
domain: Glucose oxidase
species: Penicillium amagasakiense [TaxId: 63559]

 Score =  229 bits (585), Expect = 4e-67
 Identities = 85/382 (22%), Positives = 156/382 (40%), Gaps = 40/382 (10%)

Query: 642  LTPSNIVQDTKIFEKEYDFIVIGAGSGGSVIANRLTENPNWTVLLLEAG---REESLLTD 698
            +  S +   +K+  K YD+I+ G G  G  +A +LTENP   VL++E G     +  + +
Sbjct: 9    VQSSLLSDPSKVAGKTYDYIIAGGGLTGLTVAAKLTENPKIKVLVIEKGFYESNDGAIIE 68

Query: 699  VPLFVSYMVDTDFNWGYKTEKDERFCRGMSDQTCNWPRGKAMGGTSVINYMVYSRGVPQD 758
             P     +  T  +  Y T         ++++T N   GK +GG+++IN   ++R     
Sbjct: 69   DPNAYGQIFGTTVDQNYLTVP------LINNRTNNIKAGKGLGGSTLINGDSWTRPDKVQ 122

Query: 759  FDNW-EALGNPGWSYRDVLPYFKKSEDISVSRLK--------GSPYHGIGGYLKV---EQ 806
             D+W +  G  GW++ ++  Y KK+E                 +  HG  G ++    + 
Sbjct: 123  IDSWEKVFGMEGWNWDNMFEYMKKAEAARTPTAAQLAAGHSFNATCHGTNGTVQSGARDN 182

Query: 807  TSWRTPLSAAFLEAGSELGYDQVDHC---ENPIGFSYVLANKIRGARQSASKAFIRPIRK 863
                +P+  A +   S LG                  +        R  A++A++ P  +
Sbjct: 183  GQPWSPIMKALMNTVSALGVPVQQDFLCGHPRGVSMIMNNLDENQVRVDAARAWLLPNYQ 242

Query: 864  RHNLKVAKEARVTKILID--PITKRTYGVEFSKNR-KSYTVKCRKEVILSAGTLNSPQLL 920
            R NL++     V K+L        +  GV F  N+  ++ V  + EV+L+AG+  SP +L
Sbjct: 243  RSNLEILTGQMVGKVLFKQTASGPQAVGVNFGTNKAVNFDVFAKHEVLLAAGSAISPLIL 302

Query: 921  MLSGVGPRPHLEELNIPVIQDLK--VGYNMQDHLSMAGLVFLVNSSVTIVESKYTKPRYL 978
              SG+G +  L++ N+  + DL   +   M   L   G V    + V   +         
Sbjct: 303  EYSGIGLKSVLDQANVTQLLDLPVGICSMMSREL---GGVVDATAKVYGTQG-------- 351

Query: 979  MDFLVNGAGPLTLPGGAEALAF 1000
            +  +     P  +      + +
Sbjct: 352  LRVIDGSIPPTQVSSHVMTIFY 373
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Length = 391 Back     information, alignment and structure
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Length = 385 Back     information, alignment and structure
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Length = 385 Back     information, alignment and structure
>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Length = 351 Back     information, alignment and structure
>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Length = 351 Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Length = 379 Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Length = 379 Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Length = 370 Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Length = 370 Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Length = 360 Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Length = 360 Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Length = 367 Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Length = 367 Back     information, alignment and structure
>d1cf3a2 d.16.1.1 (A:325-520) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Length = 196 Back     information, alignment and structure
>d1cf3a2 d.16.1.1 (A:325-520) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Length = 196 Back     information, alignment and structure
>d1gpea2 d.16.1.1 (A:329-524) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Length = 196 Back     information, alignment and structure
>d1gpea2 d.16.1.1 (A:329-524) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Length = 196 Back     information, alignment and structure
>d1ju2a2 d.16.1.1 (A:294-463) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Length = 170 Back     information, alignment and structure
>d1ju2a2 d.16.1.1 (A:294-463) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Length = 170 Back     information, alignment and structure
>d1kdga2 d.16.1.1 (A:513-693) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), substrate-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Length = 181 Back     information, alignment and structure
>d1kdga2 d.16.1.1 (A:513-693) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), substrate-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Length = 181 Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 297 Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 297 Back     information, alignment and structure
>d1d5ta1 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide dissociation inhibitor, GDI {Cow (Bos taurus) [TaxId: 9913]} Length = 336 Back     information, alignment and structure
>d1d5ta1 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide dissociation inhibitor, GDI {Cow (Bos taurus) [TaxId: 9913]} Length = 336 Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Length = 240 Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Length = 240 Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Length = 238 Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Length = 238 Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Length = 380 Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Length = 380 Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Length = 278 Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Length = 278 Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 223 Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 223 Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 298 Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 298 Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Length = 347 Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Length = 217 Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Length = 276 Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Length = 251 Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Length = 251 Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Length = 229 Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Length = 229 Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Length = 259 Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 308 Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Length = 229 Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 233 Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Length = 221 Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Length = 281 Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 235 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query1183
d1gpea1391 Glucose oxidase {Penicillium amagasakiense [TaxId: 100.0
d1cf3a1385 Glucose oxidase {Aspergillus niger [TaxId: 5061]} 100.0
d1gpea1391 Glucose oxidase {Penicillium amagasakiense [TaxId: 100.0
d1ju2a1351 Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI 100.0
d1cf3a1385 Glucose oxidase {Aspergillus niger [TaxId: 5061]} 100.0
d1ju2a1351 Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI 100.0
d1kdga1360 Flavoprotein domain of flavocytochrome cellobiose 100.0
d1kdga1360 Flavoprotein domain of flavocytochrome cellobiose 100.0
d3coxa1370 Cholesterol oxidase of GMC family {Brevibacterium 99.95
d3coxa1370 Cholesterol oxidase of GMC family {Brevibacterium 99.95
d2f5va1379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 99.95
d1n4wa1367 Cholesterol oxidase of GMC family {Streptomyces sp 99.93
d1n4wa1367 Cholesterol oxidase of GMC family {Streptomyces sp 99.93
d1kdga2181 Flavoprotein domain of flavocytochrome cellobiose 99.88
d1gpea2196 Glucose oxidase {Penicillium amagasakiense [TaxId: 99.88
d1cf3a2196 Glucose oxidase {Aspergillus niger [TaxId: 5061]} 99.87
d2f5va1379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 99.86
d1ju2a2170 Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI 99.82
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 99.57
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 99.53
d1kdga2181 Flavoprotein domain of flavocytochrome cellobiose 99.52
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 99.51
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 99.5
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 99.45
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 99.44
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 99.32
d1kf6a2311 Fumarate reductase {Escherichia coli [TaxId: 562]} 99.31
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 99.29
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 99.27
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 99.27
d1kf6a2311 Fumarate reductase {Escherichia coli [TaxId: 562]} 99.27
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 99.26
d2bs2a2336 Fumarate reductase {Wolinella succinogenes [TaxId: 99.26
d1ju2a2170 Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI 99.23
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 99.22
d2bs2a2336 Fumarate reductase {Wolinella succinogenes [TaxId: 99.2
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 99.18
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 99.18
d1chua2305 L-aspartate oxidase {Escherichia coli [TaxId: 562] 99.14
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 99.13
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 99.11
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 99.09
d1chua2305 L-aspartate oxidase {Escherichia coli [TaxId: 562] 99.07
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 99.06
d1cf3a2196 Glucose oxidase {Aspergillus niger [TaxId: 5061]} 99.04
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 99.04
d1gpea2196 Glucose oxidase {Penicillium amagasakiense [TaxId: 99.03
d1neka2330 Succinate dehydogenase {Escherichia coli [TaxId: 5 99.03
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 98.98
d1jnra2356 Adenylylsulfate reductase A subunit {Archaeon Arch 98.97
d1neka2330 Succinate dehydogenase {Escherichia coli [TaxId: 5 98.95
d1jnra2356 Adenylylsulfate reductase A subunit {Archaeon Arch 98.93
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 98.76
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 98.71
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 98.7
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 98.69
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 98.39
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 98.36
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 98.31
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 98.23
d2gmha1380 Electron transfer flavoprotein-ubiquinone oxidored 98.18
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 98.11
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 98.07
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 98.05
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 98.04
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 98.0
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 98.0
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 97.98
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 97.96
d2gmha1380 Electron transfer flavoprotein-ubiquinone oxidored 97.96
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 97.95
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 97.92
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 97.89
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 97.87
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 97.87
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 97.86
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 97.86
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 97.84
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 97.83
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 97.82
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 97.81
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 97.8
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 97.79
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 97.79
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 97.79
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 97.77
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 97.73
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 97.71
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 97.71
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 97.7
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 97.69
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 97.68
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 97.67
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 97.66
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 97.65
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 97.65
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 97.65
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 97.64
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 97.6
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 97.59
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 97.58
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 97.58
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 97.56
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 97.55
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 97.55
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 97.54
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 97.51
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 97.51
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 97.5
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 97.49
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 97.47
d1aoga1238 Trypanothione reductase {Trypanosoma cruzi [TaxId: 97.46
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 97.45
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 97.43
d1feca1240 Trypanothione reductase {Crithidia fasciculata [Ta 97.43
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 97.39
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 97.38
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 97.38
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 97.36
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 97.35
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 97.35
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 97.34
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 97.34
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 97.33
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 97.33
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 97.33
d1pn0a1360 Phenol hydroxylase {Soil-living yeast (Trichosporo 97.31
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 97.3
d1pn0a1360 Phenol hydroxylase {Soil-living yeast (Trichosporo 97.25
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 97.24
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 97.24
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 97.23
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 97.2
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 97.2
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 97.18
d1aoga1238 Trypanothione reductase {Trypanosoma cruzi [TaxId: 97.15
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 97.14
d1feca1240 Trypanothione reductase {Crithidia fasciculata [Ta 97.13
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 97.1
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 97.1
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 97.09
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 97.08
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 97.05
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 97.05
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 97.04
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 97.03
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 97.0
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 97.0
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 96.95
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 96.91
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 96.91
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 96.83
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 96.76
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 96.74
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 96.71
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 96.68
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 96.61
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 96.58
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 96.53
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 96.5
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 96.46
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 96.42
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 96.25
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 96.16
d1xdia1233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 96.06
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 95.96
d1xdia1233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 95.89
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 95.82
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 95.78
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 95.69
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 95.65
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 95.54
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 95.53
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 95.19
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 94.95
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 94.89
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 94.78
d1vg0a1491 Rab escort protein 1 {Rat (Rattus norvegicus) [Tax 94.61
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 94.59
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 94.45
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 93.94
d1vdca2130 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 93.91
d1vdca2130 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 93.6
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 93.35
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 93.34
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 93.32
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 92.99
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 92.99
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 92.82
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 92.44
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 92.34
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 92.32
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 91.33
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 91.05
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 90.64
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 90.62
d1vg0a1491 Rab escort protein 1 {Rat (Rattus norvegicus) [Tax 90.62
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 90.29
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 90.2
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 89.8
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 89.0
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 88.88
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 88.66
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 87.73
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 87.54
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 87.11
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 86.41
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 86.38
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 86.04
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 85.99
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 85.69
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 85.55
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 83.43
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 83.11
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 82.45
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 82.29
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 81.71
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 81.38
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 81.23
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 80.97
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 80.94
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 80.46
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 80.03
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD-linked reductases, N-terminal domain
domain: Glucose oxidase
species: Penicillium amagasakiense [TaxId: 63559]

Probab=100.00  E-value=7.8e-47  Score=439.57  Aligned_cols=299  Identities=29%  Similarity=0.491  Sum_probs=250.1

Q ss_pred             ccccc-cccceEEeeCCCchHHHHHHHHhcCCCCeEEEEcCCCCCCC---CcccccccccccCCCCccCccccCcccccc
Q psy8892         650 DTKIF-EKEYDFIVIGAGSGGSVIANRLTENPNWTVLLLEAGREESL---LTDVPLFVSYMVDTDFNWGYKTEKDERFCR  725 (1183)
Q Consensus       650 np~~~-~~~~D~VVIGsG~aG~~~A~~Lae~~G~~VlvLE~G~~~~~---~~~~p~~~~~~~~~~~~w~~~~~~~~~~~~  725 (1183)
                      +|+.. .++|||||||||++|+++|.+|||+++++|||||||+....   ....|..+....++.++|.|.+.|+     
T Consensus        16 ~p~~~~~~tyD~IIVGsG~aG~vlA~rLae~~~~~VLlLEaG~~~~~~~~~~~~p~~~~~~~~~~~dw~~~t~p~-----   90 (391)
T d1gpea1          16 DPSKVAGKTYDYIIAGGGLTGLTVAAKLTENPKIKVLVIEKGFYESNDGAIIEDPNAYGQIFGTTVDQNYLTVPL-----   90 (391)
T ss_dssp             CGGGTTTCEEEEEEECCSHHHHHHHHHHHTSTTCCEEEEESSCCCTTSCHHHHCGGGTTTTTTSTTBCCEECCCC-----
T ss_pred             CcccccCCeeeEEEECcCHHHHHHHHHHHHCCCCeEEEEcCCCCCCCCCceeeCHHHHHHhhCCCcccCceeeec-----
Confidence            44443 34799999999999999999999964489999999986432   2356777777788899999999876     


Q ss_pred             CCCCCeeeccccceecCcccccceeEeeCCccccchhhcc-CCCCCCccchHHHHHHhhcccCCC--------CCCCCCC
Q psy8892         726 GMSDQTCNWPRGKAMGGTSVINYMVYSRGVPQDFDNWEAL-GNPGWSYRDVLPYFKKSEDISVSR--------LKGSPYH  796 (1183)
Q Consensus       726 ~~~~~~~~~~~G~~lGGsS~~n~~~~~r~~~~d~~~w~~~-g~~gw~~~~l~py~~k~e~~~~~~--------~~~~~~~  796 (1183)
                       +.++.+.|++|+++||+|.+|+|+|.|+.+.||+.|... |+++|+|++++|||+|+|.+..+.        ..+..+|
T Consensus        91 -~~~r~~~~~~G~~lGGsS~in~~~~~rg~~~d~~~w~~~~G~~gW~~~~l~pyf~k~E~~~~~~~~~~~~~~~~~~~~~  169 (391)
T d1gpea1          91 -INNRTNNIKAGKGLGGSTLINGDSWTRPDKVQIDSWEKVFGMEGWNWDNMFEYMKKAEAARTPTAAQLAAGHSFNATCH  169 (391)
T ss_dssp             -TTSCCCEECCBCSTTGGGGTSCCEECCCCHHHHHHHHHTTCCTTCSHHHHHHHHHHTEEECCCCHHHHHHTCCCCGGGC
T ss_pred             -CCCcEeeeceeeccCcccceeeeEEeeccccccccccccCCCCccccchhHHHHHHhhhccCCcchhcccccCcccccc
Confidence             568889999999999999999999999999999999776 889999999999999999886542        1245678


Q ss_pred             CCCCccccccCC---CCChHHHHHHHHHHHCCCCCC-CC-CCCCceeeeecccc-cCCccchHHHhhhhhhhcCCCcEEE
Q psy8892         797 GIGGYLKVEQTS---WRTPLSAAFLEAGSELGYDQV-DH-CENPIGFSYVLANK-IRGARQSASKAFIRPIRKRHNLKVA  870 (1183)
Q Consensus       797 ~~~G~~~~~~~~---~~~~~~~~~~~~~~~~G~~~~-d~-~~~~~g~~~~~~~~-~~g~r~~~~~~~L~~~~~~~g~~i~  870 (1183)
                      +..+++.+....   ...++.+.+.++++++|++.. +. .+...+...+.... .++.|.++..+++.+...+.|++|+
T Consensus       170 g~~~~~~~~~~~~~~~~~p~~~~~~~a~~~~G~~~~~~~~~g~~~~~~~~~~~~~~~~~r~s~a~~~~~p~~~r~nl~i~  249 (391)
T d1gpea1         170 GTNGTVQSGARDNGQPWSPIMKALMNTVSALGVPVQQDFLCGHPRGVSMIMNNLDENQVRVDAARAWLLPNYQRSNLEIL  249 (391)
T ss_dssp             CBSSSEEEBCCCCSSCBCTHHHHHHHHHHHTTCCBSCCTTSSCCCEEECCEESBCTTCCBCCHHHHHTTTTTTCTTEEEE
T ss_pred             CCCCcccccccccccccCHHHHHHHHHHHhcCCceeeccccCcccccccccceeeccccccchhhhccCccccchhhhhh
Confidence            888888776533   345788899999999999876 34 55555555444443 4556888888899899999999999


Q ss_pred             cCcEEEEEEEcCC--CCeEEEEEEee-CCeEEEEEeccEEEEccCccCcHHHHHHcCCCCccchhhcCCCccccCC--CC
Q psy8892         871 KEARVTKILIDPI--TKRTYGVEFSK-NRKSYTVKCRKEVILSAGTLNSPQLLMLSGVGPRPHLEELNIPVIQDLK--VG  945 (1183)
Q Consensus       871 ~~t~V~~I~~~~~--~gra~GV~~~~-~~~~~~i~A~k~VILAaGa~~tp~lL~~SGIG~~~~l~~~gi~v~~dlp--VG  945 (1183)
                      +++.|+||++++.  +.||+||++.+ ++...+++|+||||||||+|+||+|||+|||||+++|+++||++++|||  ||
T Consensus       250 t~a~V~rIl~~~~~~g~ra~GV~~~~~~g~~~~v~A~keVILaAGai~SP~LLl~SGIGp~~~L~~~gI~~v~dlP~Gvg  329 (391)
T d1gpea1         250 TGQMVGKVLFKQTASGPQAVGVNFGTNKAVNFDVFAKHEVLLAAGSAISPLILEYSGIGLKSVLDQANVTQLLDLPVGIC  329 (391)
T ss_dssp             ESCEEEEEEEEEETTEEEEEEEEEEEETTEEEEEEEEEEEEECSCTTTHHHHHHHTTEECHHHHHHTTCCCSEECCTTCT
T ss_pred             ccceeeEEeeeCCCCCceEEeeEEecCCCeEEEEEeCCEEEEecchhcchHHHHhcCCCcHHHHHHCCCCEEEECCcccc
Confidence            9999999998742  24899999975 5677899999999999999999999999999999999999999999999  99


Q ss_pred             ccccccccc
Q psy8892         946 YNMQDHLSM  954 (1183)
Q Consensus       946 ~nl~dh~~~  954 (1183)
                      +|||||+..
T Consensus       330 ~nl~dh~~~  338 (391)
T d1gpea1         330 SMMSRELGG  338 (391)
T ss_dssp             CBSCGGGTC
T ss_pred             cccccCccc
Confidence            999999874
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Back     information, alignment and structure
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1kdga2 d.16.1.1 (A:513-693) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), substrate-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d1gpea2 d.16.1.1 (A:329-524) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
>d1cf3a2 d.16.1.1 (A:325-520) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1ju2a2 d.16.1.1 (A:294-463) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1kdga2 d.16.1.1 (A:513-693) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), substrate-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1ju2a2 d.16.1.1 (A:294-463) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1cf3a2 d.16.1.1 (A:325-520) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1gpea2 d.16.1.1 (A:329-524) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1vg0a1 c.3.1.3 (A:3-444,A:558-606) Rab escort protein 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1vg0a1 c.3.1.3 (A:3-444,A:558-606) Rab escort protein 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure