Psyllid ID: psy8899


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70---
MFVLGTANHSKSFLQFNAIKMAHAPPGHHSVMGRPSSGGLYFPEYVVYRGEQMCISYLAKNLYLRLDKANRIE
cEEEEEEEEcccHHHHHHHHHccccccccccccccccccccccEEEEEEcccccEEEEEEEEccccccccccc
cEEEEcccccHHHHHHHHHHHHccccccccEEcccccccccccEEEEEEcccccHHHHHHHEEcccccccccc
mfvlgtanhskSFLQFNAikmahappghhsvmgrpssgglyfpeyVVYRGEQMCISYLAKNLYLRLDKANRIE
MFVLGTANHSKSFLQFNAIKMAHAPPGHHSVMGRPSSGGLYFPEYVVYRGEQMCISYLAKNlylrldkanrie
MFVLGTANHSKSFLQFNAIKMAHAPPGHHSVMGRPSSGGLYFPEYVVYRGEQMCISYLAKNLYLRLDKANRIE
************FLQFNAIK*****************GGLYFPEYVVYRGEQMCISYLAKNLYLRLD******
MFVLGTANHSKSFLQFNAIKMAHAPPGHHSVMGRPSSGGLYFPEYVVYRGEQMCISYLAKNLY**********
********HSKSFLQFNAIKMAHAPPGHHSVMGRPSSGGLYFPEYVVYRGEQMCISYLAKNLYLRLDKANRIE
MFVLGTANHSKSFLQFNAIKMAHAPPGHHSVMGRPSSGGLYFPEYVVYRGEQMCISYLAKNLYLRLDKA****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFVLGTANHSKSFLQFNAIKMAHAPPGHHSVMGRPSSGGLYFPEYVVYRGEQMCISYLAKNLYLRLDKANRIE
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query73 2.2.26 [Sep-21-2011]
O952711327 Tankyrase-1 OS=Homo sapie yes N/A 0.657 0.036 0.708 1e-14
Q6PFX91320 Tankyrase-1 OS=Mus muscul yes N/A 0.657 0.036 0.708 2e-14
Q3UES31166 Tankyrase-2 OS=Mus muscul no N/A 0.657 0.041 0.708 3e-14
Q9H2K21166 Tankyrase-2 OS=Homo sapie no N/A 0.657 0.041 0.708 3e-14
>sp|O95271|TNKS1_HUMAN Tankyrase-1 OS=Homo sapiens GN=TNKS PE=1 SV=2 Back     alignment and function desciption
 Score = 78.2 bits (191), Expect = 1e-14,   Method: Composition-based stats.
 Identities = 34/48 (70%), Positives = 39/48 (81%)

Query: 11   KSFLQFNAIKMAHAPPGHHSVMGRPSSGGLYFPEYVVYRGEQMCISYL 58
            KSFLQF+ +KMAHAPPGHHSV+GRPS  GL + EYV+YRGEQ    YL
Sbjct: 1258 KSFLQFSTMKMAHAPPGHHSVIGRPSVNGLAYAEYVIYRGEQAYPEYL 1305




Poly-ADP-ribosyltransferase involved in various processes such as Wnt signaling pathway, telomere length and vesicle trafficking. Acts as an activator of the Wnt signaling pathway by mediating poly-ADP-ribosylation of AXIN1 and AXIN2, 2 key components of the beta-catenin destruction complex: poly-ADP-ribosylated target proteins are recognized by RNF146, which mediates their ubiquitination and subsequent degradation. Also mediates poly-ADP-ribosylation of BLZF1 and CASC3, followed by recruitment of RNF146 and subsequent ubiquitination. Mediates poly-ADP-ribosylation of TERF1, thereby contributing to the regulation of telomere length. May also regulate vesicle trafficking and modulate the subcellular distribution of SLC2A4/GLUT4-vesicles.
Homo sapiens (taxid: 9606)
EC: 2EC: .EC: 4EC: .EC: 2EC: .EC: 3EC: 0
>sp|Q6PFX9|TNKS1_MOUSE Tankyrase-1 OS=Mus musculus GN=Tnks PE=1 SV=1 Back     alignment and function description
>sp|Q3UES3|TNKS2_MOUSE Tankyrase-2 OS=Mus musculus GN=Tnks2 PE=2 SV=2 Back     alignment and function description
>sp|Q9H2K2|TNKS2_HUMAN Tankyrase-2 OS=Homo sapiens GN=TNKS2 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query73
242017239 1151 Tankyrase-1, putative [Pediculus humanus 0.657 0.041 0.833 4e-17
347966850 1155 AGAP001947-PA [Anopheles gambiae str. PE 0.657 0.041 0.812 1e-16
157136041 1204 tankyrase [Aedes aegypti] gi|108881109|g 0.657 0.039 0.812 1e-16
332029075 1234 Tankyrase-1 [Acromyrmex echinatior] 0.657 0.038 0.833 1e-16
322799153 1240 hypothetical protein SINV_04047 [Solenop 0.657 0.038 0.833 1e-16
307185654 1206 Tankyrase-1 [Camponotus floridanus] 0.657 0.039 0.833 1e-16
340725973 1208 PREDICTED: tankyrase-1-like [Bombus terr 0.657 0.039 0.833 1e-16
328779905 1193 PREDICTED: tankyrase-1 isoform 1 [Apis m 0.657 0.040 0.833 1e-16
328779903 1208 PREDICTED: tankyrase-1 isoform 2 [Apis m 0.657 0.039 0.833 1e-16
350397200 1208 PREDICTED: tankyrase-1-like [Bombus impa 0.657 0.039 0.833 1e-16
>gi|242017239|ref|XP_002429099.1| Tankyrase-1, putative [Pediculus humanus corporis] gi|212513963|gb|EEB16361.1| Tankyrase-1, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score = 92.0 bits (227), Expect = 4e-17,   Method: Composition-based stats.
 Identities = 40/48 (83%), Positives = 44/48 (91%)

Query: 11   KSFLQFNAIKMAHAPPGHHSVMGRPSSGGLYFPEYVVYRGEQMCISYL 58
            KSFLQF+A+KMAHAPPGHHSV+GRPS+GGLYFPEYVVYRGEQ    YL
Sbjct: 1090 KSFLQFSAMKMAHAPPGHHSVVGRPSAGGLYFPEYVVYRGEQAYPEYL 1137




Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|347966850|ref|XP_321116.5| AGAP001947-PA [Anopheles gambiae str. PEST] gi|333469871|gb|EAA01120.5| AGAP001947-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|157136041|ref|XP_001656741.1| tankyrase [Aedes aegypti] gi|108881109|gb|EAT45334.1| AAEL003391-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|332029075|gb|EGI69089.1| Tankyrase-1 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|322799153|gb|EFZ20592.1| hypothetical protein SINV_04047 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|307185654|gb|EFN71576.1| Tankyrase-1 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|340725973|ref|XP_003401338.1| PREDICTED: tankyrase-1-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|328779905|ref|XP_003249717.1| PREDICTED: tankyrase-1 isoform 1 [Apis mellifera] Back     alignment and taxonomy information
>gi|328779903|ref|XP_396483.4| PREDICTED: tankyrase-1 isoform 2 [Apis mellifera] Back     alignment and taxonomy information
>gi|350397200|ref|XP_003484803.1| PREDICTED: tankyrase-1-like [Bombus impatiens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query73
FB|FBgn00275081181 tankyrase "tankyrase" [Drosoph 0.657 0.040 0.770 6.2e-15
UNIPROTKB|H0YAW561 TNKS "Tankyrase-1" [Homo sapie 0.589 0.704 0.744 4.9e-14
ZFIN|ZDB-GENE-030131-48651267 si:ch211-155m12.3 "si:ch211-15 0.657 0.037 0.729 2.1e-13
ZFIN|ZDB-GENE-030131-74501280 tnks "tankyrase, TRF1-interact 0.657 0.037 0.729 2.1e-13
UNIPROTKB|E7EQ521090 TNKS "Tankyrase-1" [Homo sapie 0.657 0.044 0.708 4.6e-13
UNIPROTKB|F1P1N01269 TNKS "Uncharacterized protein" 0.657 0.037 0.708 5.6e-13
MGI|MGI:13410871320 Tnks "tankyrase, TRF1-interact 0.657 0.036 0.708 5.9e-13
UNIPROTKB|E1B8R51327 TNKS "Uncharacterized protein" 0.657 0.036 0.708 5.9e-13
UNIPROTKB|E2QU221327 TNKS "Uncharacterized protein" 0.657 0.036 0.708 5.9e-13
UNIPROTKB|O952711327 TNKS "Tankyrase-1" [Homo sapie 0.657 0.036 0.708 5.9e-13
FB|FBgn0027508 tankyrase "tankyrase" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 203 (76.5 bits), Expect = 6.2e-15, P = 6.2e-15
 Identities = 37/48 (77%), Positives = 43/48 (89%)

Query:    11 KSFLQFNAIKMAHAPPGHHSVMGRPSSGGLYFPEYVVYRGEQMCISYL 58
             KSFLQ++A+KMAHAPPGHHSV+GRPS+GGL+F EYVVYRGEQ    YL
Sbjct:  1115 KSFLQYSAMKMAHAPPGHHSVVGRPSAGGLHFAEYVVYRGEQSYPEYL 1162




GO:0007016 "cytoskeletal anchoring at plasma membrane" evidence=ISS
GO:0005200 "structural constituent of cytoskeleton" evidence=ISS
GO:0003950 "NAD+ ADP-ribosyltransferase activity" evidence=IEA
GO:0035220 "wing disc development" evidence=IGI
GO:0022416 "chaeta development" evidence=IGI
UNIPROTKB|H0YAW5 TNKS "Tankyrase-1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-4865 si:ch211-155m12.3 "si:ch211-155m12.3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-7450 tnks "tankyrase, TRF1-interacting ankyrin-related ADP-ribose polymerase" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E7EQ52 TNKS "Tankyrase-1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1P1N0 TNKS "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
MGI|MGI:1341087 Tnks "tankyrase, TRF1-interacting ankyrin-related ADP-ribose polymerase" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E1B8R5 TNKS "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2QU22 TNKS "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|O95271 TNKS "Tankyrase-1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O95271TNKS1_HUMAN2, ., 4, ., 2, ., 3, 00.70830.65750.0361yesN/A
Q6PFX9TNKS1_MOUSE2, ., 4, ., 2, ., 3, 00.70830.65750.0363yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query73
cd01438223 cd01438, tankyrase_like, Tankyrases interact with 3e-22
>gnl|CDD|238718 cd01438, tankyrase_like, Tankyrases interact with the telomere reverse transcriptase complex (TERT) Back     alignment and domain information
 Score = 84.6 bits (209), Expect = 3e-22
 Identities = 35/48 (72%), Positives = 40/48 (83%)

Query: 11  KSFLQFNAIKMAHAPPGHHSVMGRPSSGGLYFPEYVVYRGEQMCISYL 58
           KSFLQF+A+KMAHAPPGHHSV+GRPS  GL + EYV+YRGEQ    YL
Sbjct: 168 KSFLQFSAMKMAHAPPGHHSVIGRPSVNGLAYAEYVIYRGEQAYPEYL 215


Tankyrase 1 poly-ADP-ribosylates Telomere Repeat Binding Factor 1 (TRF1) while Tankyrase 2 can poly-ADP-ribosylate itself or TRF1. The tankyrases also contain multiple ankyrin repeats that mediate protein-protein interaction (binding TRF1 and insulin-responsive aminopeptidase) and may function as a complex. Overexpression of Tank1 promotes increased telomere length when overexpressed, while overexpressed Tank2 has been shown to promote PARP cleavage- independent cell death (necrosis). Length = 223

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 73
cd01438223 tankyrase_like Tankyrases interact with the telome 99.93
PF00644206 PARP: Poly(ADP-ribose) polymerase catalytic domain 99.75
cd01439121 TCCD_inducible_PARP_like Poly(ADP-ribose) polymera 99.63
cd01437347 parp_like Poly(ADP-ribose) polymerase (parp) catal 99.55
PLN03124643 poly [ADP-ribose] polymerase; Provisional 99.1
PLN03123981 poly [ADP-ribose] polymerase; Provisional 99.04
cd01341137 ADP_ribosyl ADP_ribosylating enzymes catalyze the 98.69
PLN03122815 Poly [ADP-ribose] polymerase; Provisional 98.33
KOG4177|consensus1143 95.61
KOG1037|consensus531 94.84
>cd01438 tankyrase_like Tankyrases interact with the telomere reverse transcriptase complex (TERT) Back     alignment and domain information
Probab=99.93  E-value=1.3e-26  Score=170.18  Aligned_cols=66  Identities=53%  Similarity=0.893  Sum_probs=63.6

Q ss_pred             CeEEeeeecCCeeeEeecccccCCCCCCceeeeccCCCCCCcceEEEeeCcccceeEEEEeeecCC
Q psy8899           1 MFVLGTANHSKSFLQFNAIKMAHAPPGHHSVMGRPSSGGLYFPEYVVYRGEQMCISYLAKNLYLRL   66 (73)
Q Consensus         1 ~~llcrV~vGr~~~~~~~~~~~~pPpGyhSViG~p~~ggLnY~E~VVY~~eqi~P~yLI~Y~~~~~   66 (73)
                      .||||||++|+++.+.+++.+++||+|||||+|.|+.++++|+|||||+++||||+|||+|+++||
T Consensus       158 ~MfLcrVlLGk~~~~~~~~~~~~~P~G~dSv~g~Ps~~~~~~~EfVVyd~~Q~YPeYLI~y~~~~~  223 (223)
T cd01438         158 QMLFCRVTLGKSFLQFSAMKMAHAPPGHHSVIGRPSVNGLAYAEYVIYRGEQAYPEYLITYQIVKP  223 (223)
T ss_pred             eEEEEEEEecceeeccCCcccCCCCCCCcceEcCCCCCCcccCEEEEECCCcEeeEEEEEEEeeCC
Confidence            389999999999988899999999999999999999999999999999999999999999999998



Tankyrase 1 poly-ADP-ribosylates Telomere Repeat Binding Factor 1 (TRF1) while Tankyrase 2 can poly-ADP-ribosylate itself or TRF1. The tankyrases also contain multiple ankyrin repeats that mediate protein-protein interaction (binding TRF1 and insulin-responsive aminopeptidase) and may function as a complex. Overexpression of Tank1 promotes increased telomere length when overexpressed, while overexpressed Tank2 has been shown to promote PARP cleavage- independent cell death (necrosis).

>PF00644 PARP: Poly(ADP-ribose) polymerase catalytic domain; InterPro: IPR012317 Poly(ADP-ribose) polymerases (PARP) are a family of enzymes present in eukaryotes, which catalyze the poly(ADP-ribosyl)ation of a limited number of proteins involved in chromatin architecture, DNA repair, or in DNA metabolism, including PARP itself Back     alignment and domain information
>cd01439 TCCD_inducible_PARP_like Poly(ADP-ribose) polymerases catalyse the covalent attachment of ADP-ribose units from NAD+ to itself and to a limited number of other DNA binding proteins, which decreases their affinity for DNA Back     alignment and domain information
>cd01437 parp_like Poly(ADP-ribose) polymerase (parp) catalytic domain catalyses the covalent attachment of ADP-ribose units from NAD+ to itself and to a limited number of other DNA binding proteins, which decreases their affinity for DNA Back     alignment and domain information
>PLN03124 poly [ADP-ribose] polymerase; Provisional Back     alignment and domain information
>PLN03123 poly [ADP-ribose] polymerase; Provisional Back     alignment and domain information
>cd01341 ADP_ribosyl ADP_ribosylating enzymes catalyze the transfer of ADP_ribose from NAD+ to substrates Back     alignment and domain information
>PLN03122 Poly [ADP-ribose] polymerase; Provisional Back     alignment and domain information
>KOG4177|consensus Back     alignment and domain information
>KOG1037|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query73
3udd_A224 Tankyrase-1 In Complex With Small Molecule Inhibito 4e-15
2rf5_A258 Crystal Structure Of Human Tankyrase 1- Catalytic P 4e-15
4dvi_A217 Crystal Structure Of Tankyrase 1 With Iwr2 Length = 1e-14
3kr7_A240 Human Tankyrase 2 - Catalytic Parp Domain Length = 2e-14
3mhk_A223 Human Tankyrase 2 - Catalytic Parp Domain In Comple 3e-14
4hki_C49 Tankyrase 2 In Complex With Flavone Length = 49 7e-10
>pdb|3UDD|A Chain A, Tankyrase-1 In Complex With Small Molecule Inhibitor Length = 224 Back     alignment and structure

Iteration: 1

Score = 76.3 bits (186), Expect = 4e-15, Method: Compositional matrix adjust. Identities = 35/48 (72%), Positives = 39/48 (81%) Query: 11 KSFLQFNAIKMAHAPPGHHSVMGRPSSGGLYFPEYVVYRGEQMCISYL 58 KSFLQF+ IKMAHAPPGHHSV+GRPS GL + EYV+YRGEQ YL Sbjct: 155 KSFLQFSTIKMAHAPPGHHSVIGRPSVNGLAYAEYVIYRGEQAYPEYL 202
>pdb|2RF5|A Chain A, Crystal Structure Of Human Tankyrase 1- Catalytic Parp Domain Length = 258 Back     alignment and structure
>pdb|4DVI|A Chain A, Crystal Structure Of Tankyrase 1 With Iwr2 Length = 217 Back     alignment and structure
>pdb|3KR7|A Chain A, Human Tankyrase 2 - Catalytic Parp Domain Length = 240 Back     alignment and structure
>pdb|3MHK|A Chain A, Human Tankyrase 2 - Catalytic Parp Domain In Complex With 2-(2- Pyridyl)-7,8-Dihydro-5h-Thiino[4,3-D]pyrimidin-4-Ol Length = 223 Back     alignment and structure
>pdb|4HKI|C Chain C, Tankyrase 2 In Complex With Flavone Length = 49 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query73
3u9h_A240 Tankyrase-2; protein-ligand complex, diphtheria to 4e-11
4f0d_A277 PARP-16, poly [ADP-ribose] polymerase 16; transfer 3e-04
4dqy_C506 Poly [ADP-ribose] polymerase 1; PARP, poly(ADP-rib 3e-04
3blj_A221 Poly(ADP-ribose) polymerase 15; PARP, BAL-3, SGC, 6e-04
1efy_A350 Poly (ADP-ribose) polymerase; benzimidazole, inhib 6e-04
3smj_A193 Poly [ADP-ribose] polymerase 14; diphtheria toxin 7e-04
>3u9h_A Tankyrase-2; protein-ligand complex, diphtheria toxin like fold, transfer ribosylation; HET: SO4; 1.75A {Homo sapiens} PDB: 3kr8_A* 3kr7_A* 3p0n_A* 3p0p_A* 3p0q_A* 3mhj_A* 3u9y_A* 3ua9_A* 4avu_A* 4avw_A* 3mhk_A* 2rf5_A 3udd_A* 3uh2_A* 3uh4_A* 4dvi_A* Length = 240 Back     alignment and structure
 Score = 54.7 bits (131), Expect = 4e-11
 Identities = 34/58 (58%), Positives = 39/58 (67%)

Query: 1   MFVLGTANHSKSFLQFNAIKMAHAPPGHHSVMGRPSSGGLYFPEYVVYRGEQMCISYL 58
             +       KSFLQF+A+KMAH+PPGHHSV GRPS  GL   EYV+YRGEQ    YL
Sbjct: 173 QLLFCRVTLGKSFLQFSAMKMAHSPPGHHSVTGRPSVNGLALAEYVIYRGEQAYPEYL 230


>4f0d_A PARP-16, poly [ADP-ribose] polymerase 16; transferase, ARTD15, structural genomics structural genomics consortium, SGC; HET: 3AB; 2.70A {Homo sapiens} Length = 277 Back     alignment and structure
>4dqy_C Poly [ADP-ribose] polymerase 1; PARP, poly(ADP-ribose) polymerase, DNA binding protein, ADP- transferase, PARP-like zinc finger, poly(ADP-ribosyl)ation; HET: DNA; 3.25A {Homo sapiens} PDB: 2cr9_A Length = 506 Back     alignment and structure
>3blj_A Poly(ADP-ribose) polymerase 15; PARP, BAL-3, SGC, structural GE consortium, glycosyltransferase, NAD, nucleus; 2.20A {Homo sapiens} PDB: 3gey_A* Length = 221 Back     alignment and structure
>1efy_A Poly (ADP-ribose) polymerase; benzimidazole, inhibitor, catalytic fragment, transferase; HET: BZC; 2.20A {Gallus gallus} SCOP: a.41.1.1 d.166.1.2 PDB: 1a26_A* 1pax_A* 2paw_A 2pax_A* 3pax_A* 4pax_A* 2rcw_A* 1uk1_A* 1wok_A* 1uk0_A* 2rd6_A* 3gjw_A* 3gn7_A* 3l3l_A* 3l3m_A* Length = 350 Back     alignment and structure
>3smj_A Poly [ADP-ribose] polymerase 14; diphtheria toxin like fold, transferase, NAD+, ADP-ribosylat transferase-transferase inhibitor complex; HET: FDR; 1.50A {Homo sapiens} PDB: 3goy_A* 3smi_A* 3se2_A* Length = 193 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query73
3u9h_A240 Tankyrase-2; protein-ligand complex, diphtheria to 99.92
2x5y_A173 Zinc finger CCCH-type antiviral protein 1; antivir 99.75
1efy_A350 Poly (ADP-ribose) polymerase; benzimidazole, inhib 99.75
3hkv_A217 PARP-10, poly [ADP-ribose] polymerase 10; NAD, tra 99.72
3smj_A193 Poly [ADP-ribose] polymerase 14; diphtheria toxin 99.71
2pqf_A198 Poly [ADP-ribose] polymerase 12; enzyme-inhibitor 99.7
4dqy_C506 Poly [ADP-ribose] polymerase 1; PARP, poly(ADP-rib 99.69
3kjd_A368 Poly [ADP-ribose] polymerase 2; transferase, enzym 99.69
3blj_A221 Poly(ADP-ribose) polymerase 15; PARP, BAL-3, SGC, 99.68
3c4h_A357 Poly(ADP-ribose) polymerase 3; enzyme-inhibitor co 99.67
>3u9h_A Tankyrase-2; protein-ligand complex, diphtheria toxin like fold, transfer ribosylation; HET: SO4; 1.75A {Homo sapiens} PDB: 3kr8_A* 3kr7_A* 3p0n_A* 3p0p_A* 3p0q_A* 3mhj_A* 3u9y_A* 3ua9_A* 4avu_A* 4avw_A* 3mhk_A* 2rf5_A 3udd_A* 3uh2_A* 3uh4_A* 4dvi_A* 4hlh_A* 4hki_A* 4hkn_A* 4hl5_A* ... Back     alignment and structure
Probab=99.92  E-value=1.8e-25  Score=161.52  Aligned_cols=66  Identities=53%  Similarity=0.891  Sum_probs=61.7

Q ss_pred             eEEeeeecCCeeeEeecccccCCCCCCceeeeccCCCCCCcceEEEeeCcccceeEEEEeeecCCc
Q psy8899           2 FVLGTANHSKSFLQFNAIKMAHAPPGHHSVMGRPSSGGLYFPEYVVYRGEQMCISYLAKNLYLRLD   67 (73)
Q Consensus         2 ~llcrV~vGr~~~~~~~~~~~~pPpGyhSViG~p~~ggLnY~E~VVY~~eqi~P~yLI~Y~~~~~~   67 (73)
                      ||||||++|+.++.++++.++.||+|||||+|.|+.++|+|+|+|||+++||+|+|||+|++.+|+
T Consensus       174 mlLc~V~lG~~~~~~~~~~~~~pP~gyDSvvg~~~~~~l~~~E~VVy~~~qi~P~YlI~y~~~~~~  239 (240)
T 3u9h_A          174 LLFCRVTLGKSFLQFSAMKMAHSPPGHHSVTGRPSVNGLALAEYVIYRGEQAYPEYLITYQIMRPE  239 (240)
T ss_dssp             EEEEEEECCSEEEEEECC--CCCCTTCSEEEEEESSCTTCCCEEEESCGGGEEEEEEEEEEECCCC
T ss_pred             EEEEEEecCceEeecCcccccCCCCCCCceecCCCCCCCCCCEEEEEcccceeEEEEEEEEccCCC
Confidence            899999999999988888888999999999999998889999999999999999999999999997



>2x5y_A Zinc finger CCCH-type antiviral protein 1; antiviral defense, immune system, transferase; 1.05A {Homo sapiens} Back     alignment and structure
>1efy_A Poly (ADP-ribose) polymerase; benzimidazole, inhibitor, catalytic fragment, transferase; HET: BZC; 2.20A {Gallus gallus} SCOP: a.41.1.1 d.166.1.2 PDB: 1a26_A* 1pax_A* 2paw_A 2pax_A* 3pax_A* 4pax_A* 2rcw_A* 1uk1_A* 1wok_A* 1uk0_A* 2rd6_A* 3gjw_A* 3gn7_A* 3l3l_A* 3l3m_A* Back     alignment and structure
>3hkv_A PARP-10, poly [ADP-ribose] polymerase 10; NAD, transferase, structural genomics, structural genomics consortium, SGC, cytoplasm, glycosyltransferase; HET: 3AB; 2.10A {Homo sapiens} Back     alignment and structure
>3smj_A Poly [ADP-ribose] polymerase 14; diphtheria toxin like fold, transferase, NAD+, ADP-ribosylat transferase-transferase inhibitor complex; HET: FDR; 1.50A {Homo sapiens} PDB: 3goy_A* 3smi_A* 3se2_A* 4f1l_A* 4f1q_A* Back     alignment and structure
>2pqf_A Poly [ADP-ribose] polymerase 12; enzyme-inhibitor complex, catalytic fragment, structural GEN structural genomics consortium, SGC, transferase; HET: GAB CIT; 2.20A {Homo sapiens} Back     alignment and structure
>4dqy_C Poly [ADP-ribose] polymerase 1; PARP, poly(ADP-ribose) polymerase, DNA binding protein, ADP- transferase, PARP-like zinc finger, poly(ADP-ribosyl)ation; HET: DNA; 3.25A {Homo sapiens} PDB: 2cr9_A Back     alignment and structure
>3kjd_A Poly [ADP-ribose] polymerase 2; transferase, enzyme-inhibitor complex, catalytic fragment, S genomics, structural genomics consortium, SGC; HET: 78P; 1.95A {Homo sapiens} PDB: 3kcz_A* 1gs0_A Back     alignment and structure
>3blj_A Poly(ADP-ribose) polymerase 15; PARP, BAL-3, SGC, structural GE consortium, glycosyltransferase, NAD, nucleus; 2.20A {Homo sapiens} PDB: 3gey_A* Back     alignment and structure
>3c4h_A Poly(ADP-ribose) polymerase 3; enzyme-inhibitor complex, catalytic fragment, structural GEN structural genomics consortium, SGC; HET: DRL; 2.10A {Homo sapiens} PDB: 3c49_A* 2pa9_A* 3ce0_A* 3fhb_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 73
d1gs0a2217 d.166.1.2 (A:341-557) Poly(ADP-ribose) polymerase, 0.003
>d1gs0a2 d.166.1.2 (A:341-557) Poly(ADP-ribose) polymerase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 217 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: ADP-ribosylation
superfamily: ADP-ribosylation
family: Poly(ADP-ribose) polymerase, C-terminal domain
domain: Poly(ADP-ribose) polymerase, C-terminal domain
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 32.0 bits (72), Expect = 0.003
 Identities = 9/34 (26%), Positives = 16/34 (47%)

Query: 25  PPGHHSVMGRPSSGGLYFPEYVVYRGEQMCISYL 58
            P   + +  P    L + E++VY   Q+ + YL
Sbjct: 175 GPASDTGILNPEGYTLNYNEFIVYSPNQVRMRYL 208


Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query73
d1efya2215 Poly(ADP-ribose) polymerase, C-terminal domain {Ch 99.76
d1gs0a2217 Poly(ADP-ribose) polymerase, C-terminal domain {Mo 99.67
>d1efya2 d.166.1.2 (A:797-1011) Poly(ADP-ribose) polymerase, C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: ADP-ribosylation
superfamily: ADP-ribosylation
family: Poly(ADP-ribose) polymerase, C-terminal domain
domain: Poly(ADP-ribose) polymerase, C-terminal domain
species: Chicken (Gallus gallus) [TaxId: 9031]
Probab=99.76  E-value=5.7e-19  Score=122.42  Aligned_cols=63  Identities=30%  Similarity=0.497  Sum_probs=55.1

Q ss_pred             CeEEeeeecCCeeeEeecccccCCCCCCceeeecc---------------------------CCCCCCcceEEEeeCccc
Q psy8899           1 MFVLGTANHSKSFLQFNAIKMAHAPPGHHSVMGRP---------------------------SSGGLYFPEYVVYRGEQM   53 (73)
Q Consensus         1 ~~llcrV~vGr~~~~~~~~~~~~pPpGyhSViG~p---------------------------~~ggLnY~E~VVY~~eqi   53 (73)
                      .||||||++|+.+..+.+..++.||+|+||+.|.-                           ..+++.|+|||||+++|+
T Consensus       122 ~mll~~V~lG~~~~~~~~~~~~~~p~g~~s~~~~g~~~pd~~~~~~~d~v~vP~g~~~~~~~~~~~~~~~EyVVy~~~Q~  201 (215)
T d1efya2         122 LILLGEVALGNMYELKNASHITKLPKGKHSVKGLGKTAPDPTATTTLDGVEVPLGNGISTGINDTCLLYNEYIVYDVAQV  201 (215)
T ss_dssp             EEEEEEEECCSEEEESSCCCCCSCCTTCCEEEECCSEEECGGGCEEETTEEECCSCEEECSCCSSSCSBCEEEESCGGGE
T ss_pred             EEEEEEEEecceEEecCccccccCCCCccccccccccCCChhhccccCCeeccCCCccccCCcCCccccCEEEEEechhE
Confidence            38999999999987778888999999999997631                           235689999999999999


Q ss_pred             ceeEEEEeee
Q psy8899          54 CISYLAKNLY   63 (73)
Q Consensus        54 ~P~yLI~Y~~   63 (73)
                      +|+|||.|+.
T Consensus       202 ~p~YLI~~k~  211 (215)
T d1efya2         202 NLKYLLKLKF  211 (215)
T ss_dssp             EEEEEEEEEE
T ss_pred             eEEEEEEEEE
Confidence            9999999985



>d1gs0a2 d.166.1.2 (A:341-557) Poly(ADP-ribose) polymerase, C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure