Psyllid ID: psy8899
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 73 | ||||||
| 242017239 | 1151 | Tankyrase-1, putative [Pediculus humanus | 0.657 | 0.041 | 0.833 | 4e-17 | |
| 347966850 | 1155 | AGAP001947-PA [Anopheles gambiae str. PE | 0.657 | 0.041 | 0.812 | 1e-16 | |
| 157136041 | 1204 | tankyrase [Aedes aegypti] gi|108881109|g | 0.657 | 0.039 | 0.812 | 1e-16 | |
| 332029075 | 1234 | Tankyrase-1 [Acromyrmex echinatior] | 0.657 | 0.038 | 0.833 | 1e-16 | |
| 322799153 | 1240 | hypothetical protein SINV_04047 [Solenop | 0.657 | 0.038 | 0.833 | 1e-16 | |
| 307185654 | 1206 | Tankyrase-1 [Camponotus floridanus] | 0.657 | 0.039 | 0.833 | 1e-16 | |
| 340725973 | 1208 | PREDICTED: tankyrase-1-like [Bombus terr | 0.657 | 0.039 | 0.833 | 1e-16 | |
| 328779905 | 1193 | PREDICTED: tankyrase-1 isoform 1 [Apis m | 0.657 | 0.040 | 0.833 | 1e-16 | |
| 328779903 | 1208 | PREDICTED: tankyrase-1 isoform 2 [Apis m | 0.657 | 0.039 | 0.833 | 1e-16 | |
| 350397200 | 1208 | PREDICTED: tankyrase-1-like [Bombus impa | 0.657 | 0.039 | 0.833 | 1e-16 |
| >gi|242017239|ref|XP_002429099.1| Tankyrase-1, putative [Pediculus humanus corporis] gi|212513963|gb|EEB16361.1| Tankyrase-1, putative [Pediculus humanus corporis] | Back alignment and taxonomy information |
|---|
Score = 92.0 bits (227), Expect = 4e-17, Method: Composition-based stats.
Identities = 40/48 (83%), Positives = 44/48 (91%)
Query: 11 KSFLQFNAIKMAHAPPGHHSVMGRPSSGGLYFPEYVVYRGEQMCISYL 58
KSFLQF+A+KMAHAPPGHHSV+GRPS+GGLYFPEYVVYRGEQ YL
Sbjct: 1090 KSFLQFSAMKMAHAPPGHHSVVGRPSAGGLYFPEYVVYRGEQAYPEYL 1137
|
Source: Pediculus humanus corporis Species: Pediculus humanus Genus: Pediculus Family: Pediculidae Order: Phthiraptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|347966850|ref|XP_321116.5| AGAP001947-PA [Anopheles gambiae str. PEST] gi|333469871|gb|EAA01120.5| AGAP001947-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|157136041|ref|XP_001656741.1| tankyrase [Aedes aegypti] gi|108881109|gb|EAT45334.1| AAEL003391-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|332029075|gb|EGI69089.1| Tankyrase-1 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|322799153|gb|EFZ20592.1| hypothetical protein SINV_04047 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|307185654|gb|EFN71576.1| Tankyrase-1 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|340725973|ref|XP_003401338.1| PREDICTED: tankyrase-1-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|328779905|ref|XP_003249717.1| PREDICTED: tankyrase-1 isoform 1 [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|328779903|ref|XP_396483.4| PREDICTED: tankyrase-1 isoform 2 [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|350397200|ref|XP_003484803.1| PREDICTED: tankyrase-1-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 73 | ||||||
| FB|FBgn0027508 | 1181 | tankyrase "tankyrase" [Drosoph | 0.657 | 0.040 | 0.770 | 6.2e-15 | |
| UNIPROTKB|H0YAW5 | 61 | TNKS "Tankyrase-1" [Homo sapie | 0.589 | 0.704 | 0.744 | 4.9e-14 | |
| ZFIN|ZDB-GENE-030131-4865 | 1267 | si:ch211-155m12.3 "si:ch211-15 | 0.657 | 0.037 | 0.729 | 2.1e-13 | |
| ZFIN|ZDB-GENE-030131-7450 | 1280 | tnks "tankyrase, TRF1-interact | 0.657 | 0.037 | 0.729 | 2.1e-13 | |
| UNIPROTKB|E7EQ52 | 1090 | TNKS "Tankyrase-1" [Homo sapie | 0.657 | 0.044 | 0.708 | 4.6e-13 | |
| UNIPROTKB|F1P1N0 | 1269 | TNKS "Uncharacterized protein" | 0.657 | 0.037 | 0.708 | 5.6e-13 | |
| MGI|MGI:1341087 | 1320 | Tnks "tankyrase, TRF1-interact | 0.657 | 0.036 | 0.708 | 5.9e-13 | |
| UNIPROTKB|E1B8R5 | 1327 | TNKS "Uncharacterized protein" | 0.657 | 0.036 | 0.708 | 5.9e-13 | |
| UNIPROTKB|E2QU22 | 1327 | TNKS "Uncharacterized protein" | 0.657 | 0.036 | 0.708 | 5.9e-13 | |
| UNIPROTKB|O95271 | 1327 | TNKS "Tankyrase-1" [Homo sapie | 0.657 | 0.036 | 0.708 | 5.9e-13 |
| FB|FBgn0027508 tankyrase "tankyrase" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 203 (76.5 bits), Expect = 6.2e-15, P = 6.2e-15
Identities = 37/48 (77%), Positives = 43/48 (89%)
Query: 11 KSFLQFNAIKMAHAPPGHHSVMGRPSSGGLYFPEYVVYRGEQMCISYL 58
KSFLQ++A+KMAHAPPGHHSV+GRPS+GGL+F EYVVYRGEQ YL
Sbjct: 1115 KSFLQYSAMKMAHAPPGHHSVVGRPSAGGLHFAEYVVYRGEQSYPEYL 1162
|
|
| UNIPROTKB|H0YAW5 TNKS "Tankyrase-1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-4865 si:ch211-155m12.3 "si:ch211-155m12.3" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-030131-7450 tnks "tankyrase, TRF1-interacting ankyrin-related ADP-ribose polymerase" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E7EQ52 TNKS "Tankyrase-1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1P1N0 TNKS "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1341087 Tnks "tankyrase, TRF1-interacting ankyrin-related ADP-ribose polymerase" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1B8R5 TNKS "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2QU22 TNKS "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|O95271 TNKS "Tankyrase-1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 73 | |||
| cd01438 | 223 | cd01438, tankyrase_like, Tankyrases interact with | 3e-22 |
| >gnl|CDD|238718 cd01438, tankyrase_like, Tankyrases interact with the telomere reverse transcriptase complex (TERT) | Back alignment and domain information |
|---|
Score = 84.6 bits (209), Expect = 3e-22
Identities = 35/48 (72%), Positives = 40/48 (83%)
Query: 11 KSFLQFNAIKMAHAPPGHHSVMGRPSSGGLYFPEYVVYRGEQMCISYL 58
KSFLQF+A+KMAHAPPGHHSV+GRPS GL + EYV+YRGEQ YL
Sbjct: 168 KSFLQFSAMKMAHAPPGHHSVIGRPSVNGLAYAEYVIYRGEQAYPEYL 215
|
Tankyrase 1 poly-ADP-ribosylates Telomere Repeat Binding Factor 1 (TRF1) while Tankyrase 2 can poly-ADP-ribosylate itself or TRF1. The tankyrases also contain multiple ankyrin repeats that mediate protein-protein interaction (binding TRF1 and insulin-responsive aminopeptidase) and may function as a complex. Overexpression of Tank1 promotes increased telomere length when overexpressed, while overexpressed Tank2 has been shown to promote PARP cleavage- independent cell death (necrosis). Length = 223 |
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 73 | |||
| cd01438 | 223 | tankyrase_like Tankyrases interact with the telome | 99.93 | |
| PF00644 | 206 | PARP: Poly(ADP-ribose) polymerase catalytic domain | 99.75 | |
| cd01439 | 121 | TCCD_inducible_PARP_like Poly(ADP-ribose) polymera | 99.63 | |
| cd01437 | 347 | parp_like Poly(ADP-ribose) polymerase (parp) catal | 99.55 | |
| PLN03124 | 643 | poly [ADP-ribose] polymerase; Provisional | 99.1 | |
| PLN03123 | 981 | poly [ADP-ribose] polymerase; Provisional | 99.04 | |
| cd01341 | 137 | ADP_ribosyl ADP_ribosylating enzymes catalyze the | 98.69 | |
| PLN03122 | 815 | Poly [ADP-ribose] polymerase; Provisional | 98.33 | |
| KOG4177|consensus | 1143 | 95.61 | ||
| KOG1037|consensus | 531 | 94.84 |
| >cd01438 tankyrase_like Tankyrases interact with the telomere reverse transcriptase complex (TERT) | Back alignment and domain information |
|---|
Probab=99.93 E-value=1.3e-26 Score=170.18 Aligned_cols=66 Identities=53% Similarity=0.893 Sum_probs=63.6
Q ss_pred CeEEeeeecCCeeeEeecccccCCCCCCceeeeccCCCCCCcceEEEeeCcccceeEEEEeeecCC
Q psy8899 1 MFVLGTANHSKSFLQFNAIKMAHAPPGHHSVMGRPSSGGLYFPEYVVYRGEQMCISYLAKNLYLRL 66 (73)
Q Consensus 1 ~~llcrV~vGr~~~~~~~~~~~~pPpGyhSViG~p~~ggLnY~E~VVY~~eqi~P~yLI~Y~~~~~ 66 (73)
.||||||++|+++.+.+++.+++||+|||||+|.|+.++++|+|||||+++||||+|||+|+++||
T Consensus 158 ~MfLcrVlLGk~~~~~~~~~~~~~P~G~dSv~g~Ps~~~~~~~EfVVyd~~Q~YPeYLI~y~~~~~ 223 (223)
T cd01438 158 QMLFCRVTLGKSFLQFSAMKMAHAPPGHHSVIGRPSVNGLAYAEYVIYRGEQAYPEYLITYQIVKP 223 (223)
T ss_pred eEEEEEEEecceeeccCCcccCCCCCCCcceEcCCCCCCcccCEEEEECCCcEeeEEEEEEEeeCC
Confidence 389999999999988899999999999999999999999999999999999999999999999998
|
Tankyrase 1 poly-ADP-ribosylates Telomere Repeat Binding Factor 1 (TRF1) while Tankyrase 2 can poly-ADP-ribosylate itself or TRF1. The tankyrases also contain multiple ankyrin repeats that mediate protein-protein interaction (binding TRF1 and insulin-responsive aminopeptidase) and may function as a complex. Overexpression of Tank1 promotes increased telomere length when overexpressed, while overexpressed Tank2 has been shown to promote PARP cleavage- independent cell death (necrosis). |
| >PF00644 PARP: Poly(ADP-ribose) polymerase catalytic domain; InterPro: IPR012317 Poly(ADP-ribose) polymerases (PARP) are a family of enzymes present in eukaryotes, which catalyze the poly(ADP-ribosyl)ation of a limited number of proteins involved in chromatin architecture, DNA repair, or in DNA metabolism, including PARP itself | Back alignment and domain information |
|---|
| >cd01439 TCCD_inducible_PARP_like Poly(ADP-ribose) polymerases catalyse the covalent attachment of ADP-ribose units from NAD+ to itself and to a limited number of other DNA binding proteins, which decreases their affinity for DNA | Back alignment and domain information |
|---|
| >cd01437 parp_like Poly(ADP-ribose) polymerase (parp) catalytic domain catalyses the covalent attachment of ADP-ribose units from NAD+ to itself and to a limited number of other DNA binding proteins, which decreases their affinity for DNA | Back alignment and domain information |
|---|
| >PLN03124 poly [ADP-ribose] polymerase; Provisional | Back alignment and domain information |
|---|
| >PLN03123 poly [ADP-ribose] polymerase; Provisional | Back alignment and domain information |
|---|
| >cd01341 ADP_ribosyl ADP_ribosylating enzymes catalyze the transfer of ADP_ribose from NAD+ to substrates | Back alignment and domain information |
|---|
| >PLN03122 Poly [ADP-ribose] polymerase; Provisional | Back alignment and domain information |
|---|
| >KOG4177|consensus | Back alignment and domain information |
|---|
| >KOG1037|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 73 | ||||
| 3udd_A | 224 | Tankyrase-1 In Complex With Small Molecule Inhibito | 4e-15 | ||
| 2rf5_A | 258 | Crystal Structure Of Human Tankyrase 1- Catalytic P | 4e-15 | ||
| 4dvi_A | 217 | Crystal Structure Of Tankyrase 1 With Iwr2 Length = | 1e-14 | ||
| 3kr7_A | 240 | Human Tankyrase 2 - Catalytic Parp Domain Length = | 2e-14 | ||
| 3mhk_A | 223 | Human Tankyrase 2 - Catalytic Parp Domain In Comple | 3e-14 | ||
| 4hki_C | 49 | Tankyrase 2 In Complex With Flavone Length = 49 | 7e-10 |
| >pdb|3UDD|A Chain A, Tankyrase-1 In Complex With Small Molecule Inhibitor Length = 224 | Back alignment and structure |
|
| >pdb|2RF5|A Chain A, Crystal Structure Of Human Tankyrase 1- Catalytic Parp Domain Length = 258 | Back alignment and structure |
| >pdb|4DVI|A Chain A, Crystal Structure Of Tankyrase 1 With Iwr2 Length = 217 | Back alignment and structure |
| >pdb|3KR7|A Chain A, Human Tankyrase 2 - Catalytic Parp Domain Length = 240 | Back alignment and structure |
| >pdb|3MHK|A Chain A, Human Tankyrase 2 - Catalytic Parp Domain In Complex With 2-(2- Pyridyl)-7,8-Dihydro-5h-Thiino[4,3-D]pyrimidin-4-Ol Length = 223 | Back alignment and structure |
| >pdb|4HKI|C Chain C, Tankyrase 2 In Complex With Flavone Length = 49 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 73 | |||
| 3u9h_A | 240 | Tankyrase-2; protein-ligand complex, diphtheria to | 4e-11 | |
| 4f0d_A | 277 | PARP-16, poly [ADP-ribose] polymerase 16; transfer | 3e-04 | |
| 4dqy_C | 506 | Poly [ADP-ribose] polymerase 1; PARP, poly(ADP-rib | 3e-04 | |
| 3blj_A | 221 | Poly(ADP-ribose) polymerase 15; PARP, BAL-3, SGC, | 6e-04 | |
| 1efy_A | 350 | Poly (ADP-ribose) polymerase; benzimidazole, inhib | 6e-04 | |
| 3smj_A | 193 | Poly [ADP-ribose] polymerase 14; diphtheria toxin | 7e-04 |
| >3u9h_A Tankyrase-2; protein-ligand complex, diphtheria toxin like fold, transfer ribosylation; HET: SO4; 1.75A {Homo sapiens} PDB: 3kr8_A* 3kr7_A* 3p0n_A* 3p0p_A* 3p0q_A* 3mhj_A* 3u9y_A* 3ua9_A* 4avu_A* 4avw_A* 3mhk_A* 2rf5_A 3udd_A* 3uh2_A* 3uh4_A* 4dvi_A* Length = 240 | Back alignment and structure |
|---|
Score = 54.7 bits (131), Expect = 4e-11
Identities = 34/58 (58%), Positives = 39/58 (67%)
Query: 1 MFVLGTANHSKSFLQFNAIKMAHAPPGHHSVMGRPSSGGLYFPEYVVYRGEQMCISYL 58
+ KSFLQF+A+KMAH+PPGHHSV GRPS GL EYV+YRGEQ YL
Sbjct: 173 QLLFCRVTLGKSFLQFSAMKMAHSPPGHHSVTGRPSVNGLALAEYVIYRGEQAYPEYL 230
|
| >4f0d_A PARP-16, poly [ADP-ribose] polymerase 16; transferase, ARTD15, structural genomics structural genomics consortium, SGC; HET: 3AB; 2.70A {Homo sapiens} Length = 277 | Back alignment and structure |
|---|
| >4dqy_C Poly [ADP-ribose] polymerase 1; PARP, poly(ADP-ribose) polymerase, DNA binding protein, ADP- transferase, PARP-like zinc finger, poly(ADP-ribosyl)ation; HET: DNA; 3.25A {Homo sapiens} PDB: 2cr9_A Length = 506 | Back alignment and structure |
|---|
| >3blj_A Poly(ADP-ribose) polymerase 15; PARP, BAL-3, SGC, structural GE consortium, glycosyltransferase, NAD, nucleus; 2.20A {Homo sapiens} PDB: 3gey_A* Length = 221 | Back alignment and structure |
|---|
| >1efy_A Poly (ADP-ribose) polymerase; benzimidazole, inhibitor, catalytic fragment, transferase; HET: BZC; 2.20A {Gallus gallus} SCOP: a.41.1.1 d.166.1.2 PDB: 1a26_A* 1pax_A* 2paw_A 2pax_A* 3pax_A* 4pax_A* 2rcw_A* 1uk1_A* 1wok_A* 1uk0_A* 2rd6_A* 3gjw_A* 3gn7_A* 3l3l_A* 3l3m_A* Length = 350 | Back alignment and structure |
|---|
| >3smj_A Poly [ADP-ribose] polymerase 14; diphtheria toxin like fold, transferase, NAD+, ADP-ribosylat transferase-transferase inhibitor complex; HET: FDR; 1.50A {Homo sapiens} PDB: 3goy_A* 3smi_A* 3se2_A* Length = 193 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 73 | |||
| 3u9h_A | 240 | Tankyrase-2; protein-ligand complex, diphtheria to | 99.92 | |
| 2x5y_A | 173 | Zinc finger CCCH-type antiviral protein 1; antivir | 99.75 | |
| 1efy_A | 350 | Poly (ADP-ribose) polymerase; benzimidazole, inhib | 99.75 | |
| 3hkv_A | 217 | PARP-10, poly [ADP-ribose] polymerase 10; NAD, tra | 99.72 | |
| 3smj_A | 193 | Poly [ADP-ribose] polymerase 14; diphtheria toxin | 99.71 | |
| 2pqf_A | 198 | Poly [ADP-ribose] polymerase 12; enzyme-inhibitor | 99.7 | |
| 4dqy_C | 506 | Poly [ADP-ribose] polymerase 1; PARP, poly(ADP-rib | 99.69 | |
| 3kjd_A | 368 | Poly [ADP-ribose] polymerase 2; transferase, enzym | 99.69 | |
| 3blj_A | 221 | Poly(ADP-ribose) polymerase 15; PARP, BAL-3, SGC, | 99.68 | |
| 3c4h_A | 357 | Poly(ADP-ribose) polymerase 3; enzyme-inhibitor co | 99.67 |
| >3u9h_A Tankyrase-2; protein-ligand complex, diphtheria toxin like fold, transfer ribosylation; HET: SO4; 1.75A {Homo sapiens} PDB: 3kr8_A* 3kr7_A* 3p0n_A* 3p0p_A* 3p0q_A* 3mhj_A* 3u9y_A* 3ua9_A* 4avu_A* 4avw_A* 3mhk_A* 2rf5_A 3udd_A* 3uh2_A* 3uh4_A* 4dvi_A* 4hlh_A* 4hki_A* 4hkn_A* 4hl5_A* ... | Back alignment and structure |
|---|
Probab=99.92 E-value=1.8e-25 Score=161.52 Aligned_cols=66 Identities=53% Similarity=0.891 Sum_probs=61.7
Q ss_pred eEEeeeecCCeeeEeecccccCCCCCCceeeeccCCCCCCcceEEEeeCcccceeEEEEeeecCCc
Q psy8899 2 FVLGTANHSKSFLQFNAIKMAHAPPGHHSVMGRPSSGGLYFPEYVVYRGEQMCISYLAKNLYLRLD 67 (73)
Q Consensus 2 ~llcrV~vGr~~~~~~~~~~~~pPpGyhSViG~p~~ggLnY~E~VVY~~eqi~P~yLI~Y~~~~~~ 67 (73)
||||||++|+.++.++++.++.||+|||||+|.|+.++|+|+|+|||+++||+|+|||+|++.+|+
T Consensus 174 mlLc~V~lG~~~~~~~~~~~~~pP~gyDSvvg~~~~~~l~~~E~VVy~~~qi~P~YlI~y~~~~~~ 239 (240)
T 3u9h_A 174 LLFCRVTLGKSFLQFSAMKMAHSPPGHHSVTGRPSVNGLALAEYVIYRGEQAYPEYLITYQIMRPE 239 (240)
T ss_dssp EEEEEEECCSEEEEEECC--CCCCTTCSEEEEEESSCTTCCCEEEESCGGGEEEEEEEEEEECCCC
T ss_pred EEEEEEecCceEeecCcccccCCCCCCCceecCCCCCCCCCCEEEEEcccceeEEEEEEEEccCCC
Confidence 899999999999988888888999999999999998889999999999999999999999999997
|
| >2x5y_A Zinc finger CCCH-type antiviral protein 1; antiviral defense, immune system, transferase; 1.05A {Homo sapiens} | Back alignment and structure |
|---|
| >1efy_A Poly (ADP-ribose) polymerase; benzimidazole, inhibitor, catalytic fragment, transferase; HET: BZC; 2.20A {Gallus gallus} SCOP: a.41.1.1 d.166.1.2 PDB: 1a26_A* 1pax_A* 2paw_A 2pax_A* 3pax_A* 4pax_A* 2rcw_A* 1uk1_A* 1wok_A* 1uk0_A* 2rd6_A* 3gjw_A* 3gn7_A* 3l3l_A* 3l3m_A* | Back alignment and structure |
|---|
| >3hkv_A PARP-10, poly [ADP-ribose] polymerase 10; NAD, transferase, structural genomics, structural genomics consortium, SGC, cytoplasm, glycosyltransferase; HET: 3AB; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3smj_A Poly [ADP-ribose] polymerase 14; diphtheria toxin like fold, transferase, NAD+, ADP-ribosylat transferase-transferase inhibitor complex; HET: FDR; 1.50A {Homo sapiens} PDB: 3goy_A* 3smi_A* 3se2_A* 4f1l_A* 4f1q_A* | Back alignment and structure |
|---|
| >2pqf_A Poly [ADP-ribose] polymerase 12; enzyme-inhibitor complex, catalytic fragment, structural GEN structural genomics consortium, SGC, transferase; HET: GAB CIT; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >4dqy_C Poly [ADP-ribose] polymerase 1; PARP, poly(ADP-ribose) polymerase, DNA binding protein, ADP- transferase, PARP-like zinc finger, poly(ADP-ribosyl)ation; HET: DNA; 3.25A {Homo sapiens} PDB: 2cr9_A | Back alignment and structure |
|---|
| >3kjd_A Poly [ADP-ribose] polymerase 2; transferase, enzyme-inhibitor complex, catalytic fragment, S genomics, structural genomics consortium, SGC; HET: 78P; 1.95A {Homo sapiens} PDB: 3kcz_A* 1gs0_A | Back alignment and structure |
|---|
| >3blj_A Poly(ADP-ribose) polymerase 15; PARP, BAL-3, SGC, structural GE consortium, glycosyltransferase, NAD, nucleus; 2.20A {Homo sapiens} PDB: 3gey_A* | Back alignment and structure |
|---|
| >3c4h_A Poly(ADP-ribose) polymerase 3; enzyme-inhibitor complex, catalytic fragment, structural GEN structural genomics consortium, SGC; HET: DRL; 2.10A {Homo sapiens} PDB: 3c49_A* 2pa9_A* 3ce0_A* 3fhb_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 73 | ||||
| d1gs0a2 | 217 | d.166.1.2 (A:341-557) Poly(ADP-ribose) polymerase, | 0.003 |
| >d1gs0a2 d.166.1.2 (A:341-557) Poly(ADP-ribose) polymerase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 217 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: ADP-ribosylation superfamily: ADP-ribosylation family: Poly(ADP-ribose) polymerase, C-terminal domain domain: Poly(ADP-ribose) polymerase, C-terminal domain species: Mouse (Mus musculus) [TaxId: 10090]
Score = 32.0 bits (72), Expect = 0.003
Identities = 9/34 (26%), Positives = 16/34 (47%)
Query: 25 PPGHHSVMGRPSSGGLYFPEYVVYRGEQMCISYL 58
P + + P L + E++VY Q+ + YL
Sbjct: 175 GPASDTGILNPEGYTLNYNEFIVYSPNQVRMRYL 208
|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 73 | |||
| d1efya2 | 215 | Poly(ADP-ribose) polymerase, C-terminal domain {Ch | 99.76 | |
| d1gs0a2 | 217 | Poly(ADP-ribose) polymerase, C-terminal domain {Mo | 99.67 |
| >d1efya2 d.166.1.2 (A:797-1011) Poly(ADP-ribose) polymerase, C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: ADP-ribosylation superfamily: ADP-ribosylation family: Poly(ADP-ribose) polymerase, C-terminal domain domain: Poly(ADP-ribose) polymerase, C-terminal domain species: Chicken (Gallus gallus) [TaxId: 9031]
Probab=99.76 E-value=5.7e-19 Score=122.42 Aligned_cols=63 Identities=30% Similarity=0.497 Sum_probs=55.1
Q ss_pred CeEEeeeecCCeeeEeecccccCCCCCCceeeecc---------------------------CCCCCCcceEEEeeCccc
Q psy8899 1 MFVLGTANHSKSFLQFNAIKMAHAPPGHHSVMGRP---------------------------SSGGLYFPEYVVYRGEQM 53 (73)
Q Consensus 1 ~~llcrV~vGr~~~~~~~~~~~~pPpGyhSViG~p---------------------------~~ggLnY~E~VVY~~eqi 53 (73)
.||||||++|+.+..+.+..++.||+|+||+.|.- ..+++.|+|||||+++|+
T Consensus 122 ~mll~~V~lG~~~~~~~~~~~~~~p~g~~s~~~~g~~~pd~~~~~~~d~v~vP~g~~~~~~~~~~~~~~~EyVVy~~~Q~ 201 (215)
T d1efya2 122 LILLGEVALGNMYELKNASHITKLPKGKHSVKGLGKTAPDPTATTTLDGVEVPLGNGISTGINDTCLLYNEYIVYDVAQV 201 (215)
T ss_dssp EEEEEEEECCSEEEESSCCCCCSCCTTCCEEEECCSEEECGGGCEEETTEEECCSCEEECSCCSSSCSBCEEEESCGGGE
T ss_pred EEEEEEEEecceEEecCccccccCCCCccccccccccCCChhhccccCCeeccCCCccccCCcCCccccCEEEEEechhE
Confidence 38999999999987778888999999999997631 235689999999999999
Q ss_pred ceeEEEEeee
Q psy8899 54 CISYLAKNLY 63 (73)
Q Consensus 54 ~P~yLI~Y~~ 63 (73)
+|+|||.|+.
T Consensus 202 ~p~YLI~~k~ 211 (215)
T d1efya2 202 NLKYLLKLKF 211 (215)
T ss_dssp EEEEEEEEEE
T ss_pred eEEEEEEEEE
Confidence 9999999985
|
| >d1gs0a2 d.166.1.2 (A:341-557) Poly(ADP-ribose) polymerase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|