Psyllid ID: psy88
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 75 | ||||||
| 325302574 | 725 | laccase 2 [Riptortus pedestris] | 0.92 | 0.095 | 0.797 | 1e-28 | |
| 325302576 | 729 | laccase 2 [Megacopta punctatissima] | 0.92 | 0.094 | 0.828 | 1e-27 | |
| 61658224 | 753 | laccase-2 isoform A [Anopheles gambiae] | 0.92 | 0.091 | 0.826 | 2e-27 | |
| 63079853 | 747 | laccase-like multicopper oxidase 1 [Aede | 0.92 | 0.092 | 0.826 | 2e-27 | |
| 61658226 | 755 | laccase-2 isoform B [Anopheles gambiae] | 0.92 | 0.091 | 0.826 | 2e-27 | |
| 312373563 | 795 | hypothetical protein AND_17284 [Anophele | 0.92 | 0.086 | 0.826 | 2e-27 | |
| 158295492 | 754 | AGAP006176-PB [Anopheles gambiae str. PE | 0.92 | 0.091 | 0.826 | 2e-27 | |
| 157116019 | 752 | multicopper oxidase [Aedes aegypti] gi|1 | 0.92 | 0.091 | 0.826 | 2e-27 | |
| 158295490 | 756 | AGAP006176-PA [Anopheles gambiae str. PE | 0.92 | 0.091 | 0.826 | 2e-27 | |
| 195028474 | 1023 | GH21733 [Drosophila grimshawi] gi|193903 | 0.92 | 0.067 | 0.797 | 4e-27 |
| >gi|325302574|dbj|BAJ83487.1| laccase 2 [Riptortus pedestris] | Back alignment and taxonomy information |
|---|
Score = 130 bits (326), Expect = 1e-28, Method: Compositional matrix adjust.
Identities = 55/69 (79%), Positives = 64/69 (92%)
Query: 7 VCEGDRVVVDVRNSMDGLENTIHWHGIHQRGTQYSDGVPFVTQCPITQGNTFRYQFTANA 66
VCEGD+V++D+RN+M GLE +IHWHGIHQRGTQ SDGVPFVTQCPI +GNTFRYQ+ AN+
Sbjct: 190 VCEGDKVIIDLRNAMQGLELSIHWHGIHQRGTQISDGVPFVTQCPIPEGNTFRYQWVANS 249
Query: 67 GTHFWHAHT 75
GTHFWHAHT
Sbjct: 250 GTHFWHAHT 258
|
Source: Riptortus pedestris Species: Riptortus pedestris Genus: Riptortus Family: Alydidae Order: Hemiptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|325302576|dbj|BAJ83488.1| laccase 2 [Megacopta punctatissima] | Back alignment and taxonomy information |
|---|
| >gi|61658224|gb|AAX49501.1| laccase-2 isoform A [Anopheles gambiae] | Back alignment and taxonomy information |
|---|
| >gi|63079853|gb|AAY29698.1| laccase-like multicopper oxidase 1 [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|61658226|gb|AAX49502.1| laccase-2 isoform B [Anopheles gambiae] | Back alignment and taxonomy information |
|---|
| >gi|312373563|gb|EFR21278.1| hypothetical protein AND_17284 [Anopheles darlingi] | Back alignment and taxonomy information |
|---|
| >gi|158295492|ref|XP_001688810.1| AGAP006176-PB [Anopheles gambiae str. PEST] gi|157016064|gb|EDO63816.1| AGAP006176-PB [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|157116019|ref|XP_001658342.1| multicopper oxidase [Aedes aegypti] gi|108876642|gb|EAT40867.1| AAEL007415-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|158295490|ref|XP_316236.4| AGAP006176-PA [Anopheles gambiae str. PEST] gi|157016063|gb|EAA11473.4| AGAP006176-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|195028474|ref|XP_001987101.1| GH21733 [Drosophila grimshawi] gi|193903101|gb|EDW01968.1| GH21733 [Drosophila grimshawi] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 75 | ||||||
| FB|FBgn0259247 | 784 | laccase2 "laccase 2" [Drosophi | 0.92 | 0.088 | 0.797 | 3.5e-28 | |
| FB|FBgn0032116 | 959 | Mco1 "Multicopper oxidase-1" [ | 0.92 | 0.071 | 0.628 | 3.8e-21 | |
| FB|FBgn0052557 | 645 | CG32557 [Drosophila melanogast | 0.906 | 0.105 | 0.585 | 2.1e-16 | |
| SGD|S000004662 | 636 | FET3 "Ferro-O2-oxidoreductase" | 0.92 | 0.108 | 0.478 | 6.1e-14 | |
| TAIR|locus:2178973 | 573 | AT5G21100 [Arabidopsis thalian | 0.866 | 0.113 | 0.515 | 6.6e-14 | |
| ASPGD|ASPL0000035520 | 570 | lccB [Emericella nidulans (tax | 0.866 | 0.114 | 0.515 | 1.8e-13 | |
| UNIPROTKB|G4ND85 | 597 | MGG_11608 "Laccase-2" [Magnapo | 0.866 | 0.108 | 0.5 | 1.8e-12 | |
| TAIR|locus:2135242 | 582 | AT4G39830 [Arabidopsis thalian | 0.88 | 0.113 | 0.477 | 2.8e-12 | |
| TAIR|locus:505006625 | 588 | AT5G21105 [Arabidopsis thalian | 0.84 | 0.107 | 0.5 | 3.6e-12 | |
| UNIPROTKB|G5EGX4 | 595 | MGCH7_ch7g635 "Laccase-1" [Mag | 0.96 | 0.121 | 0.461 | 3.7e-12 |
| FB|FBgn0259247 laccase2 "laccase 2" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 324 (119.1 bits), Expect = 3.5e-28, P = 3.5e-28
Identities = 55/69 (79%), Positives = 61/69 (88%)
Query: 7 VCEGDRVVVDVRNSMDGLENTIHWHGIHQRGTQYSDGVPFVTQCPITQGNTFRYQFTANA 66
VCE D+VV+DV N M+G+E TIHWHGI QRG+QY DGVPFVTQCPI QGNTFRYQ+T NA
Sbjct: 250 VCENDKVVIDVENHMEGMEVTIHWHGIWQRGSQYYDGVPFVTQCPIQQGNTFRYQWTGNA 309
Query: 67 GTHFWHAHT 75
GTHFWHAHT
Sbjct: 310 GTHFWHAHT 318
|
|
| FB|FBgn0032116 Mco1 "Multicopper oxidase-1" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0052557 CG32557 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| SGD|S000004662 FET3 "Ferro-O2-oxidoreductase" [Saccharomyces cerevisiae (taxid:4932)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2178973 AT5G21100 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| ASPGD|ASPL0000035520 lccB [Emericella nidulans (taxid:162425)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G4ND85 MGG_11608 "Laccase-2" [Magnaporthe oryzae 70-15 (taxid:242507)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2135242 AT4G39830 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:505006625 AT5G21105 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G5EGX4 MGCH7_ch7g635 "Laccase-1" [Magnaporthe oryzae 70-15 (taxid:242507)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 75 | |||
| pfam07732 | 119 | pfam07732, Cu-oxidase_3, Multicopper oxidase | 1e-27 | |
| TIGR03388 | 541 | TIGR03388, ascorbase, L-ascorbate oxidase, plant t | 3e-21 | |
| PLN02604 | 566 | PLN02604, PLN02604, oxidoreductase | 1e-18 | |
| PLN02191 | 574 | PLN02191, PLN02191, L-ascorbate oxidase | 3e-18 | |
| TIGR03389 | 539 | TIGR03389, laccase, laccase, plant | 2e-17 | |
| TIGR03390 | 538 | TIGR03390, ascorbOXfungal, L-ascorbate oxidase, fu | 3e-12 | |
| COG2132 | 451 | COG2132, SufI, Putative multicopper oxidases [Seco | 1e-10 | |
| TIGR01480 | 587 | TIGR01480, copper_res_A, copper-resistance protein | 6e-09 | |
| PRK10965 | 523 | PRK10965, PRK10965, multicopper oxidase; Provision | 2e-06 | |
| PLN02354 | 552 | PLN02354, PLN02354, copper ion binding / oxidoredu | 3e-06 | |
| PLN00044 | 596 | PLN00044, PLN00044, multi-copper oxidase-related p | 5e-06 | |
| PLN02792 | 536 | PLN02792, PLN02792, oxidoreductase | 6e-06 | |
| PLN02835 | 539 | PLN02835, PLN02835, oxidoreductase | 0.001 |
| >gnl|CDD|219542 pfam07732, Cu-oxidase_3, Multicopper oxidase | Back alignment and domain information |
|---|
Score = 95.8 bits (239), Expect = 1e-27
Identities = 40/72 (55%), Positives = 52/72 (72%), Gaps = 3/72 (4%)
Query: 6 NVCEGDRVVVDVRNSMDGLENTIHWHGIHQRGTQYSDGVPFVTQCPITQGNTFRYQFTAN 65
V EGD VVV+V N++D TIHWHG+ Q GT ++DGVP VTQCPI G +F Y+FT
Sbjct: 29 RVREGDTVVVNVTNNLD-EPTTIHWHGLRQPGTPWADGVPGVTQCPIPPGESFTYRFTVK 87
Query: 66 --AGTHFWHAHT 75
AGT+++H+HT
Sbjct: 88 QQAGTYWYHSHT 99
|
This entry contains many divergent copper oxidase-like domains that are not recognised by the pfam00394 model. Length = 119 |
| >gnl|CDD|234193 TIGR03388, ascorbase, L-ascorbate oxidase, plant type | Back alignment and domain information |
|---|
| >gnl|CDD|215324 PLN02604, PLN02604, oxidoreductase | Back alignment and domain information |
|---|
| >gnl|CDD|177843 PLN02191, PLN02191, L-ascorbate oxidase | Back alignment and domain information |
|---|
| >gnl|CDD|234194 TIGR03389, laccase, laccase, plant | Back alignment and domain information |
|---|
| >gnl|CDD|132431 TIGR03390, ascorbOXfungal, L-ascorbate oxidase, fungal type | Back alignment and domain information |
|---|
| >gnl|CDD|225043 COG2132, SufI, Putative multicopper oxidases [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|233432 TIGR01480, copper_res_A, copper-resistance protein, CopA family | Back alignment and domain information |
|---|
| >gnl|CDD|236810 PRK10965, PRK10965, multicopper oxidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|177987 PLN02354, PLN02354, copper ion binding / oxidoreductase | Back alignment and domain information |
|---|
| >gnl|CDD|165622 PLN00044, PLN00044, multi-copper oxidase-related protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178389 PLN02792, PLN02792, oxidoreductase | Back alignment and domain information |
|---|
| >gnl|CDD|178429 PLN02835, PLN02835, oxidoreductase | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 75 | |||
| PF07732 | 117 | Cu-oxidase_3: Multicopper oxidase; InterPro: IPR01 | 99.97 | |
| PLN02835 | 539 | oxidoreductase | 99.96 | |
| PLN02168 | 545 | copper ion binding / pectinesterase | 99.96 | |
| PLN02792 | 536 | oxidoreductase | 99.96 | |
| PLN02354 | 552 | copper ion binding / oxidoreductase | 99.96 | |
| TIGR03389 | 539 | laccase laccase, plant. Members of this protein fa | 99.96 | |
| PLN00044 | 596 | multi-copper oxidase-related protein; Provisional | 99.96 | |
| PLN02991 | 543 | oxidoreductase | 99.96 | |
| TIGR03390 | 538 | ascorbOXfungal L-ascorbate oxidase, fungal type. T | 99.96 | |
| PLN02191 | 574 | L-ascorbate oxidase | 99.96 | |
| TIGR03388 | 541 | ascorbase L-ascorbate oxidase, plant type. Members | 99.95 | |
| PLN02604 | 566 | oxidoreductase | 99.94 | |
| TIGR01480 | 587 | copper_res_A copper-resistance protein, CopA famil | 99.94 | |
| KOG1263|consensus | 563 | 99.94 | ||
| PRK10965 | 523 | multicopper oxidase; Provisional | 99.92 | |
| PRK10883 | 471 | FtsI repressor; Provisional | 99.89 | |
| TIGR02376 | 311 | Cu_nitrite_red nitrite reductase, copper-containin | 99.83 | |
| TIGR01480 | 587 | copper_res_A copper-resistance protein, CopA famil | 99.79 | |
| COG2132 | 451 | SufI Putative multicopper oxidases [Secondary meta | 99.79 | |
| TIGR03095 | 148 | rusti_cyanin rusticyanin. Rusticyanin is a blue co | 99.72 | |
| PF07731 | 138 | Cu-oxidase_2: Multicopper oxidase; InterPro: IPR01 | 99.52 | |
| TIGR03096 | 135 | nitroso_cyanin nitrosocyanin. Nitrosocyanin, as de | 99.34 | |
| PLN02835 | 539 | oxidoreductase | 99.1 | |
| COG2132 | 451 | SufI Putative multicopper oxidases [Secondary meta | 98.99 | |
| TIGR03388 | 541 | ascorbase L-ascorbate oxidase, plant type. Members | 98.98 | |
| TIGR03389 | 539 | laccase laccase, plant. Members of this protein fa | 98.96 | |
| PLN02604 | 566 | oxidoreductase | 98.93 | |
| PLN02168 | 545 | copper ion binding / pectinesterase | 98.9 | |
| PLN02354 | 552 | copper ion binding / oxidoreductase | 98.89 | |
| PF13473 | 104 | Cupredoxin_1: Cupredoxin-like domain; PDB: 1IBZ_D | 98.88 | |
| PRK10965 | 523 | multicopper oxidase; Provisional | 98.83 | |
| PLN02991 | 543 | oxidoreductase | 98.82 | |
| PLN02792 | 536 | oxidoreductase | 98.8 | |
| PLN02191 | 574 | L-ascorbate oxidase | 98.79 | |
| TIGR03390 | 538 | ascorbOXfungal L-ascorbate oxidase, fungal type. T | 98.78 | |
| TIGR02656 | 99 | cyanin_plasto plastocyanin. Members of this family | 98.73 | |
| PLN00044 | 596 | multi-copper oxidase-related protein; Provisional | 98.67 | |
| PRK02888 | 635 | nitrous-oxide reductase; Validated | 98.64 | |
| TIGR02657 | 83 | amicyanin amicyanin. Members of this family are am | 98.59 | |
| TIGR02376 | 311 | Cu_nitrite_red nitrite reductase, copper-containin | 98.54 | |
| PRK02710 | 119 | plastocyanin; Provisional | 98.43 | |
| PF00394 | 159 | Cu-oxidase: Multicopper oxidase; InterPro: IPR0011 | 98.39 | |
| PRK10883 | 471 | FtsI repressor; Provisional | 98.35 | |
| PF00127 | 99 | Copper-bind: Copper binding proteins, plastocyanin | 98.3 | |
| KOG1263|consensus | 563 | 98.14 | ||
| TIGR03102 | 115 | halo_cynanin halocyanin domain. Halocyanins are bl | 97.98 | |
| TIGR02375 | 116 | pseudoazurin pseudoazurin. Pseudoazurin, also call | 97.79 | |
| COG3794 | 128 | PetE Plastocyanin [Energy production and conversio | 97.63 | |
| PF00116 | 120 | COX2: Cytochrome C oxidase subunit II, periplasmic | 97.38 | |
| TIGR03094 | 195 | sulfo_cyanin sulfocyanin. Members of this family a | 97.16 | |
| PF06525 | 196 | SoxE: Sulfocyanin (SoxE); InterPro: IPR010532 Memb | 97.15 | |
| COG4263 | 637 | NosZ Nitrous oxide reductase [Energy production an | 96.7 | |
| TIGR02695 | 125 | azurin azurin. Azurin is a blue copper-binding pro | 96.69 | |
| TIGR02866 | 201 | CoxB cytochrome c oxidase, subunit II. Cytochrome | 95.42 | |
| PRK13202 | 104 | ureB urease subunit beta; Reviewed | 95.1 | |
| PRK13203 | 102 | ureB urease subunit beta; Reviewed | 94.33 | |
| TIGR00192 | 101 | urease_beta urease, beta subunit. In a number of s | 94.3 | |
| PF12690 | 82 | BsuPI: Intracellular proteinase inhibitor; InterPr | 93.89 | |
| cd00407 | 101 | Urease_beta Urease beta-subunit; Urease is a nicke | 93.88 | |
| PRK10378 | 375 | inactive ferrous ion transporter periplasmic prote | 93.35 | |
| PRK13201 | 136 | ureB urease subunit beta; Reviewed | 93.02 | |
| PRK13198 | 158 | ureB urease subunit beta; Reviewed | 93.0 | |
| PRK13205 | 162 | ureB urease subunit beta; Reviewed | 92.93 | |
| PRK13204 | 159 | ureB urease subunit beta; Reviewed | 92.88 | |
| COG4263 | 637 | NosZ Nitrous oxide reductase [Energy production an | 92.77 | |
| COG1622 | 247 | CyoA Heme/copper-type cytochrome/quinol oxidases, | 89.76 | |
| PRK13192 | 208 | bifunctional urease subunit gamma/beta; Reviewed | 89.37 | |
| PF05938 | 110 | Self-incomp_S1: Plant self-incompatibility protein | 88.71 | |
| PF00699 | 100 | Urease_beta: Urease beta subunit CAUTION: The Pros | 88.6 | |
| PF10989 | 146 | DUF2808: Protein of unknown function (DUF2808); In | 87.56 | |
| PRK13986 | 225 | urease subunit alpha; Provisional | 86.4 | |
| COG4454 | 158 | Uncharacterized copper-binding protein [Inorganic | 85.61 | |
| COG0832 | 106 | UreB Urea amidohydrolase (urease) beta subunit [Am | 85.13 | |
| TIGR03079 | 399 | CH4_NH3mon_ox_B methane monooxygenase/ammonia mono | 83.65 | |
| PF04744 | 381 | Monooxygenase_B: Monooxygenase subunit B protein; | 82.51 | |
| PF05506 | 89 | DUF756: Domain of unknown function (DUF756); Inter | 82.44 | |
| cd00918 | 120 | Der-p2_like Several group 2 allergen proteins belo | 80.89 | |
| PF10633 | 78 | NPCBM_assoc: NPCBM-associated, NEW3 domain of alph | 80.25 |
| >PF07732 Cu-oxidase_3: Multicopper oxidase; InterPro: IPR011707 Copper is one of the most prevalent transition metals in living organisms and its biological function is intimately related to its redox properties | Back alignment and domain information |
|---|
Probab=99.97 E-value=5.6e-32 Score=159.01 Aligned_cols=73 Identities=48% Similarity=0.865 Sum_probs=69.0
Q ss_pred cccEEEecCCEEEEEEEeCCCCCCceEEeCCccccCCCCCCCCCcccccccCCCCEEEEEEc-CC-CeeeEEccCC
Q psy88 2 LYPKNVCEGDRVVVDVRNSMDGLENTIHWHGIHQRGTQYSDGVPFVTQCPITQGNTFRYQFT-AN-AGTHFWHAHT 75 (75)
Q Consensus 2 ~~~i~~~~Gd~v~i~~~N~~~~~~~~iH~HG~~~~~~~~~DG~~~~~~~~i~pG~~~~y~~~-~~-~Gt~~YH~H~ 75 (75)
.++||+++||+|+|+|+|.++ .+++|||||+.++..+++||++..++++|.||++++|+|+ .+ +||||||||+
T Consensus 25 GPtI~v~~Gd~v~i~~~N~l~-~~~siH~HG~~~~~~~~~DG~~~~~~~~i~pG~~~~Y~~~~~~~~Gt~wYH~H~ 99 (117)
T PF07732_consen 25 GPTIRVREGDTVRITVTNNLD-EPTSIHWHGLHQPPSPWMDGVPGVTQCPIAPGESFTYEFTANQQAGTYWYHSHV 99 (117)
T ss_dssp EEEEEEETTEEEEEEEEEESS-SGBSEEEETSBSTTGGGGSGGTTTSGSSBSTTEEEEEEEEESSCSEEEEEEECS
T ss_pred CCEEEEEcCCeeEEEEEeccc-cccccccceeeeeeeeecCCcccccceeEEeecceeeeEeeeccccceeEeeCC
Confidence 579999999999999999998 8999999999998887899999999999999999999999 55 9999999995
|
Since free copper is toxic, even at very low concentrations, its homeostasis in living organisms is tightly controlled by subtle molecular mechanisms. In eukaryotes, before being transported inside the cell via the high-affinity copper transporters of the CTR family, the copper (II) ion is reduced to copper (I). In blue copper proteins such as cupredoxin, the copper (I) ion form is stabilised by a constrained His2Cys coordination environment. Multicopper oxidases oxidise their substrate by accepting electrons at a mononuclear copper centre and transferring them to a trinuclear copper centre; dioxygen binds to the trinuclear centre and, following the transfer of four electrons, is reduced to two molecules of water []. There are three spectroscopically different copper centres found in multicopper oxidases: type 1 (or blue), type 2 (or normal) and type 3 (or coupled binuclear) [, ]. Multicopper oxidases consist of 2, 3 or 6 of these homologous domains, which also share homology to the cupredoxins azurin and plastocyanin. Structurally, these domains consist of a cupredoxin-like fold, a beta-sandwich consisting of 7 strands in 2 beta-sheets, arranged in a Greek-key beta-barrel []. Multicopper oxidases include: Ceruloplasmin (1.16.3.1 from EC) (ferroxidase), a 6-domain enzyme found in the serum of mammals and birds that oxidizes different inorganic and organic substances; exhibits internal sequence homology that appears to have evolved from the triplication of a Cu-binding domain similar to that of laccase and ascorbate oxidase. Laccase (1.10.3.2 from EC) (urishiol oxidase), a 3-domain enzyme found in fungi and plants, which oxidizes different phenols and diamines. CueO is a laccase found in Escherichia coli that is involved in copper-resistance []. Ascorbate oxidase (1.10.3.3 from EC), a 3-domain enzyme found in higher plants. Nitrite reductase (1.7.2.1 from EC), a 2-domain enzyme containing type-1 and type-2 copper centres [, ]. In addition to the above enzymes there are a number of other proteins that are similar to the multi-copper oxidases in terms of structure and sequence, some of which have lost the ability to bind copper. These include: copper resistance protein A (copA) from a plasmid in Pseudomonas syringae; domain A of (non-copper binding) blood coagulation factors V (Fa V) and VIII (Fa VIII) []; yeast FET3 required for ferrous iron uptake []; yeast hypothetical protein YFL041w; and the fission yeast homologue SpAC1F7.08. This entry represents multicopper oxidase type 3 (or coupled binuclear) domains. ; GO: 0005507 copper ion binding; PDB: 2QT6_B 3KW7_B 2R7E_A 3CDZ_A 1SDD_A 3G5W_D 3UAC_A 2YXV_A 3OD3_A 3NSY_A .... |
| >PLN02835 oxidoreductase | Back alignment and domain information |
|---|
| >PLN02168 copper ion binding / pectinesterase | Back alignment and domain information |
|---|
| >PLN02792 oxidoreductase | Back alignment and domain information |
|---|
| >PLN02354 copper ion binding / oxidoreductase | Back alignment and domain information |
|---|
| >TIGR03389 laccase laccase, plant | Back alignment and domain information |
|---|
| >PLN00044 multi-copper oxidase-related protein; Provisional | Back alignment and domain information |
|---|
| >PLN02991 oxidoreductase | Back alignment and domain information |
|---|
| >TIGR03390 ascorbOXfungal L-ascorbate oxidase, fungal type | Back alignment and domain information |
|---|
| >PLN02191 L-ascorbate oxidase | Back alignment and domain information |
|---|
| >TIGR03388 ascorbase L-ascorbate oxidase, plant type | Back alignment and domain information |
|---|
| >PLN02604 oxidoreductase | Back alignment and domain information |
|---|
| >TIGR01480 copper_res_A copper-resistance protein, CopA family | Back alignment and domain information |
|---|
| >KOG1263|consensus | Back alignment and domain information |
|---|
| >PRK10965 multicopper oxidase; Provisional | Back alignment and domain information |
|---|
| >PRK10883 FtsI repressor; Provisional | Back alignment and domain information |
|---|
| >TIGR02376 Cu_nitrite_red nitrite reductase, copper-containing | Back alignment and domain information |
|---|
| >TIGR01480 copper_res_A copper-resistance protein, CopA family | Back alignment and domain information |
|---|
| >COG2132 SufI Putative multicopper oxidases [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >TIGR03095 rusti_cyanin rusticyanin | Back alignment and domain information |
|---|
| >PF07731 Cu-oxidase_2: Multicopper oxidase; InterPro: IPR011706 Copper is one of the most prevalent transition metals in living organisms and its biological function is intimately related to its redox properties | Back alignment and domain information |
|---|
| >TIGR03096 nitroso_cyanin nitrosocyanin | Back alignment and domain information |
|---|
| >PLN02835 oxidoreductase | Back alignment and domain information |
|---|
| >COG2132 SufI Putative multicopper oxidases [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >TIGR03388 ascorbase L-ascorbate oxidase, plant type | Back alignment and domain information |
|---|
| >TIGR03389 laccase laccase, plant | Back alignment and domain information |
|---|
| >PLN02604 oxidoreductase | Back alignment and domain information |
|---|
| >PLN02168 copper ion binding / pectinesterase | Back alignment and domain information |
|---|
| >PLN02354 copper ion binding / oxidoreductase | Back alignment and domain information |
|---|
| >PF13473 Cupredoxin_1: Cupredoxin-like domain; PDB: 1IBZ_D 1IC0_E 1IBY_D | Back alignment and domain information |
|---|
| >PRK10965 multicopper oxidase; Provisional | Back alignment and domain information |
|---|
| >PLN02991 oxidoreductase | Back alignment and domain information |
|---|
| >PLN02792 oxidoreductase | Back alignment and domain information |
|---|
| >PLN02191 L-ascorbate oxidase | Back alignment and domain information |
|---|
| >TIGR03390 ascorbOXfungal L-ascorbate oxidase, fungal type | Back alignment and domain information |
|---|
| >TIGR02656 cyanin_plasto plastocyanin | Back alignment and domain information |
|---|
| >PLN00044 multi-copper oxidase-related protein; Provisional | Back alignment and domain information |
|---|
| >PRK02888 nitrous-oxide reductase; Validated | Back alignment and domain information |
|---|
| >TIGR02657 amicyanin amicyanin | Back alignment and domain information |
|---|
| >TIGR02376 Cu_nitrite_red nitrite reductase, copper-containing | Back alignment and domain information |
|---|
| >PRK02710 plastocyanin; Provisional | Back alignment and domain information |
|---|
| >PF00394 Cu-oxidase: Multicopper oxidase; InterPro: IPR001117 Copper is one of the most prevalent transition metals in living organisms and its biological function is intimately related to its redox properties | Back alignment and domain information |
|---|
| >PRK10883 FtsI repressor; Provisional | Back alignment and domain information |
|---|
| >PF00127 Copper-bind: Copper binding proteins, plastocyanin/azurin family; InterPro: IPR000923 Blue (type 1) copper proteins are small proteins which bind a single copper atom and which are characterised by an intense electronic absorption band near 600 nm [, ] | Back alignment and domain information |
|---|
| >KOG1263|consensus | Back alignment and domain information |
|---|
| >TIGR03102 halo_cynanin halocyanin domain | Back alignment and domain information |
|---|
| >TIGR02375 pseudoazurin pseudoazurin | Back alignment and domain information |
|---|
| >COG3794 PetE Plastocyanin [Energy production and conversion] | Back alignment and domain information |
|---|
| >PF00116 COX2: Cytochrome C oxidase subunit II, periplasmic domain This family corresponds to chains b and o | Back alignment and domain information |
|---|
| >TIGR03094 sulfo_cyanin sulfocyanin | Back alignment and domain information |
|---|
| >PF06525 SoxE: Sulfocyanin (SoxE); InterPro: IPR010532 Members of this family are blue-copper redox proteins designated sulfocyanin, from the archaeal genera Sulfolobus, Ferroplasma, and Picrophilus | Back alignment and domain information |
|---|
| >COG4263 NosZ Nitrous oxide reductase [Energy production and conversion] | Back alignment and domain information |
|---|
| >TIGR02695 azurin azurin | Back alignment and domain information |
|---|
| >TIGR02866 CoxB cytochrome c oxidase, subunit II | Back alignment and domain information |
|---|
| >PRK13202 ureB urease subunit beta; Reviewed | Back alignment and domain information |
|---|
| >PRK13203 ureB urease subunit beta; Reviewed | Back alignment and domain information |
|---|
| >TIGR00192 urease_beta urease, beta subunit | Back alignment and domain information |
|---|
| >PF12690 BsuPI: Intracellular proteinase inhibitor; InterPro: IPR020481 BsuPI is a intracellular proteinase inhibitor that directly regulates the major intracellular proteinase (ISP-1) activity in vivo | Back alignment and domain information |
|---|
| >cd00407 Urease_beta Urease beta-subunit; Urease is a nickel-dependent metalloenzyme that catalyzes the hydrolysis of urea to form ammonia and carbon dioxide | Back alignment and domain information |
|---|
| >PRK10378 inactive ferrous ion transporter periplasmic protein EfeO; Provisional | Back alignment and domain information |
|---|
| >PRK13201 ureB urease subunit beta; Reviewed | Back alignment and domain information |
|---|
| >PRK13198 ureB urease subunit beta; Reviewed | Back alignment and domain information |
|---|
| >PRK13205 ureB urease subunit beta; Reviewed | Back alignment and domain information |
|---|
| >PRK13204 ureB urease subunit beta; Reviewed | Back alignment and domain information |
|---|
| >COG4263 NosZ Nitrous oxide reductase [Energy production and conversion] | Back alignment and domain information |
|---|
| >COG1622 CyoA Heme/copper-type cytochrome/quinol oxidases, subunit 2 [Energy production and conversion] | Back alignment and domain information |
|---|
| >PRK13192 bifunctional urease subunit gamma/beta; Reviewed | Back alignment and domain information |
|---|
| >PF05938 Self-incomp_S1: Plant self-incompatibility protein S1; InterPro: IPR010264 This family consists of a series of plant proteins which are related to the Papaver rhoeas S1 self-incompatibility protein | Back alignment and domain information |
|---|
| >PF00699 Urease_beta: Urease beta subunit CAUTION: The Prosite patterns do not match this subunit of the enzyme; InterPro: IPR002019 Urease 3 | Back alignment and domain information |
|---|
| >PF10989 DUF2808: Protein of unknown function (DUF2808); InterPro: IPR021256 This family of proteins with unknown function appears to be restricted to Cyanobacteria | Back alignment and domain information |
|---|
| >PRK13986 urease subunit alpha; Provisional | Back alignment and domain information |
|---|
| >COG4454 Uncharacterized copper-binding protein [Inorganic ion transport and metabolism] | Back alignment and domain information |
|---|
| >COG0832 UreB Urea amidohydrolase (urease) beta subunit [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR03079 CH4_NH3mon_ox_B methane monooxygenase/ammonia monooxygenase, subunit B | Back alignment and domain information |
|---|
| >PF04744 Monooxygenase_B: Monooxygenase subunit B protein; InterPro: IPR006833 Ammonia monooxygenase and the particulate methane monooxygenase are both integral membrane proteins, occurring in ammonia oxidisers and methanotrophs respectively, which are thought to be evolutionarily related [] | Back alignment and domain information |
|---|
| >PF05506 DUF756: Domain of unknown function (DUF756); InterPro: IPR008475 This domain is found, normally as a tandem repeat, at the C terminus of bacterial phospholipase C proteins | Back alignment and domain information |
|---|
| >cd00918 Der-p2_like Several group 2 allergen proteins belong to the ML domain family | Back alignment and domain information |
|---|
| >PF10633 NPCBM_assoc: NPCBM-associated, NEW3 domain of alpha-galactosidase; InterPro: IPR018905 This domain has been named NEW3, but its function is not known | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 75 | ||||
| 1zpu_A | 534 | Crystal Structure Of Fet3p, A Multicopper Oxidase T | 5e-14 | ||
| 3g5w_A | 318 | Crystal Structure Of Blue Copper Oxidase From Nitro | 1e-12 | ||
| 1aoz_A | 552 | Refined Crystal Structure Of Ascorbate Oxidase At 1 | 2e-12 | ||
| 3sqr_A | 580 | Crystal Structure Of Laccase From Botrytis Aclada A | 3e-11 | ||
| 3kw7_A | 502 | Crystal Structure Of Lacb From Trametes Sp. Ah28-2 | 3e-11 | ||
| 3v9e_A | 580 | Structure Of The L513m Mutant Of The Laccase From B | 3e-11 | ||
| 3t6v_A | 495 | Crystal Structure Of Laccase From Steccherinum Ochr | 1e-10 | ||
| 1hfu_A | 503 | Type-2 Cu-Depleted Laccase From Coprinus Cinereus A | 2e-10 | ||
| 1a65_A | 504 | Type-2 Cu-depleted Laccase From Coprinus Cinereus L | 2e-10 | ||
| 2hzh_A | 499 | Crystal Structure Of Laccase From Coriolus Zonatus | 2e-10 | ||
| 2qt6_A | 498 | Crystal Structure Determination Of A Blue Laccase F | 4e-10 | ||
| 1kya_A | 499 | Active Laccase From Trametes Versicolor Complexed W | 6e-10 | ||
| 4a2f_A | 497 | Coriolopsis Gallica Laccase Collected At 12.65 Kev | 9e-10 | ||
| 4a2d_A | 496 | Coriolopsis Gallica Laccase T2 Copper Depleted At P | 9e-10 | ||
| 2hrg_A | 496 | Crystal Structure Of Blue Laccase From Trametes Tro | 9e-10 | ||
| 1gyc_A | 499 | Crystal Structure Determination At Room Temperature | 1e-09 | ||
| 2xyb_A | 497 | Crystal Structure Of A Fully Functional Laccase Fro | 1e-09 | ||
| 3div_A | 499 | Crystal Structure Of Laccase From Cerrena Maxima At | 2e-09 | ||
| 2h5u_A | 499 | Crystal Structure Of Laccase From Cerrena Maxima At | 2e-09 | ||
| 3fpx_A | 499 | Native Fungus Laccase From Trametes Hirsuta Length | 2e-09 | ||
| 3pxl_A | 499 | Type-2 Cu-Depleted Fungus Laccase From Trametes Hir | 2e-09 | ||
| 1v10_A | 521 | Structure Of Rigidoporus Lignosus Laccase From Hemi | 7e-08 | ||
| 3dkh_A | 559 | L559a Mutant Of Melanocarpus Albomyces Laccase Leng | 7e-07 | ||
| 1gw0_A | 559 | Crystal Structure Of Laccase From Melanocarpus Albo | 7e-07 | ||
| 3pps_A | 604 | Crystal Structure Of An Ascomycete Fungal Laccase F | 7e-07 | ||
| 2q9o_A | 559 | Near-Atomic Resolution Structure Of A Melanocarpus | 5e-06 | ||
| 3zx1_A | 481 | Multicopper Oxidase From Campylobacter Jejuni: A Me | 4e-04 | ||
| 3gdc_A | 288 | Crystal Structure Of Multicopper Oxidase Length = 2 | 4e-04 |
| >pdb|1ZPU|A Chain A, Crystal Structure Of Fet3p, A Multicopper Oxidase That Functions In Iron Import Length = 534 | Back alignment and structure |
|
| >pdb|3G5W|A Chain A, Crystal Structure Of Blue Copper Oxidase From Nitrosomonas Europaea Length = 318 | Back alignment and structure |
| >pdb|1AOZ|A Chain A, Refined Crystal Structure Of Ascorbate Oxidase At 1.9 Angstroms Resolution Length = 552 | Back alignment and structure |
| >pdb|3SQR|A Chain A, Crystal Structure Of Laccase From Botrytis Aclada At 1.67 A Resolution Length = 580 | Back alignment and structure |
| >pdb|3KW7|A Chain A, Crystal Structure Of Lacb From Trametes Sp. Ah28-2 Length = 502 | Back alignment and structure |
| >pdb|3V9E|A Chain A, Structure Of The L513m Mutant Of The Laccase From B.aclada Length = 580 | Back alignment and structure |
| >pdb|3T6V|A Chain A, Crystal Structure Of Laccase From Steccherinum Ochraceum Length = 495 | Back alignment and structure |
| >pdb|1HFU|A Chain A, Type-2 Cu-Depleted Laccase From Coprinus Cinereus At 1.68 A Resolution Length = 503 | Back alignment and structure |
| >pdb|1A65|A Chain A, Type-2 Cu-depleted Laccase From Coprinus Cinereus Length = 504 | Back alignment and structure |
| >pdb|2HZH|A Chain A, Crystal Structure Of Laccase From Coriolus Zonatus At 2.6 A Resolution Length = 499 | Back alignment and structure |
| >pdb|2QT6|A Chain A, Crystal Structure Determination Of A Blue Laccase From Lentinus Tigrinus Length = 498 | Back alignment and structure |
| >pdb|1KYA|A Chain A, Active Laccase From Trametes Versicolor Complexed With 2,5-Xylidine Length = 499 | Back alignment and structure |
| >pdb|4A2F|A Chain A, Coriolopsis Gallica Laccase Collected At 12.65 Kev Length = 497 | Back alignment and structure |
| >pdb|4A2D|A Chain A, Coriolopsis Gallica Laccase T2 Copper Depleted At Ph 4.5 Length = 496 | Back alignment and structure |
| >pdb|2HRG|A Chain A, Crystal Structure Of Blue Laccase From Trametes Trogii Complexed With P-Methylbenzoate Length = 496 | Back alignment and structure |
| >pdb|1GYC|A Chain A, Crystal Structure Determination At Room Temperature Of A Laccase From Trametes Versicolor In Its Oxidised Form Containing A Full Complement Of Copper Ions Length = 499 | Back alignment and structure |
| >pdb|2XYB|A Chain A, Crystal Structure Of A Fully Functional Laccase From The Ligninolytic Fungus Pycnoporus Cinnabarinus Length = 497 | Back alignment and structure |
| >pdb|3DIV|A Chain A, Crystal Structure Of Laccase From Cerrena Maxima At 1.76a Resolution Length = 499 | Back alignment and structure |
| >pdb|2H5U|A Chain A, Crystal Structure Of Laccase From Cerrena Maxima At 1.9a Resolution Length = 499 | Back alignment and structure |
| >pdb|3FPX|A Chain A, Native Fungus Laccase From Trametes Hirsuta Length = 499 | Back alignment and structure |
| >pdb|3PXL|A Chain A, Type-2 Cu-Depleted Fungus Laccase From Trametes Hirsuta Length = 499 | Back alignment and structure |
| >pdb|1V10|A Chain A, Structure Of Rigidoporus Lignosus Laccase From Hemihedrally Twinned Crystals Length = 521 | Back alignment and structure |
| >pdb|3DKH|A Chain A, L559a Mutant Of Melanocarpus Albomyces Laccase Length = 559 | Back alignment and structure |
| >pdb|1GW0|A Chain A, Crystal Structure Of Laccase From Melanocarpus Albomyces In Four Copper Form Length = 559 | Back alignment and structure |
| >pdb|3PPS|A Chain A, Crystal Structure Of An Ascomycete Fungal Laccase From Thielavia Arenaria Length = 604 | Back alignment and structure |
| >pdb|2Q9O|A Chain A, Near-Atomic Resolution Structure Of A Melanocarpus Albomyces Laccase Length = 559 | Back alignment and structure |
| >pdb|3ZX1|A Chain A, Multicopper Oxidase From Campylobacter Jejuni: A Metallo-Oxidase Length = 481 | Back alignment and structure |
| >pdb|3GDC|A Chain A, Crystal Structure Of Multicopper Oxidase Length = 288 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 75 | |||
| 1aoz_A | 552 | Ascorbate oxidase; oxidoreductase(oxygen acceptor) | 5e-34 | |
| 1zpu_A | 534 | Iron transport multicopper oxidase FET3; ferroxida | 3e-32 | |
| 3g5w_A | 318 | Multicopper oxidase type 1; two domain, laccase, n | 2e-31 | |
| 3t6v_A | 495 | Laccase; beta barrel, oxidoreductase; HET: CBS; 2. | 6e-31 | |
| 3pxl_A | 499 | Laccase; 4-copper protein, metal-binding, oxidored | 7e-31 | |
| 1v10_A | 521 | Laccase; multicopper blue oxidase, oxidase; 1.7A { | 2e-30 | |
| 3sqr_A | 580 | Laccase; multicopper oxidase, glycosylation, oxido | 3e-30 | |
| 2zwn_A | 339 | Two-domain type laccase; muticopper oxidase, oxido | 4e-30 | |
| 2q9o_A | 559 | Laccase-1; multicopper oxidase, 2-OXOH oxidoreduct | 5e-30 | |
| 1hfu_A | 503 | Laccase 1; oxidoreductase, blue multi-copper oxida | 8e-30 | |
| 3gdc_A | 288 | Multicopper oxidase; beta sandwich, plasmid, oxido | 6e-18 | |
| 2xu9_A | 439 | Laccase; oxidoreductase, multicopper oxidases; 1.5 | 4e-16 | |
| 3aw5_A | 448 | Multicopper oxidase; beta barrel, oxidoreductase; | 5e-16 | |
| 3od3_A | 488 | Blue copper oxidase CUEO; multicopper oxidase, Cu( | 1e-15 | |
| 3zx1_A | 481 | Oxidoreductase, putative; laccase, metallo-oxidase | 3e-15 | |
| 3abg_A | 534 | Bilirubin oxidase; cleavage on PAIR of basic resid | 1e-14 | |
| 3cg8_A | 343 | Laccase; oxidoreductase, multicopper blue protein; | 2e-12 | |
| 3kw8_A | 276 | Laccase, putative copper oxidase; two-domain lacca | 3e-12 | |
| 2zoo_A | 442 | Probable nitrite reductase; electron transfer, ele | 4e-12 | |
| 2r7e_A | 742 | Coagulation factor VIII; ceruloplasmin fold, cuppe | 5e-12 | |
| 2r7e_A | 742 | Coagulation factor VIII; ceruloplasmin fold, cuppe | 8e-10 | |
| 2uxt_A | 451 | Protein SUFI, SUFI; oxidoreductase, periplasmic, c | 5e-11 | |
| 1kbv_A | 327 | ANIA, major outer membrane protein PAN 1; ANIA[NO2 | 7e-11 | |
| 2dv6_A | 447 | Nitrite reductase; electron transfer, reduction, d | 1e-10 | |
| 2dv6_A | 447 | Nitrite reductase; electron transfer, reduction, d | 4e-04 | |
| 2bw4_A | 340 | Copper-containing nitrite reductase; oxidoreductas | 6e-10 | |
| 1sdd_A | 306 | Coagulation factor V; copper-binding protein, cofa | 8e-10 | |
| 1oe1_A | 336 | Dissimilatory copper-containing nitrite reductase; | 1e-09 | |
| 2j5w_A | 1065 | Ceruloplasmin, ferroxidase; oxidoreductase, plasma | 2e-09 | |
| 2j5w_A | 1065 | Ceruloplasmin, ferroxidase; oxidoreductase, plasma | 1e-07 | |
| 2j5w_A | 1065 | Ceruloplasmin, ferroxidase; oxidoreductase, plasma | 2e-05 | |
| 1mzy_A | 333 | Copper-containing nitrite reductase; mutant M182T, | 9e-09 | |
| 2wsd_A | 513 | Spore coat protein A; oxidoreductase, multi-copper | 2e-08 | |
| 2g23_A | 612 | PHS, phenoxazinone synthase; copper, metalloprotei | 3e-08 | |
| 1sdd_B | 647 | Coagulation factor V; copper-binding protein, cofa | 4e-05 |
| >1aoz_A Ascorbate oxidase; oxidoreductase(oxygen acceptor); HET: NAG; 1.90A {Cucurbita pepo var} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1aso_A* 1asp_A* 1asq_A* Length = 552 | Back alignment and structure |
|---|
Score = 120 bits (302), Expect = 5e-34
Identities = 32/71 (45%), Positives = 41/71 (57%), Gaps = 1/71 (1%)
Query: 6 NVCEGDRVVVDVRNSMDGLENTIHWHGIHQRGTQYSDGVPFVTQCPITQGNTFRYQFTAN 65
GD VVV++ N + IHWHGI QRGT ++DG ++QC I G TF Y FT +
Sbjct: 37 RANAGDSVVVELTNKLHTEGVVIHWHGILQRGTPWADGTASISQCAINPGETFFYNFTVD 96
Query: 66 -AGTHFWHAHT 75
GT F+H H
Sbjct: 97 NPGTFFYHGHL 107
|
| >1zpu_A Iron transport multicopper oxidase FET3; ferroxidase, oxidoreduc; HET: NAG BMA MAN NDG; 2.80A {Saccharomyces cerevisiae} Length = 534 | Back alignment and structure |
|---|
| >3g5w_A Multicopper oxidase type 1; two domain, laccase, nitrifier, metal B protein; 1.90A {Nitrosomonas europaea} Length = 318 | Back alignment and structure |
|---|
| >3t6v_A Laccase; beta barrel, oxidoreductase; HET: CBS; 2.00A {Steccherinum ochraceum} PDB: 3t6w_A* 3t6x_A* 3t6z_A* 3t71_A* Length = 495 | Back alignment and structure |
|---|
| >3pxl_A Laccase; 4-copper protein, metal-binding, oxidoreductase, type-2 Cu-D; HET: NAG BMA MAN; 1.20A {Trametes hirsuta} PDB: 3fpx_A* 3v9c_A* 3div_A* 2h5u_A* 2xyb_A* 1kya_A* 1gyc_A* 2qt6_A* 2hrg_A* 2hrh_A* 4a2f_A* 2vdz_A* 4a2d_A* 4a2e_A* 4a2g_A* 4a2h_A* 2ve0_A* 2vds_A* 2hzh_A* 3kw7_A* Length = 499 | Back alignment and structure |
|---|
| >1v10_A Laccase; multicopper blue oxidase, oxidase; 1.7A {Rigidoporus lignosus} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 Length = 521 | Back alignment and structure |
|---|
| >3sqr_A Laccase; multicopper oxidase, glycosylation, oxidoreductase; HET: NAG BMA MAN; 1.67A {Botrytis aclada} Length = 580 | Back alignment and structure |
|---|
| >2zwn_A Two-domain type laccase; muticopper oxidase, oxidoreductase; 1.70A {Metagenomes} Length = 339 | Back alignment and structure |
|---|
| >2q9o_A Laccase-1; multicopper oxidase, 2-OXOH oxidoreductase; HET: OHI NAG MAN GOL; 1.30A {Melanocarpus albomyces} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 3fu7_A* 3fu8_A* 3fu7_B* 1gw0_A* 2ih9_A* 2ih8_A* 3fu9_A* 3qpk_A* 3dkh_A* 3pps_A* Length = 559 | Back alignment and structure |
|---|
| >1hfu_A Laccase 1; oxidoreductase, blue multi-copper oxidase, type-2 copper depleted, signal, glycoprotein; HET: MAN NAG NDG; 1.68A {Coprinus cinereus} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1a65_A* Length = 503 | Back alignment and structure |
|---|
| >3gdc_A Multicopper oxidase; beta sandwich, plasmid, oxidoreductase; 1.80A {Arthrobacter SP} Length = 288 | Back alignment and structure |
|---|
| >2xu9_A Laccase; oxidoreductase, multicopper oxidases; 1.50A {Thermus thermophilus} PDB: 2xuw_A 2xvb_A 2yae_A 2yaf_A 2yah_A 2yam_A 2yao_A 2yap_A 2yaq_A 2yar_A 4ai7_A Length = 439 | Back alignment and structure |
|---|
| >3aw5_A Multicopper oxidase; beta barrel, oxidoreductase; 2.00A {Pyrobaculum aerophilum} Length = 448 | Back alignment and structure |
|---|
| >3od3_A Blue copper oxidase CUEO; multicopper oxidase, Cu(I) oxidase, oxidoreductase; 1.10A {Escherichia coli} PDB: 1n68_A 2fqd_A* 2fqe_A* 2fqf_A* 2fqg_A* 3nsd_A 1kv7_A 3pau_A 3pav_A 3nsf_A 1pf3_A 3qqx_A 3nsc_A 3nt0_A 3uad_A 3uaa_A 3uac_A 3uab_A 3uae_A 3nsy_A ... Length = 488 | Back alignment and structure |
|---|
| >3zx1_A Oxidoreductase, putative; laccase, metallo-oxidase, cuprous oxidase; 1.95A {Campylobacter jejuni subsp} Length = 481 | Back alignment and structure |
|---|
| >3abg_A Bilirubin oxidase; cleavage on PAIR of basic residues, glyco metal-binding, oxidoreductase; HET: NAG BMA NDG; 2.30A {Myrothecium verrucaria} PDB: 2xll_A* Length = 534 | Back alignment and structure |
|---|
| >3cg8_A Laccase; oxidoreductase, multicopper blue protein; HET: PG4; 2.68A {Streptomyces coelicolor} Length = 343 | Back alignment and structure |
|---|
| >3kw8_A Laccase, putative copper oxidase; two-domain laccase, oxidoreductase, multicopper blue protein; HET: PG4 PGE; 2.29A {Streptomyces coelicolor} Length = 276 | Back alignment and structure |
|---|
| >2zoo_A Probable nitrite reductase; electron transfer, electron transport, heme, iron, binding, oxidoreductase, transport; HET: SUC HEM; 1.95A {Pseudoalteromonas haloplanktis} Length = 442 | Back alignment and structure |
|---|
| >2r7e_A Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_A* Length = 742 | Back alignment and structure |
|---|
| >2r7e_A Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_A* Length = 742 | Back alignment and structure |
|---|
| >2uxt_A Protein SUFI, SUFI; oxidoreductase, periplasmic, cupredoxin-like, FTS mutant suppressor; 1.90A {Escherichia coli} PDB: 2uxv_A Length = 451 | Back alignment and structure |
|---|
| >1kbv_A ANIA, major outer membrane protein PAN 1; ANIA[NO2-], oxidoreductase; 1.95A {Neisseria gonorrhoeae} SCOP: b.6.1.3 b.6.1.3 PDB: 1kbw_A Length = 327 | Back alignment and structure |
|---|
| >2dv6_A Nitrite reductase; electron transfer, reduction, denitrification, oxidoreductase; 2.20A {Hyphomicrobium denitrificans} Length = 447 | Back alignment and structure |
|---|
| >2dv6_A Nitrite reductase; electron transfer, reduction, denitrification, oxidoreductase; 2.20A {Hyphomicrobium denitrificans} Length = 447 | Back alignment and structure |
|---|
| >2bw4_A Copper-containing nitrite reductase; oxidoreductase, denitrification, catalysis, enzyme mechanism, nitrate assimilation; 0.90A {Achromobacter cycloclastes} SCOP: b.6.1.3 b.6.1.3 PDB: 1nib_A 1nia_A 1nid_A 1nie_A 1nic_A 1nif_A 2bw5_A 2bwd_A 2bwi_A 2nrd_A 2y1a_A 1kcb_A 1rzp_A* 1rzq_A 2avf_A 1as6_A 1aq8_A 1as7_A 1as8_A 2afn_A ... Length = 340 | Back alignment and structure |
|---|
| >1sdd_A Coagulation factor V; copper-binding protein, cofactor, blood clottin; HET: NAG NDG; 2.80A {Bos taurus} SCOP: b.6.1.3 b.6.1.3 Length = 306 | Back alignment and structure |
|---|
| >1oe1_A Dissimilatory copper-containing nitrite reductase; denitrification; HET: PG4; 1.04A {Alcaligenes xylosoxidans} SCOP: b.6.1.3 b.6.1.3 PDB: 1oe3_A* 2xwz_A* 2vn3_A 2zon_A* 1haw_A 1hau_A* 2vm4_A* 2vw4_A* 2vw6_A* 2vw7_A* 2vm3_A* 1oe2_A* 2jl0_A* 2xx1_A 2xxg_A* 2xxf_A* 1gs8_A 1wa1_X* 1wa2_X* 2jl3_A* ... Length = 336 | Back alignment and structure |
|---|
| >2j5w_A Ceruloplasmin, ferroxidase; oxidoreductase, plasma protein, copper transport, copper, transport, polymorphism, glycoprotein, multi-copper oxidase; HET: NAG; 2.80A {Homo sapiens} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1kcw_A* Length = 1065 | Back alignment and structure |
|---|
| >2j5w_A Ceruloplasmin, ferroxidase; oxidoreductase, plasma protein, copper transport, copper, transport, polymorphism, glycoprotein, multi-copper oxidase; HET: NAG; 2.80A {Homo sapiens} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1kcw_A* Length = 1065 | Back alignment and structure |
|---|
| >2j5w_A Ceruloplasmin, ferroxidase; oxidoreductase, plasma protein, copper transport, copper, transport, polymorphism, glycoprotein, multi-copper oxidase; HET: NAG; 2.80A {Homo sapiens} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1kcw_A* Length = 1065 | Back alignment and structure |
|---|
| >1mzy_A Copper-containing nitrite reductase; mutant M182T, gating mechanism, electron oxidoreductase; 1.46A {Rhodobacter sphaeroides} SCOP: b.6.1.3 b.6.1.3 PDB: 1mzz_A 1n70_A 1zv2_A 2a3t_A 2dws_A 2dwt_A 2dy2_A Length = 333 | Back alignment and structure |
|---|
| >2wsd_A Spore coat protein A; oxidoreductase, multi-copper oxidase, sporulation, COTA- LAC copper centre; 1.60A {Bacillus subtilis} PDB: 1gsk_A 1hkp_A 1hkz_A 1hl0_A 1hl1_A 1of0_A* 1ogr_A 1uvw_A* 1w6l_A 1w6w_A 1w8e_A 2bhf_A 2x87_A 2x88_A* 4a67_A 4akq_A 4a68_A* 4akp_A* 4a66_A 4ako_A Length = 513 | Back alignment and structure |
|---|
| >1sdd_B Coagulation factor V; copper-binding protein, cofactor, blood clottin; HET: NAG NDG; 2.80A {Bos taurus} SCOP: b.6.1.3 b.6.1.3 b.18.1.2 b.18.1.2 Length = 647 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 75 | |||
| 3sqr_A | 580 | Laccase; multicopper oxidase, glycosylation, oxido | 99.96 | |
| 3t6v_A | 495 | Laccase; beta barrel, oxidoreductase; HET: CBS; 2. | 99.96 | |
| 3pxl_A | 499 | Laccase; 4-copper protein, metal-binding, oxidored | 99.96 | |
| 1aoz_A | 552 | Ascorbate oxidase; oxidoreductase(oxygen acceptor) | 99.96 | |
| 1zpu_A | 534 | Iron transport multicopper oxidase FET3; ferroxida | 99.96 | |
| 1v10_A | 521 | Laccase; multicopper blue oxidase, oxidase; 1.7A { | 99.96 | |
| 2q9o_A | 559 | Laccase-1; multicopper oxidase, 2-OXOH oxidoreduct | 99.95 | |
| 1hfu_A | 503 | Laccase 1; oxidoreductase, blue multi-copper oxida | 99.95 | |
| 3g5w_A | 318 | Multicopper oxidase type 1; two domain, laccase, n | 99.95 | |
| 3t9w_A | 299 | Small laccase, multi-copper oxidase; two-domain co | 99.95 | |
| 2zwn_A | 339 | Two-domain type laccase; muticopper oxidase, oxido | 99.94 | |
| 3gdc_A | 288 | Multicopper oxidase; beta sandwich, plasmid, oxido | 99.94 | |
| 3tas_A | 313 | Small laccase, multi-copper oxidase; two-domain la | 99.94 | |
| 3kw8_A | 276 | Laccase, putative copper oxidase; two-domain lacca | 99.94 | |
| 3zx1_A | 481 | Oxidoreductase, putative; laccase, metallo-oxidase | 99.94 | |
| 2uxt_A | 451 | Protein SUFI, SUFI; oxidoreductase, periplasmic, c | 99.94 | |
| 3aw5_A | 448 | Multicopper oxidase; beta barrel, oxidoreductase; | 99.93 | |
| 3abg_A | 534 | Bilirubin oxidase; cleavage on PAIR of basic resid | 99.92 | |
| 3od3_A | 488 | Blue copper oxidase CUEO; multicopper oxidase, Cu( | 99.92 | |
| 2j5w_A | 1065 | Ceruloplasmin, ferroxidase; oxidoreductase, plasma | 99.92 | |
| 1sdd_A | 306 | Coagulation factor V; copper-binding protein, cofa | 99.92 | |
| 2wsd_A | 513 | Spore coat protein A; oxidoreductase, multi-copper | 99.92 | |
| 2xu9_A | 439 | Laccase; oxidoreductase, multicopper oxidases; 1.5 | 99.91 | |
| 2r7e_A | 742 | Coagulation factor VIII; ceruloplasmin fold, cuppe | 99.91 | |
| 3gyr_A | 612 | PHS, phenoxazinone synthase; metalloprotein, lacca | 99.91 | |
| 2r7e_B | 770 | Coagulation factor VIII; ceruloplasmin fold, cuppe | 99.9 | |
| 3cg8_A | 343 | Laccase; oxidoreductase, multicopper blue protein; | 99.9 | |
| 1sdd_B | 647 | Coagulation factor V; copper-binding protein, cofa | 99.9 | |
| 2g23_A | 612 | PHS, phenoxazinone synthase; copper, metalloprotei | 99.88 | |
| 2r7e_A | 742 | Coagulation factor VIII; ceruloplasmin fold, cuppe | 99.88 | |
| 1kbv_A | 327 | ANIA, major outer membrane protein PAN 1; ANIA[NO2 | 99.84 | |
| 2zoo_A | 442 | Probable nitrite reductase; electron transfer, ele | 99.84 | |
| 1mzy_A | 333 | Copper-containing nitrite reductase; mutant M182T, | 99.84 | |
| 1oe1_A | 336 | Dissimilatory copper-containing nitrite reductase; | 99.82 | |
| 2bw4_A | 340 | Copper-containing nitrite reductase; oxidoreductas | 99.82 | |
| 2dv6_A | 447 | Nitrite reductase; electron transfer, reduction, d | 99.73 | |
| 3cvb_A | 105 | Plastocyanin; cupredoxin, SELF assembly, copper, e | 99.69 | |
| 3kw8_A | 276 | Laccase, putative copper oxidase; two-domain lacca | 99.67 | |
| 2dv6_A | 447 | Nitrite reductase; electron transfer, reduction, d | 99.63 | |
| 2j5w_A | 1065 | Ceruloplasmin, ferroxidase; oxidoreductase, plasma | 99.61 | |
| 3cg8_A | 343 | Laccase; oxidoreductase, multicopper blue protein; | 99.53 | |
| 1iby_A | 112 | Nitrosocyanin; RED copper, cupredoxin, beta hairpi | 99.45 | |
| 3t9w_A | 299 | Small laccase, multi-copper oxidase; two-domain co | 99.44 | |
| 3tas_A | 313 | Small laccase, multi-copper oxidase; two-domain la | 99.4 | |
| 2ov0_A | 105 | Amicyanin; beta-sandwich, electron transport; 0.75 | 99.4 | |
| 2aan_A | 139 | Auracyanin A; cupredoxin fold, electron transport; | 99.39 | |
| 3g5w_A | 318 | Multicopper oxidase type 1; two domain, laccase, n | 99.37 | |
| 3zx1_A | 481 | Oxidoreductase, putative; laccase, metallo-oxidase | 99.37 | |
| 2g23_A | 612 | PHS, phenoxazinone synthase; copper, metalloprotei | 99.35 | |
| 3gdc_A | 288 | Multicopper oxidase; beta sandwich, plasmid, oxido | 99.32 | |
| 2xu9_A | 439 | Laccase; oxidoreductase, multicopper oxidases; 1.5 | 99.31 | |
| 1hfu_A | 503 | Laccase 1; oxidoreductase, blue multi-copper oxida | 99.31 | |
| 2gim_A | 106 | Plastocyanin; beta sheet, Cu, helix, electron tran | 99.3 | |
| 1v10_A | 521 | Laccase; multicopper blue oxidase, oxidase; 1.7A { | 99.3 | |
| 1zpu_A | 534 | Iron transport multicopper oxidase FET3; ferroxida | 99.28 | |
| 1sdd_B | 647 | Coagulation factor V; copper-binding protein, cofa | 99.28 | |
| 2cal_A | 154 | Rusticyanin; iron respiratory electron transport c | 99.26 | |
| 2zwn_A | 339 | Two-domain type laccase; muticopper oxidase, oxido | 99.24 | |
| 1aoz_A | 552 | Ascorbate oxidase; oxidoreductase(oxygen acceptor) | 99.23 | |
| 1fwx_A | 595 | Nitrous oxide reductase; beta-propeller domain, cu | 99.22 | |
| 3abg_A | 534 | Bilirubin oxidase; cleavage on PAIR of basic resid | 99.22 | |
| 3t6v_A | 495 | Laccase; beta barrel, oxidoreductase; HET: CBS; 2. | 99.22 | |
| 3gyr_A | 612 | PHS, phenoxazinone synthase; metalloprotein, lacca | 99.2 | |
| 1sdd_A | 306 | Coagulation factor V; copper-binding protein, cofa | 99.18 | |
| 2plt_A | 98 | Plastocyanin; electron transport; 1.50A {Chlamydom | 99.18 | |
| 3pxl_A | 499 | Laccase; 4-copper protein, metal-binding, oxidored | 99.16 | |
| 4hci_A | 100 | Cupredoxin 1; structural genomics, niaid, national | 99.15 | |
| 1kbv_A | 327 | ANIA, major outer membrane protein PAN 1; ANIA[NO2 | 99.15 | |
| 2wsd_A | 513 | Spore coat protein A; oxidoreductase, multi-copper | 99.13 | |
| 3od3_A | 488 | Blue copper oxidase CUEO; multicopper oxidase, Cu( | 99.08 | |
| 1bxv_A | 91 | Plastocyanin; copper protein, electron transfer; 1 | 99.07 | |
| 1qhq_A | 140 | Protein (auracyanin); electron transfer, cupredoxi | 99.06 | |
| 1pcs_A | 98 | Plastocyanin; electron transport; 2.15A {Synechocy | 99.04 | |
| 2q9o_A | 559 | Laccase-1; multicopper oxidase, 2-OXOH oxidoreduct | 99.02 | |
| 2r7e_B | 770 | Coagulation factor VIII; ceruloplasmin fold, cuppe | 99.02 | |
| 1byp_A | 99 | Protein (plastocyanin); electron transfer, photosy | 99.01 | |
| 1b3i_A | 97 | PETE protein, protein (plastocyanin); electron tra | 98.98 | |
| 1plc_A | 99 | Plastocyanin; electron transport; 1.33A {Populus n | 98.97 | |
| 3sqr_A | 580 | Laccase; multicopper oxidase, glycosylation, oxido | 98.96 | |
| 3erx_A | 123 | Pseudoazurin; copper protein, high-resolution, E t | 98.96 | |
| 2zoo_A | 442 | Probable nitrite reductase; electron transfer, ele | 98.92 | |
| 1kdj_A | 102 | Plastocyanin; electron transfer, photosystem, PAI- | 98.91 | |
| 3tu6_A | 127 | Pseudoazurin (blue copper protein); cupredoxins, b | 98.89 | |
| 3ef4_A | 124 | Pseudoazurin, blue copper protein; electron transf | 98.87 | |
| 3c75_A | 132 | Amicyanin; copper proteins, electron transfer comp | 98.87 | |
| 1mzy_A | 333 | Copper-containing nitrite reductase; mutant M182T, | 98.86 | |
| 2bw4_A | 340 | Copper-containing nitrite reductase; oxidoreductas | 98.86 | |
| 2uxt_A | 451 | Protein SUFI, SUFI; oxidoreductase, periplasmic, c | 98.82 | |
| 1iuz_A | 98 | Plastocyanin; electron transport; 1.60A {Ulva pert | 98.77 | |
| 3aw5_A | 448 | Multicopper oxidase; beta barrel, oxidoreductase; | 98.75 | |
| 1cuo_A | 129 | Protein (azurin ISO-2); beta barrel, periplasmic, | 98.68 | |
| 1paz_A | 123 | Pseudoazurin precursor; electron transfer(cupropro | 98.68 | |
| 1id2_A | 106 | Amicyanin; beta barrel, type-1 blue copper protein | 98.67 | |
| 1pmy_A | 123 | Pseudoazurin; electron transfer(cuproprotein); 1.5 | 98.65 | |
| 2ux6_A | 122 | Pseudoazurin; type-1 copper, metal-binding, redox | 98.63 | |
| 3ay2_A | 167 | Lipid modified azurin protein; beta sandwich, bact | 98.62 | |
| 1oe1_A | 336 | Dissimilatory copper-containing nitrite reductase; | 98.55 | |
| 1nwp_A | 128 | Azurin; electron transport, cupredoxin, electron t | 98.52 | |
| 2ccw_A | 129 | Azurin II, AZN-2; electron transport (cuproprotein | 98.5 | |
| 3sbq_A | 638 | Nitrous-oxide reductase; beta-propeller, cupredoxi | 98.44 | |
| 2iaa_C | 128 | Azurin; quinoprotein, tryptophan tryptophylquinone | 98.43 | |
| 2cua_A | 135 | Protein (CUA); CUA center, electron transport; 1.6 | 98.01 | |
| 3fsa_A | 125 | Azurin; copper, cupredoxin fold, metal-binding, pr | 97.99 | |
| 3s8f_B | 168 | Cytochrome C oxidase subunit 2; complex IV, respir | 97.73 | |
| 1cyx_A | 205 | CYOA; electron transport; 2.30A {Escherichia coli} | 93.99 | |
| 4ep8_B | 101 | Urease subunit beta; alpha-beta barrel, nickel met | 93.0 | |
| 2gsm_B | 262 | Cytochrome C oxidase subunit 2; transmembrane prot | 92.22 | |
| 4ac7_B | 126 | Urease subunit beta; hydrolase, bacillus pasteurii | 91.94 | |
| 4ubp_B | 126 | Protein (urease (chain B)); bacillus pasteurii, ni | 91.94 | |
| 3hb3_B | 298 | Cytochrome C oxidase subunit 2; electron transfer, | 91.27 | |
| 1v54_B | 227 | Cytochrome C oxidase polypeptide II; oxidoreductas | 88.95 | |
| 3isy_A | 120 | Bsupi, intracellular proteinase inhibitor; intrace | 88.39 | |
| 3rfr_A | 419 | PMOB; membrane, oxidoreductase; 2.68A {Methylocyst | 88.0 | |
| 3qga_A | 225 | UREA2, fusion of urease beta and gamma subunits; i | 86.7 | |
| 1yew_A | 382 | Particulate methane monooxygenase, B subunit; memb | 85.82 | |
| 1xwv_A | 129 | DER F II; beta sheets, allergen; HET: PE3 XPE; 1.8 | 85.48 | |
| 1nep_A | 130 | EPV20, BNPC2, epididymal secretory protein E1; nie | 82.88 | |
| 2wtp_A | 131 | ORF131 protein, CZCE; metal binding protein, heavy | 82.51 |
| >3sqr_A Laccase; multicopper oxidase, glycosylation, oxidoreductase; HET: NAG BMA MAN; 1.67A {Botrytis aclada} | Back alignment and structure |
|---|
Probab=99.96 E-value=1e-29 Score=178.88 Aligned_cols=75 Identities=40% Similarity=0.699 Sum_probs=70.6
Q ss_pred CcccEEEecCCEEEEEEEeCCCCCCceEEeCCccccCCCCCCCCCcccccccCCCCEEEEEEc-CCCeeeEEccCC
Q psy88 1 MLYPKNVCEGDRVVVDVRNSMDGLENTIHWHGIHQRGTQYSDGVPFVTQCPITQGNTFRYQFT-ANAGTHFWHAHT 75 (75)
Q Consensus 1 ~~~~i~~~~Gd~v~i~~~N~~~~~~~~iH~HG~~~~~~~~~DG~~~~~~~~i~pG~~~~y~~~-~~~Gt~~YH~H~ 75 (75)
++++||+++||+|+|+|+|+++.++++|||||+.+...+++||+++++||||+||++|+|+|+ +++||||||||.
T Consensus 96 PGP~I~~~~GD~v~V~v~N~l~~~~tsIHwHGl~~~~t~~~DGvp~vTq~pI~PG~sftY~f~~~q~GT~WYHsH~ 171 (580)
T 3sqr_A 96 PGPAIIADWGDNLIIHVTNNLEHNGTSIHWHGIRQLGSLEYDGVPGVTQCPIAPGDTLTYKFQVTQYGTTWYHSHF 171 (580)
T ss_dssp SCCCEEEETTCEEEEEEEECCSSCCBCEEETTCCCTTCGGGSCCBTTTBCCBCTTCEEEEEEECCCCEEEEEEECS
T ss_pred CCceEEEeCCCEEEEEEEECCCCCcceEEecccccCCCccccCCCccccCCCCCCCeEEEEEECCCCcceEEeecc
Confidence 468999999999999999999746899999999998778999999999999999999999999 999999999995
|
| >3t6v_A Laccase; beta barrel, oxidoreductase; HET: CBS; 2.00A {Steccherinum ochraceum} PDB: 3t6w_A* 3t6x_A* 3t6z_A* 3t71_A* | Back alignment and structure |
|---|
| >3pxl_A Laccase; 4-copper protein, metal-binding, oxidoreductase, type-2 Cu-D; HET: NAG BMA MAN; 1.20A {Trametes hirsuta} PDB: 3fpx_A* 3v9c_A* 3div_A* 2h5u_A* 2xyb_A* 1kya_A* 1gyc_A* 2qt6_A* 2hrg_A* 2hrh_A* 4a2f_A* 2vdz_A* 4a2d_A* 4a2e_A* 4a2g_A* 4a2h_A* 2ve0_A* 2vds_A* 2hzh_A* 3kw7_A* | Back alignment and structure |
|---|
| >1aoz_A Ascorbate oxidase; oxidoreductase(oxygen acceptor); HET: NAG; 1.90A {Cucurbita pepo var} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1aso_A* 1asp_A* 1asq_A* | Back alignment and structure |
|---|
| >1zpu_A Iron transport multicopper oxidase FET3; ferroxidase, oxidoreduc; HET: NAG BMA MAN NDG; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1v10_A Laccase; multicopper blue oxidase, oxidase; 1.7A {Rigidoporus lignosus} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 | Back alignment and structure |
|---|
| >2q9o_A Laccase-1; multicopper oxidase, 2-OXOH oxidoreductase; HET: OHI NAG MAN GOL; 1.30A {Melanocarpus albomyces} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 3fu7_A* 3fu8_A* 3fu7_B* 1gw0_A* 2ih9_A* 2ih8_A* 3fu9_A* 3qpk_A* 3dkh_A* 3pps_A* | Back alignment and structure |
|---|
| >1hfu_A Laccase 1; oxidoreductase, blue multi-copper oxidase, type-2 copper depleted, signal, glycoprotein; HET: MAN NAG NDG; 1.68A {Coprinus cinereus} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1a65_A* | Back alignment and structure |
|---|
| >3g5w_A Multicopper oxidase type 1; two domain, laccase, nitrifier, metal B protein; 1.90A {Nitrosomonas europaea} | Back alignment and structure |
|---|
| >3t9w_A Small laccase, multi-copper oxidase; two-domain copper oxidase, Cu-binding, oxidoreducta; 1.50A {Amycolatopsis SP} | Back alignment and structure |
|---|
| >2zwn_A Two-domain type laccase; muticopper oxidase, oxidoreductase; 1.70A {Metagenomes} | Back alignment and structure |
|---|
| >3gdc_A Multicopper oxidase; beta sandwich, plasmid, oxidoreductase; 1.80A {Arthrobacter SP} | Back alignment and structure |
|---|
| >3tas_A Small laccase, multi-copper oxidase; two-domain laccase, oxidoreductase, secreted; HET: PG4; 2.30A {Streptomyces viridosporus} PDB: 3tbb_A 3tbc_A* | Back alignment and structure |
|---|
| >3kw8_A Laccase, putative copper oxidase; two-domain laccase, oxidoreductase, multicopper blue protein; HET: PG4 PGE; 2.29A {Streptomyces coelicolor} PDB: 4gxf_A* 4gy4_A* | Back alignment and structure |
|---|
| >3zx1_A Oxidoreductase, putative; laccase, metallo-oxidase, cuprous oxidase; 1.95A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >2uxt_A Protein SUFI, SUFI; oxidoreductase, periplasmic, cupredoxin-like, FTS mutant suppressor; 1.90A {Escherichia coli} PDB: 2uxv_A | Back alignment and structure |
|---|
| >3aw5_A Multicopper oxidase; beta barrel, oxidoreductase; 2.00A {Pyrobaculum aerophilum} | Back alignment and structure |
|---|
| >3abg_A Bilirubin oxidase; cleavage on PAIR of basic residues, glyco metal-binding, oxidoreductase; HET: NAG BMA NDG; 2.30A {Myrothecium verrucaria} PDB: 2xll_A* | Back alignment and structure |
|---|
| >3od3_A Blue copper oxidase CUEO; multicopper oxidase, Cu(I) oxidase, oxidoreductase; 1.10A {Escherichia coli} PDB: 1n68_A 2fqd_A* 2fqe_A* 2fqf_A* 2fqg_A* 3nsd_A 1kv7_A 3pau_A 3pav_A 3nsf_A 1pf3_A 3qqx_A 3nsc_A 3nt0_A 3uad_A 3uaa_A 3uac_A 3uab_A 3uae_A 3nsy_A ... | Back alignment and structure |
|---|
| >2j5w_A Ceruloplasmin, ferroxidase; oxidoreductase, plasma protein, copper transport, copper, transport, polymorphism, glycoprotein, multi-copper oxidase; HET: NAG; 2.80A {Homo sapiens} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1kcw_A* | Back alignment and structure |
|---|
| >1sdd_A Coagulation factor V; copper-binding protein, cofactor, blood clottin; HET: NAG NDG; 2.80A {Bos taurus} SCOP: b.6.1.3 b.6.1.3 | Back alignment and structure |
|---|
| >2wsd_A Spore coat protein A; oxidoreductase, multi-copper oxidase, sporulation, COTA- LAC copper centre; 1.60A {Bacillus subtilis} PDB: 1gsk_A 1hkp_A 1hkz_A 1hl0_A 1hl1_A 1of0_A* 1ogr_A 1uvw_A* 1w6l_A 1w6w_A 1w8e_A 2bhf_A 2x87_A 2x88_A* 4a67_A 4akq_A 4a68_A* 4akp_A* 4a66_A 4ako_A | Back alignment and structure |
|---|
| >2xu9_A Laccase; oxidoreductase, multicopper oxidases; 1.50A {Thermus thermophilus} PDB: 2xuw_A 2xvb_A 2yae_A 2yaf_A 2yah_A 2yam_A 2yao_A 2yap_A 2yaq_A 2yar_A 4ai7_A | Back alignment and structure |
|---|
| >2r7e_A Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_A* | Back alignment and structure |
|---|
| >3gyr_A PHS, phenoxazinone synthase; metalloprotein, laccase, multicopper oxidase, hexamer, oxidoreductase, antibiotic biosynthesis; 2.30A {Streptomyces antibioticus} | Back alignment and structure |
|---|
| >2r7e_B Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_B* | Back alignment and structure |
|---|
| >3cg8_A Laccase; oxidoreductase, multicopper blue protein; HET: PG4; 2.68A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >1sdd_B Coagulation factor V; copper-binding protein, cofactor, blood clottin; HET: NAG NDG; 2.80A {Bos taurus} SCOP: b.6.1.3 b.6.1.3 b.18.1.2 b.18.1.2 | Back alignment and structure |
|---|
| >2r7e_A Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_A* | Back alignment and structure |
|---|
| >1kbv_A ANIA, major outer membrane protein PAN 1; ANIA[NO2-], oxidoreductase; 1.95A {Neisseria gonorrhoeae} SCOP: b.6.1.3 b.6.1.3 PDB: 1kbw_A | Back alignment and structure |
|---|
| >2zoo_A Probable nitrite reductase; electron transfer, electron transport, heme, iron, binding, oxidoreductase, transport; HET: SUC HEM; 1.95A {Pseudoalteromonas haloplanktis} | Back alignment and structure |
|---|
| >1mzy_A Copper-containing nitrite reductase; mutant M182T, gating mechanism, electron oxidoreductase; 1.46A {Rhodobacter sphaeroides} SCOP: b.6.1.3 b.6.1.3 PDB: 1mzz_A 1n70_A 1zv2_A 2a3t_A 2dws_A 2dwt_A 2dy2_A | Back alignment and structure |
|---|
| >1oe1_A Dissimilatory copper-containing nitrite reductase; denitrification; HET: PG4; 1.04A {Alcaligenes xylosoxidans} SCOP: b.6.1.3 b.6.1.3 PDB: 1oe3_A* 2xwz_A* 2vn3_A 2zon_A* 1haw_A 1hau_A* 2vm4_A* 2vw4_A* 2vw6_A* 2vw7_A* 2vm3_A* 1oe2_A* 2jl0_A* 2xx1_A 2xxg_A* 2xxf_A* 1gs8_A 1wa1_X* 1wa2_X* 2jl3_A* ... | Back alignment and structure |
|---|
| >2bw4_A Copper-containing nitrite reductase; oxidoreductase, denitrification, catalysis, enzyme mechanism, nitrate assimilation; 0.90A {Achromobacter cycloclastes} SCOP: b.6.1.3 b.6.1.3 PDB: 1nib_A 1nia_A 1nid_A 1nie_A 1nic_A 1nif_A 2bw5_A 2bwd_A 2bwi_A 2nrd_A 2y1a_A 1kcb_A 1rzp_A* 1rzq_A 2avf_A 1as6_A 1aq8_A 1as7_A 1as8_A 2afn_A ... | Back alignment and structure |
|---|
| >2dv6_A Nitrite reductase; electron transfer, reduction, denitrification, oxidoreductase; 2.20A {Hyphomicrobium denitrificans} | Back alignment and structure |
|---|
| >3cvb_A Plastocyanin; cupredoxin, SELF assembly, copper, electron transport, metal-binding, transport; 1.40A {Phormidium laminosum} PDB: 3cvc_A 3cvd_A 2w8c_A 2w88_A 2q5b_A 1baw_A 3bqv_A | Back alignment and structure |
|---|
| >3kw8_A Laccase, putative copper oxidase; two-domain laccase, oxidoreductase, multicopper blue protein; HET: PG4 PGE; 2.29A {Streptomyces coelicolor} PDB: 4gxf_A* 4gy4_A* | Back alignment and structure |
|---|
| >2dv6_A Nitrite reductase; electron transfer, reduction, denitrification, oxidoreductase; 2.20A {Hyphomicrobium denitrificans} | Back alignment and structure |
|---|
| >2j5w_A Ceruloplasmin, ferroxidase; oxidoreductase, plasma protein, copper transport, copper, transport, polymorphism, glycoprotein, multi-copper oxidase; HET: NAG; 2.80A {Homo sapiens} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1kcw_A* | Back alignment and structure |
|---|
| >3cg8_A Laccase; oxidoreductase, multicopper blue protein; HET: PG4; 2.68A {Streptomyces coelicolor} | Back alignment and structure |
|---|
| >1iby_A Nitrosocyanin; RED copper, cupredoxin, beta hairpin, metal binding protein; 1.65A {Nitrosomonas europaea} SCOP: b.6.1.4 PDB: 1ibz_A 1ic0_A | Back alignment and structure |
|---|
| >3t9w_A Small laccase, multi-copper oxidase; two-domain copper oxidase, Cu-binding, oxidoreducta; 1.50A {Amycolatopsis SP} | Back alignment and structure |
|---|
| >3tas_A Small laccase, multi-copper oxidase; two-domain laccase, oxidoreductase, secreted; HET: PG4; 2.30A {Streptomyces viridosporus} PDB: 3tbb_A 3tbc_A* | Back alignment and structure |
|---|
| >2ov0_A Amicyanin; beta-sandwich, electron transport; 0.75A {Paracoccus denitrificans} SCOP: b.6.1.1 PDB: 1aaj_A 1aan_A 1aac_A 1mg2_C* 1mg3_C* 1t5k_A 2gc4_C* 2gc7_C* 2j55_A* 2j56_A* 2j57_A* 2mta_A* 1bxa_A 2rac_A 3l45_A 3ie9_A 3iea_A 2idq_A 2ids_A 1sf3_A ... | Back alignment and structure |
|---|
| >2aan_A Auracyanin A; cupredoxin fold, electron transport; 1.85A {Chloroflexus aurantiacus} | Back alignment and structure |
|---|
| >3g5w_A Multicopper oxidase type 1; two domain, laccase, nitrifier, metal B protein; 1.90A {Nitrosomonas europaea} | Back alignment and structure |
|---|
| >3zx1_A Oxidoreductase, putative; laccase, metallo-oxidase, cuprous oxidase; 1.95A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >3gdc_A Multicopper oxidase; beta sandwich, plasmid, oxidoreductase; 1.80A {Arthrobacter SP} | Back alignment and structure |
|---|
| >2xu9_A Laccase; oxidoreductase, multicopper oxidases; 1.50A {Thermus thermophilus} PDB: 2xuw_A 2xvb_A 2yae_A 2yaf_A 2yah_A 2yam_A 2yao_A 2yap_A 2yaq_A 2yar_A 4ai7_A | Back alignment and structure |
|---|
| >1hfu_A Laccase 1; oxidoreductase, blue multi-copper oxidase, type-2 copper depleted, signal, glycoprotein; HET: MAN NAG NDG; 1.68A {Coprinus cinereus} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1a65_A* | Back alignment and structure |
|---|
| >2gim_A Plastocyanin; beta sheet, Cu, helix, electron transport; 1.60A {Anabaena variabilis} SCOP: b.6.1.1 PDB: 1fa4_A 1nin_A 1tu2_A* 2cj3_A | Back alignment and structure |
|---|
| >1v10_A Laccase; multicopper blue oxidase, oxidase; 1.7A {Rigidoporus lignosus} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 | Back alignment and structure |
|---|
| >1zpu_A Iron transport multicopper oxidase FET3; ferroxidase, oxidoreduc; HET: NAG BMA MAN NDG; 2.80A {Saccharomyces cerevisiae} | Back alignment and structure |
|---|
| >1sdd_B Coagulation factor V; copper-binding protein, cofactor, blood clottin; HET: NAG NDG; 2.80A {Bos taurus} SCOP: b.6.1.3 b.6.1.3 b.18.1.2 b.18.1.2 | Back alignment and structure |
|---|
| >2cal_A Rusticyanin; iron respiratory electron transport chain, blue protein, electron transport, metal- binding, periplasmic; 1.10A {Thiobacillus ferrooxidans} PDB: 1cur_A 1gy2_A 1a3z_A 1e30_A 1gy1_A 1rcy_A 1a8z_A 2cak_A | Back alignment and structure |
|---|
| >2zwn_A Two-domain type laccase; muticopper oxidase, oxidoreductase; 1.70A {Metagenomes} | Back alignment and structure |
|---|
| >1aoz_A Ascorbate oxidase; oxidoreductase(oxygen acceptor); HET: NAG; 1.90A {Cucurbita pepo var} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 1aso_A* 1asp_A* 1asq_A* | Back alignment and structure |
|---|
| >1fwx_A Nitrous oxide reductase; beta-propeller domain, cupredoxin domain, CUZ site, CUA site oxidoreductase; 1.60A {Paracoccus denitrificans} SCOP: b.6.1.4 b.69.3.1 PDB: 2iwk_A 2iwf_A | Back alignment and structure |
|---|
| >3abg_A Bilirubin oxidase; cleavage on PAIR of basic residues, glyco metal-binding, oxidoreductase; HET: NAG BMA NDG; 2.30A {Myrothecium verrucaria} PDB: 2xll_A* | Back alignment and structure |
|---|
| >3t6v_A Laccase; beta barrel, oxidoreductase; HET: CBS; 2.00A {Steccherinum ochraceum} PDB: 3t6w_A* 3t6x_A* 3t6z_A* 3t71_A* | Back alignment and structure |
|---|
| >3gyr_A PHS, phenoxazinone synthase; metalloprotein, laccase, multicopper oxidase, hexamer, oxidoreductase, antibiotic biosynthesis; 2.30A {Streptomyces antibioticus} | Back alignment and structure |
|---|
| >1sdd_A Coagulation factor V; copper-binding protein, cofactor, blood clottin; HET: NAG NDG; 2.80A {Bos taurus} SCOP: b.6.1.3 b.6.1.3 | Back alignment and structure |
|---|
| >2plt_A Plastocyanin; electron transport; 1.50A {Chlamydomonas reinhardtii} SCOP: b.6.1.1 | Back alignment and structure |
|---|
| >3pxl_A Laccase; 4-copper protein, metal-binding, oxidoreductase, type-2 Cu-D; HET: NAG BMA MAN; 1.20A {Trametes hirsuta} PDB: 3fpx_A* 3v9c_A* 3div_A* 2h5u_A* 2xyb_A* 1kya_A* 1gyc_A* 2qt6_A* 2hrg_A* 2hrh_A* 4a2f_A* 2vdz_A* 4a2d_A* 4a2e_A* 4a2g_A* 4a2h_A* 2ve0_A* 2vds_A* 2hzh_A* 3kw7_A* | Back alignment and structure |
|---|
| >4hci_A Cupredoxin 1; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.63A {Bacillus anthracis} PDB: 4hcg_A 4hcf_A | Back alignment and structure |
|---|
| >1kbv_A ANIA, major outer membrane protein PAN 1; ANIA[NO2-], oxidoreductase; 1.95A {Neisseria gonorrhoeae} SCOP: b.6.1.3 b.6.1.3 PDB: 1kbw_A | Back alignment and structure |
|---|
| >2wsd_A Spore coat protein A; oxidoreductase, multi-copper oxidase, sporulation, COTA- LAC copper centre; 1.60A {Bacillus subtilis} PDB: 1gsk_A 1hkp_A 1hkz_A 1hl0_A 1hl1_A 1of0_A* 1ogr_A 1uvw_A* 1w6l_A 1w6w_A 1w8e_A 2bhf_A 2x87_A 2x88_A* 4a67_A 4akq_A 4a68_A* 4akp_A* 4a66_A 4ako_A | Back alignment and structure |
|---|
| >3od3_A Blue copper oxidase CUEO; multicopper oxidase, Cu(I) oxidase, oxidoreductase; 1.10A {Escherichia coli} PDB: 1n68_A 2fqd_A* 2fqe_A* 2fqf_A* 2fqg_A* 3nsd_A 1kv7_A 3pau_A 3pav_A 3nsf_A 1pf3_A 3qqx_A 3nsc_A 3nt0_A 3uad_A 3uaa_A 3uac_A 3uab_A 3uae_A 3nsy_A ... | Back alignment and structure |
|---|
| >1bxv_A Plastocyanin; copper protein, electron transfer; 1.80A {Synechococcus elongatus} SCOP: b.6.1.1 PDB: 1bxu_A | Back alignment and structure |
|---|
| >1qhq_A Protein (auracyanin); electron transfer, cupredoxin, blue copper protein, azurin-L thermophIle; 1.55A {Chloroflexus aurantiacus} SCOP: b.6.1.1 PDB: 1ov8_A | Back alignment and structure |
|---|
| >1pcs_A Plastocyanin; electron transport; 2.15A {Synechocystis SP} SCOP: b.6.1.1 PDB: 1m9w_A 1j5c_A 1j5d_A 1jxd_A 1jxf_A | Back alignment and structure |
|---|
| >2q9o_A Laccase-1; multicopper oxidase, 2-OXOH oxidoreductase; HET: OHI NAG MAN GOL; 1.30A {Melanocarpus albomyces} SCOP: b.6.1.3 b.6.1.3 b.6.1.3 PDB: 3fu7_A* 3fu8_A* 3fu7_B* 1gw0_A* 2ih9_A* 2ih8_A* 3fu9_A* 3qpk_A* 3dkh_A* 3pps_A* | Back alignment and structure |
|---|
| >2r7e_B Coagulation factor VIII; ceruloplasmin fold, cupper protein fold, C2 domain fold, ACU blood coagulation, disease mutation, glycoprotein; HET: NAG BMA MAN; 3.70A {Homo sapiens} PDB: 3cdz_B* | Back alignment and structure |
|---|
| >1byp_A Protein (plastocyanin); electron transfer, photosynthesis, acidic patch, double mutant, electron transport; 1.75A {Silene latifolia subsp} SCOP: b.6.1.1 PDB: 1pla_A 1plb_A | Back alignment and structure |
|---|
| >1b3i_A PETE protein, protein (plastocyanin); electron transport, type I copper protein, photosynthesis; NMR {Prochlorothrix hollandica} SCOP: b.6.1.1 PDB: 2b3i_A 2jxm_A* | Back alignment and structure |
|---|
| >1plc_A Plastocyanin; electron transport; 1.33A {Populus nigra} SCOP: b.6.1.1 PDB: 1pnc_A 1pnd_A 1tkw_A* 2pcy_A 3pcy_A 4pcy_A 5pcy_A 6pcy_A 1jxg_A 1ag6_A 1ylb_B 2pcf_A* 1oow_A 1tef_A 9pcy_A 1teg_A 1byo_A | Back alignment and structure |
|---|
| >3sqr_A Laccase; multicopper oxidase, glycosylation, oxidoreductase; HET: NAG BMA MAN; 1.67A {Botrytis aclada} | Back alignment and structure |
|---|
| >3erx_A Pseudoazurin; copper protein, high-resolution, E transport, metal-binding, transport; 1.25A {Paracoccus pantotrophus} SCOP: b.6.1.1 PDB: 1adw_A | Back alignment and structure |
|---|
| >2zoo_A Probable nitrite reductase; electron transfer, electron transport, heme, iron, binding, oxidoreductase, transport; HET: SUC HEM; 1.95A {Pseudoalteromonas haloplanktis} | Back alignment and structure |
|---|
| >1kdj_A Plastocyanin; electron transfer, photosystem, PAI-PAI stacking; 1.70A {Adiantum capillus-veneris} SCOP: b.6.1.1 PDB: 1kdi_A 2bz7_A 2bzc_A | Back alignment and structure |
|---|
| >3tu6_A Pseudoazurin (blue copper protein); cupredoxins, beta barrel, electron transfer, redox, electron transport; 2.00A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3ef4_A Pseudoazurin, blue copper protein; electron transfer, electron transport; HET: PO4; 1.18A {Hyphomicrobium denitrificans} SCOP: b.6.1.0 | Back alignment and structure |
|---|
| >3c75_A Amicyanin; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} | Back alignment and structure |
|---|
| >1mzy_A Copper-containing nitrite reductase; mutant M182T, gating mechanism, electron oxidoreductase; 1.46A {Rhodobacter sphaeroides} SCOP: b.6.1.3 b.6.1.3 PDB: 1mzz_A 1n70_A 1zv2_A 2a3t_A 2dws_A 2dwt_A 2dy2_A | Back alignment and structure |
|---|
| >2bw4_A Copper-containing nitrite reductase; oxidoreductase, denitrification, catalysis, enzyme mechanism, nitrate assimilation; 0.90A {Achromobacter cycloclastes} SCOP: b.6.1.3 b.6.1.3 PDB: 1nib_A 1nia_A 1nid_A 1nie_A 1nic_A 1nif_A 2bw5_A 2bwd_A 2bwi_A 2nrd_A 2y1a_A 1kcb_A 1rzp_A* 1rzq_A 2avf_A 1as6_A 1aq8_A 1as7_A 1as8_A 2afn_A ... | Back alignment and structure |
|---|
| >2uxt_A Protein SUFI, SUFI; oxidoreductase, periplasmic, cupredoxin-like, FTS mutant suppressor; 1.90A {Escherichia coli} PDB: 2uxv_A | Back alignment and structure |
|---|
| >1iuz_A Plastocyanin; electron transport; 1.60A {Ulva pertusa} SCOP: b.6.1.1 PDB: 7pcy_A | Back alignment and structure |
|---|
| >3aw5_A Multicopper oxidase; beta barrel, oxidoreductase; 2.00A {Pyrobaculum aerophilum} | Back alignment and structure |
|---|
| >1cuo_A Protein (azurin ISO-2); beta barrel, periplasmic, electron transport; 1.60A {Methylomonas SP} SCOP: b.6.1.1 PDB: 1uat_A | Back alignment and structure |
|---|
| >1paz_A Pseudoazurin precursor; electron transfer(cuproprotein); 1.55A {Alcaligenes faecalis} SCOP: b.6.1.1 PDB: 1pza_A 1pzb_A 1pzc_A 2p80_D 3nyk_A 3paz_A 8paz_A 4paz_A 5paz_A 6paz_A 7paz_A 1py0_A* | Back alignment and structure |
|---|
| >1id2_A Amicyanin; beta barrel, type-1 blue copper protein, electron transfer protein, electron transport; 2.15A {Paracoccus versutus} SCOP: b.6.1.1 | Back alignment and structure |
|---|
| >1pmy_A Pseudoazurin; electron transfer(cuproprotein); 1.50A {Methylobacterium extorquens} SCOP: b.6.1.1 | Back alignment and structure |
|---|
| >2ux6_A Pseudoazurin; type-1 copper, metal-binding, redox potential, copper, transport, cupredoxin, periplasmic, electron transport; 1.3A {Achromobacter cycloclastes} PDB: 2ux7_A 2uxf_A 2uxg_A 1bqk_A 1bqr_A 1zia_A 1zib_A 2jkw_A | Back alignment and structure |
|---|
| >3ay2_A Lipid modified azurin protein; beta sandwich, bacterial protein, anticancer, anti-HIV/AIDS, antiparasitic activity, antitumor protein; 1.90A {Neisseria gonorrhoeae} | Back alignment and structure |
|---|
| >1oe1_A Dissimilatory copper-containing nitrite reductase; denitrification; HET: PG4; 1.04A {Alcaligenes xylosoxidans} SCOP: b.6.1.3 b.6.1.3 PDB: 1oe3_A* 2xwz_A* 2vn3_A 2zon_A* 1haw_A 1hau_A* 2vm4_A* 2vw4_A* 2vw6_A* 2vw7_A* 2vm3_A* 1oe2_A* 2jl0_A* 2xx1_A 2xxg_A* 2xxf_A* 1gs8_A 1wa1_X* 1wa2_X* 2jl3_A* ... | Back alignment and structure |
|---|
| >1nwp_A Azurin; electron transport, cupredoxin, electron transfer; 1.60A {Pseudomonas putida} SCOP: b.6.1.1 PDB: 1nwo_A 1joi_A | Back alignment and structure |
|---|
| >2ccw_A Azurin II, AZN-2; electron transport (cuproprotein), alcaligenes xylosoxidans, electron transfer, cupredoxin, electron transport; 1.13A {Alcaligenes xylosoxydans} SCOP: b.6.1.1 PDB: 1dz0_A 1dyz_A 1aiz_A 1azb_A 1azc_A 1uri_A 2aza_A 1a4a_A 1a4b_A 1a4c_A | Back alignment and structure |
|---|
| >3sbq_A Nitrous-oxide reductase; beta-propeller, cupredoxin domain, copper-contain periplasmic, oxidoreductase; 1.70A {Pseudomonas stutzeri} PDB: 3sbp_A 3sbr_A 1qni_A | Back alignment and structure |
|---|
| >2iaa_C Azurin; quinoprotein, tryptophan tryptophylquinone, cupredoxin, electron transfer, oxidoreductase/electron transport comple; HET: TRQ; 1.95A {Alcaligenes faecalis} PDB: 2h47_C* 2h3x_C* | Back alignment and structure |
|---|
| >2cua_A Protein (CUA); CUA center, electron transport; 1.60A {Thermus thermophilus} SCOP: b.6.1.2 PDB: 2fwl_B* | Back alignment and structure |
|---|
| >3fsa_A Azurin; copper, cupredoxin fold, metal-binding, protein-protein interaction, metal binding protein; 0.98A {Pseudomonas aeruginosa} SCOP: b.6.1.1 PDB: 2xv2_A 2xv0_A 3fs9_A 2fta_A* 2hx7_A 2hx8_A 2hx9_A 2hxa_A 1cc3_A 2ft6_A 2ft7_A 2ft8_A 1azn_A 3n2j_A 2iwe_A 2ghz_A 2gi0_A 1jzg_A* 1azu_A* 1bex_A ... | Back alignment and structure |
|---|
| >3s8f_B Cytochrome C oxidase subunit 2; complex IV, respiratory chain, lipid cubic phase, monoolein, peroxide, electron transport, proton pump; HET: HEM HAS OLC; 1.80A {Thermus thermophilus} PDB: 1ehk_B* 2qpd_B* 3qjq_B* 3qjr_B* 3qju_B* 3qjv_B* 1xme_B* 3s8g_B* 4esl_B* 4ev3_B* 4f05_B* 4fa7_B* 4faa_B* 3qjs_B* 3bvd_B* 2qpe_B* 3qjt_B* 3s3b_B* 3s33_B* 3s39_B* ... | Back alignment and structure |
|---|
| >1cyx_A CYOA; electron transport; 2.30A {Escherichia coli} SCOP: b.6.1.2 PDB: 1cyw_A | Back alignment and structure |
|---|
| >4ep8_B Urease subunit beta; alpha-beta barrel, nickel metalloenzyme, hydrolase, radiatio; HET: KCX; 1.55A {Enterobacter aerogenes} PDB: 1a5l_B 1a5k_B 1a5n_B 1a5o_B 1ef2_B* 1ejr_B* 1ejs_B* 1ejt_B* 1eju_B* 1ejv_B* 1a5m_B* 1ejw_B* 1ejx_B* 4epb_B* 4epd_B* 4epe_B* 1fwa_B* 1fwb_B* 1fwc_B* 1fwd_B* ... | Back alignment and structure |
|---|
| >2gsm_B Cytochrome C oxidase subunit 2; transmembrane protein complex, oxidoreductase; HET: DMU HEA TRD; 2.00A {Rhodobacter sphaeroides} SCOP: b.6.1.2 f.17.2.1 PDB: 3dtu_B* 3fye_B* 3fyi_B* 3omi_B* 3om3_B* 3oma_B* 3omn_B* 1m56_B* 1m57_B* | Back alignment and structure |
|---|
| >4ac7_B Urease subunit beta; hydrolase, bacillus pasteurii; HET: CXM KCX FLC; 1.50A {Sporosarcina pasteurii} PDB: 1s3t_B* 3ubp_B* 1ie7_B* 4ubp_B* 1ubp_B* 2ubp_B* | Back alignment and structure |
|---|
| >4ubp_B Protein (urease (chain B)); bacillus pasteurii, nickel, acetohydroxamic acid, metalloenzyme, hydrolase; HET: KCX; 1.55A {Sporosarcina pasteurii} SCOP: b.85.3.1 PDB: 1s3t_B* 3ubp_B* 1ie7_B* 1ubp_B* 2ubp_B* | Back alignment and structure |
|---|
| >3hb3_B Cytochrome C oxidase subunit 2; electron transfer, proton transfer, proton pumping, membrane protein, cell inner membrane, cell membrane, copper; HET: HEA LDA LMT; 2.25A {Paracoccus denitrificans} PDB: 1ar1_B* 3ehb_B* 1qle_B* | Back alignment and structure |
|---|
| >1v54_B Cytochrome C oxidase polypeptide II; oxidoreductase; HET: FME TPO HEA TGL PGV CHD CDL PEK PSC DMU; 1.80A {Bos taurus} SCOP: b.6.1.2 f.17.2.1 PDB: 1oco_B* 1occ_B* 1ocz_B* 1ocr_B* 1v55_B* 2dyr_B* 2dys_B* 2eij_B* 2eik_B* 2eil_B* 2eim_B* 2ein_B* 2occ_B* 2y69_B* 2ybb_M* 2zxw_B* 3abk_B* 3abl_B* 3abm_B* 3ag1_B* ... | Back alignment and structure |
|---|
| >3isy_A Bsupi, intracellular proteinase inhibitor; intracellular proteinase inhibitor bsupi, beta sandwich, GRE structural genomics; HET: PG4; 2.61A {Bacillus subtilis} | Back alignment and structure |
|---|
| >3rfr_A PMOB; membrane, oxidoreductase; 2.68A {Methylocystis SP} PDB: 3chx_A | Back alignment and structure |
|---|
| >3qga_A UREA2, fusion of urease beta and gamma subunits; iron metalloenzyme, alpha-beta barrel, hydrolase; HET: FME KCX; 3.00A {Helicobacter mustelae} PDB: 3qgk_A* | Back alignment and structure |
|---|
| >1yew_A Particulate methane monooxygenase, B subunit; membrane protein, beta barrel, oxidoreductase; 2.80A {Methylococcus capsulatus} PDB: 3rgb_A | Back alignment and structure |
|---|
| >1xwv_A DER F II; beta sheets, allergen; HET: PE3 XPE; 1.83A {Dermatophagoides farinae} SCOP: b.1.18.7 PDB: 1ahk_A 1ahm_A 1wrf_A 2f08_A* 1a9v_A 1ktj_A | Back alignment and structure |
|---|
| >1nep_A EPV20, BNPC2, epididymal secretory protein E1; niemann-PICK C2, LDL, cholesterol, lipid bindin; HET: NAG; 1.70A {Bos taurus} SCOP: b.1.18.7 PDB: 2hka_A* | Back alignment and structure |
|---|
| >2wtp_A ORF131 protein, CZCE; metal binding protein, heavy metal, copper binding; HET: TRS; 1.50A {Ralstonia metallidurans CH34} PDB: 2wto_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 75 | ||||
| d1hfua1 | 131 | b.6.1.3 (A:1-131) Laccase {Inky cap fungus (Coprin | 9e-18 | |
| d1v10a1 | 136 | b.6.1.3 (A:1-136) Laccase {Rigidoporus lignosus [T | 5e-16 | |
| d1gyca1 | 130 | b.6.1.3 (A:1-130) Laccase {Trametes versicolor, la | 8e-16 | |
| d1aoza1 | 129 | b.6.1.3 (A:1-129) Ascorbate oxidase {Zucchini (Cuc | 2e-12 | |
| d2j5wa1 | 192 | b.6.1.3 (A:1-192) Ceruloplasmin {Human (Homo sapie | 6e-11 | |
| d1oe2a1 | 159 | b.6.1.3 (A:1-159) Nitrite reductase, NIR {Alcalige | 3e-10 | |
| d2j5wa3 | 207 | b.6.1.3 (A:347-553) Ceruloplasmin {Human (Homo sap | 9e-10 | |
| d1kbva1 | 151 | b.6.1.3 (A:13-163) Nitrite reductase, NIR {Neisser | 2e-09 | |
| d1sdda1 | 180 | b.6.1.3 (A:1-180) Coagulation factor V {Cow (Bos t | 2e-09 | |
| d2q9oa1 | 162 | b.6.1.3 (A:1-162) Laccase {Melanocarpus albomyces | 3e-09 | |
| d1mzya1 | 153 | b.6.1.3 (A:41-193) Nitrite reductase, NIR {Rhodoba | 7e-09 | |
| d1e30a_ | 153 | b.6.1.1 (A:) Rusticyanin {Thiobacillus ferrooxidan | 3e-08 | |
| d1gska1 | 181 | b.6.1.3 (A:2-182) Spore coat protein A, CotA {Baci | 3e-08 | |
| d2bw4a1 | 157 | b.6.1.3 (A:8-164) Nitrite reductase, NIR {Alcalige | 4e-08 | |
| d1kv7a1 | 140 | b.6.1.3 (A:31-170) multi-copper oxidase CueO {Esch | 3e-07 | |
| d2j5wa4 | 179 | b.6.1.3 (A:706-884) Ceruloplasmin {Human (Homo sap | 4e-07 | |
| d1sddb2 | 139 | b.6.1.3 (B:1724-1862) Coagulation factor V {Cow (B | 2e-06 | |
| d2j5wa5 | 149 | b.6.1.3 (A:892-1040) Ceruloplasmin {Human (Homo sa | 3e-06 | |
| d2j5wa2 | 145 | b.6.1.3 (A:555-699) Ceruloplasmin {Human (Homo sap | 9e-06 | |
| d1sdda2 | 116 | b.6.1.3 (A:181-296) Coagulation factor V {Cow (Bos | 1e-04 | |
| d1kcwa2 | 146 | b.6.1.3 (A:193-338) Ceruloplasmin {Human (Homo sap | 3e-04 |
| >d1hfua1 b.6.1.3 (A:1-131) Laccase {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]} Length = 131 | Back information, alignment and structure |
|---|
class: All beta proteins fold: Cupredoxin-like superfamily: Cupredoxins family: Multidomain cupredoxins domain: Laccase species: Inky cap fungus (Coprinus cinereus) [TaxId: 5346]
Score = 69.3 bits (169), Expect = 9e-18
Identities = 30/76 (39%), Positives = 45/76 (59%), Gaps = 6/76 (7%)
Query: 6 NVCEGDRVVVDVRNSMDGLEN----TIHWHGIHQRGTQYSDGVPFVTQCPITQGNTFRYQ 61
+ D ++V N +D +IHWHG+ QRGT ++DG V QCPI+ G+ F Y+
Sbjct: 37 RGGKNDNFELNVVNDLDNPTMLRPTSIHWHGLFQRGTNWADGADGVNQCPISPGHAFLYK 96
Query: 62 FTA--NAGTHFWHAHT 75
FT +AGT ++H+H
Sbjct: 97 FTPAGHAGTFWYHSHF 112
|
| >d1v10a1 b.6.1.3 (A:1-136) Laccase {Rigidoporus lignosus [TaxId: 219653]} Length = 136 | Back information, alignment and structure |
|---|
| >d1gyca1 b.6.1.3 (A:1-130) Laccase {Trametes versicolor, laccase 2 [TaxId: 5325]} Length = 130 | Back information, alignment and structure |
|---|
| >d1aoza1 b.6.1.3 (A:1-129) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]} Length = 129 | Back information, alignment and structure |
|---|
| >d2j5wa1 b.6.1.3 (A:1-192) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Length = 192 | Back information, alignment and structure |
|---|
| >d1oe2a1 b.6.1.3 (A:1-159) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Length = 159 | Back information, alignment and structure |
|---|
| >d2j5wa3 b.6.1.3 (A:347-553) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Length = 207 | Back information, alignment and structure |
|---|
| >d1kbva1 b.6.1.3 (A:13-163) Nitrite reductase, NIR {Neisseria gonorrhoeae, AniA [TaxId: 485]} Length = 151 | Back information, alignment and structure |
|---|
| >d1sdda1 b.6.1.3 (A:1-180) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Length = 180 | Back information, alignment and structure |
|---|
| >d2q9oa1 b.6.1.3 (A:1-162) Laccase {Melanocarpus albomyces [TaxId: 204285]} Length = 162 | Back information, alignment and structure |
|---|
| >d1mzya1 b.6.1.3 (A:41-193) Nitrite reductase, NIR {Rhodobacter sphaeroides [TaxId: 1063]} Length = 153 | Back information, alignment and structure |
|---|
| >d1e30a_ b.6.1.1 (A:) Rusticyanin {Thiobacillus ferrooxidans [TaxId: 920]} Length = 153 | Back information, alignment and structure |
|---|
| >d1gska1 b.6.1.3 (A:2-182) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]} Length = 181 | Back information, alignment and structure |
|---|
| >d2bw4a1 b.6.1.3 (A:8-164) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} Length = 157 | Back information, alignment and structure |
|---|
| >d1kv7a1 b.6.1.3 (A:31-170) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]} Length = 140 | Back information, alignment and structure |
|---|
| >d2j5wa4 b.6.1.3 (A:706-884) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Length = 179 | Back information, alignment and structure |
|---|
| >d1sddb2 b.6.1.3 (B:1724-1862) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Length = 139 | Back information, alignment and structure |
|---|
| >d2j5wa5 b.6.1.3 (A:892-1040) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Length = 149 | Back information, alignment and structure |
|---|
| >d2j5wa2 b.6.1.3 (A:555-699) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Length = 145 | Back information, alignment and structure |
|---|
| >d1sdda2 b.6.1.3 (A:181-296) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} Length = 116 | Back information, alignment and structure |
|---|
| >d1kcwa2 b.6.1.3 (A:193-338) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} Length = 146 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 75 | |||
| d1v10a1 | 136 | Laccase {Rigidoporus lignosus [TaxId: 219653]} | 99.97 | |
| d1hfua1 | 131 | Laccase {Inky cap fungus (Coprinus cinereus) [TaxI | 99.97 | |
| d1aoza1 | 129 | Ascorbate oxidase {Zucchini (Cucurbita pepo var. m | 99.96 | |
| d1gyca1 | 130 | Laccase {Trametes versicolor, laccase 2 [TaxId: 53 | 99.96 | |
| d1kv7a1 | 140 | multi-copper oxidase CueO {Escherichia coli [TaxId | 99.94 | |
| d2q9oa1 | 162 | Laccase {Melanocarpus albomyces [TaxId: 204285]} | 99.93 | |
| d1sdda1 | 180 | Coagulation factor V {Cow (Bos taurus) [TaxId: 991 | 99.91 | |
| d2j5wa3 | 207 | Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} | 99.91 | |
| d2bw4a1 | 157 | Nitrite reductase, NIR {Alcaligenes xylosoxidans [ | 99.9 | |
| d1oe2a1 | 159 | Nitrite reductase, NIR {Alcaligenes xylosoxidans [ | 99.9 | |
| d2j5wa1 | 192 | Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} | 99.89 | |
| d2j5wa4 | 179 | Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} | 99.88 | |
| d1kbva1 | 151 | Nitrite reductase, NIR {Neisseria gonorrhoeae, Ani | 99.88 | |
| d1mzya1 | 153 | Nitrite reductase, NIR {Rhodobacter sphaeroides [T | 99.87 | |
| d1gska1 | 181 | Spore coat protein A, CotA {Bacillus subtilis [Tax | 99.87 | |
| d1kbva2 | 151 | Nitrite reductase, NIR {Neisseria gonorrhoeae, Ani | 99.78 | |
| d1e30a_ | 153 | Rusticyanin {Thiobacillus ferrooxidans [TaxId: 920 | 99.78 | |
| d1sddb2 | 139 | Coagulation factor V {Cow (Bos taurus) [TaxId: 991 | 99.78 | |
| d2j5wa5 | 149 | Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} | 99.77 | |
| d2j5wa2 | 145 | Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} | 99.73 | |
| d1kcwa2 | 146 | Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} | 99.72 | |
| d1sdda2 | 116 | Coagulation factor V {Cow (Bos taurus) [TaxId: 991 | 99.67 | |
| d1ibya_ | 112 | Red copper protein nitrosocyanin {Nitrosomonas eur | 99.61 | |
| d1fwxa1 | 132 | Nitrous oxide reductase, C-terminal domain {Paraco | 99.58 | |
| d2bw4a2 | 173 | Nitrite reductase, NIR {Alcaligenes xylosoxidans [ | 99.35 | |
| d1aoza3 | 214 | Ascorbate oxidase {Zucchini (Cucurbita pepo var. m | 99.3 | |
| d1kv7a3 | 181 | multi-copper oxidase CueO {Escherichia coli [TaxId | 99.28 | |
| d1hfua3 | 200 | Laccase {Inky cap fungus (Coprinus cinereus) [TaxI | 99.25 | |
| d1gska3 | 154 | Spore coat protein A, CotA {Bacillus subtilis [Tax | 99.23 | |
| d1oe1a2 | 177 | Nitrite reductase, NIR {Alcaligenes xylosoxidans [ | 99.23 | |
| d1qnia1 | 131 | Nitrous oxide reductase, C-terminal domain {Pseudo | 99.23 | |
| d1v10a3 | 190 | Laccase {Rigidoporus lignosus [TaxId: 219653]} | 99.14 | |
| d1qhqa_ | 139 | Auracyanin {Chloroflexus aurantiacus [TaxId: 1108] | 99.12 | |
| d1gyca3 | 199 | Laccase {Trametes versicolor, laccase 2 [TaxId: 53 | 99.1 | |
| d1sddb1 | 67 | Coagulation factor V {Cow (Bos taurus) [TaxId: 991 | 98.96 | |
| d2q9oa3 | 216 | Laccase {Melanocarpus albomyces [TaxId: 204285]} | 98.85 | |
| d2plta_ | 98 | Plastocyanin {Green alga (Chlamydomonas reinhardti | 98.67 | |
| d2ov0a1 | 105 | Amicyanin {Paracoccus denitrificans [TaxId: 266]} | 98.64 | |
| d2q5ba1 | 105 | Plastocyanin {Cyanobacterium (Phormidium laminosum | 98.56 | |
| d1pcsa_ | 98 | Plastocyanin {Cyanobacterium (Synechocystis sp.), | 98.56 | |
| d1plca_ | 99 | Plastocyanin {Poplar (Populus nigra), variant ital | 98.51 | |
| d1bypa_ | 99 | Plastocyanin {White campion (Silene pratensis) [Ta | 98.46 | |
| d1v10a2 | 168 | Laccase {Rigidoporus lignosus [TaxId: 219653]} | 98.37 | |
| d1bxua_ | 91 | Plastocyanin {Cyanobacterium (Synechocystis sp.), | 98.36 | |
| d2q9oa2 | 181 | Laccase {Melanocarpus albomyces [TaxId: 204285]} | 98.31 | |
| d1kdja_ | 102 | Plastocyanin {Fern (Adiantum capillus-veneris) [Ta | 98.31 | |
| d2jxma1 | 97 | Plastocyanin {Photosynthetic prokaryote (Prochloro | 98.28 | |
| d1gyca2 | 170 | Laccase {Trametes versicolor, laccase 2 [TaxId: 53 | 98.28 | |
| d2cj3a1 | 105 | Plastocyanin {Anabaena variabilis [TaxId: 1172]} | 98.27 | |
| d1hfua2 | 172 | Laccase {Inky cap fungus (Coprinus cinereus) [TaxI | 98.27 | |
| d2cuaa_ | 122 | Cytochrome c oxidase {Thermus thermophilus, ba3 ty | 98.26 | |
| d1id2a_ | 106 | Amicyanin {Paracoccus versutus (Thiobacillus versu | 98.23 | |
| d1aoza2 | 209 | Ascorbate oxidase {Zucchini (Cucurbita pepo var. m | 98.23 | |
| d2ccwa1 | 129 | Azurin {Alcaligenes xylosoxidans, NCIMB (11015), d | 98.22 | |
| d1iuza_ | 98 | Plastocyanin {Ulva pertusa, a sea lettuce [TaxId: | 98.19 | |
| d1cuoa_ | 129 | Azurin {Methylomonas sp. j [TaxId: 32038]} | 98.06 | |
| d1pmya_ | 123 | Pseudoazurin {Methylobacterium extorquens, strain | 98.02 | |
| d1nwpa_ | 128 | Azurin {Pseudomonas putida [TaxId: 303]} | 98.01 | |
| d1jzga_ | 128 | Azurin {Pseudomonas aeruginosa [TaxId: 287]} | 98.01 | |
| d1mzya2 | 178 | Nitrite reductase, NIR {Rhodobacter sphaeroides [T | 97.87 | |
| d1paza_ | 120 | Pseudoazurin {Alcaligenes faecalis, strain s-6 [Ta | 97.86 | |
| d1bqka_ | 124 | Pseudoazurin {Achromobacter cycloclastes [TaxId: 2 | 97.78 | |
| d1adwa_ | 123 | Pseudoazurin {Thiosphaera pantotropha [TaxId: 8236 | 97.74 | |
| d1kv7a2 | 165 | multi-copper oxidase CueO {Escherichia coli [TaxId | 95.84 | |
| d1gska2 | 174 | Spore coat protein A, CotA {Bacillus subtilis [Tax | 95.7 | |
| d1cyxa_ | 158 | Quinol oxidase (CyoA) {Escherichia coli [TaxId: 56 | 94.2 | |
| d1ejxb_ | 101 | Urease, beta-subunit {Klebsiella aerogenes [TaxId: | 91.88 | |
| d2nqda1 | 108 | Chagasin {Trypanosoma cruzi [TaxId: 5693]} | 89.63 | |
| d4ubpb_ | 122 | Urease, beta-subunit {Bacillus pasteurii [TaxId: 1 | 89.45 | |
| d1xvsa_ | 124 | ApaG {Vibrio cholerae [TaxId: 666]} | 85.71 | |
| d1nepa_ | 130 | Epididymal secretory protein E1 (Niemann-Pick C2 p | 85.4 | |
| d1e9ya1 | 133 | Urease, beta-subunit {Helicobacter pylori [TaxId: | 84.97 | |
| d1w8oa1 | 103 | Sialidase, "linker" domain {Micromonospora viridif | 83.27 | |
| d1xwva_ | 129 | Major mite allergen {House-dust mite (Dermatophago | 82.38 | |
| d1tzaa_ | 132 | ApaG {Shewanella oneidensis [TaxId: 70863]} | 82.33 | |
| d2vzsa2 | 122 | Exochitosanase CsxA, domains 2, 4 and 5 {Amycolato | 80.07 |
| >d1v10a1 b.6.1.3 (A:1-136) Laccase {Rigidoporus lignosus [TaxId: 219653]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Cupredoxin-like superfamily: Cupredoxins family: Multidomain cupredoxins domain: Laccase species: Rigidoporus lignosus [TaxId: 219653]
Probab=99.97 E-value=2.4e-31 Score=157.56 Aligned_cols=75 Identities=36% Similarity=0.667 Sum_probs=68.8
Q ss_pred CcccEEEecCCEEEEEEEeCCCC----CCceEEeCCccccCCCCCCCCCcccccccCCCCEEEEEEc--CCCeeeEEccC
Q psy88 1 MLYPKNVCEGDRVVVDVRNSMDG----LENTIHWHGIHQRGTQYSDGVPFVTQCPITQGNTFRYQFT--ANAGTHFWHAH 74 (75)
Q Consensus 1 ~~~~i~~~~Gd~v~i~~~N~~~~----~~~~iH~HG~~~~~~~~~DG~~~~~~~~i~pG~~~~y~~~--~~~Gt~~YH~H 74 (75)
++++||+++||+|+|+|+|+++. ++++|||||+.+...++.||+++++||+|+||++++|+|+ +++||||||||
T Consensus 32 PGP~i~~~~GD~v~v~~~N~l~~~~~~~~tsiH~HGl~~~~~~~~dgv~~~t~~~I~PG~~~~Y~~~~~~~~Gt~wYH~H 111 (136)
T d1v10a1 32 IAPLITGNIDDRFQINVIDQLTDANMRRATSIHWHGFFQAGTTEMDGPAFVNQCPIIPNESFVYDFVVPGQAGTYWYHSH 111 (136)
T ss_dssp SCCCEEEETTCEEEEEEEECCCCTTSCCCBCEEEETCCCTTCGGGSCCBTTTBCCBCTTEEEEEEEECTTCCEEEEEEEC
T ss_pred cCCeEEEECCcEEEEEEEeCCCCcccCcceeEEecccccccccccCCCCccccceECCCCeEEEEEECCCCccceEEecC
Confidence 46899999999999999998752 5899999999998888899999999999999999999998 67999999999
Q ss_pred C
Q psy88 75 T 75 (75)
Q Consensus 75 ~ 75 (75)
+
T Consensus 112 ~ 112 (136)
T d1v10a1 112 L 112 (136)
T ss_dssp S
T ss_pred c
Confidence 5
|
| >d1hfua1 b.6.1.3 (A:1-131) Laccase {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]} | Back information, alignment and structure |
|---|
| >d1aoza1 b.6.1.3 (A:1-129) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]} | Back information, alignment and structure |
|---|
| >d1gyca1 b.6.1.3 (A:1-130) Laccase {Trametes versicolor, laccase 2 [TaxId: 5325]} | Back information, alignment and structure |
|---|
| >d1kv7a1 b.6.1.3 (A:31-170) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2q9oa1 b.6.1.3 (A:1-162) Laccase {Melanocarpus albomyces [TaxId: 204285]} | Back information, alignment and structure |
|---|
| >d1sdda1 b.6.1.3 (A:1-180) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2j5wa3 b.6.1.3 (A:347-553) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2bw4a1 b.6.1.3 (A:8-164) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} | Back information, alignment and structure |
|---|
| >d1oe2a1 b.6.1.3 (A:1-159) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} | Back information, alignment and structure |
|---|
| >d2j5wa1 b.6.1.3 (A:1-192) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2j5wa4 b.6.1.3 (A:706-884) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kbva1 b.6.1.3 (A:13-163) Nitrite reductase, NIR {Neisseria gonorrhoeae, AniA [TaxId: 485]} | Back information, alignment and structure |
|---|
| >d1mzya1 b.6.1.3 (A:41-193) Nitrite reductase, NIR {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d1gska1 b.6.1.3 (A:2-182) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1kbva2 b.6.1.3 (A:164-314) Nitrite reductase, NIR {Neisseria gonorrhoeae, AniA [TaxId: 485]} | Back information, alignment and structure |
|---|
| >d1e30a_ b.6.1.1 (A:) Rusticyanin {Thiobacillus ferrooxidans [TaxId: 920]} | Back information, alignment and structure |
|---|
| >d1sddb2 b.6.1.3 (B:1724-1862) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2j5wa5 b.6.1.3 (A:892-1040) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2j5wa2 b.6.1.3 (A:555-699) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kcwa2 b.6.1.3 (A:193-338) Ceruloplasmin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sdda2 b.6.1.3 (A:181-296) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1ibya_ b.6.1.4 (A:) Red copper protein nitrosocyanin {Nitrosomonas europaea [TaxId: 915]} | Back information, alignment and structure |
|---|
| >d1fwxa1 b.6.1.4 (A:452-581) Nitrous oxide reductase, C-terminal domain {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d2bw4a2 b.6.1.3 (A:166-338) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} | Back information, alignment and structure |
|---|
| >d1aoza3 b.6.1.3 (A:339-552) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]} | Back information, alignment and structure |
|---|
| >d1kv7a3 b.6.1.3 (A:336-516) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1hfua3 b.6.1.3 (A:304-503) Laccase {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]} | Back information, alignment and structure |
|---|
| >d1gska3 b.6.1.3 (A:357-510) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1oe1a2 b.6.1.3 (A:160-336) Nitrite reductase, NIR {Alcaligenes xylosoxidans [TaxId: 85698]} | Back information, alignment and structure |
|---|
| >d1qnia1 b.6.1.4 (A:451-581) Nitrous oxide reductase, C-terminal domain {Pseudomonas nautica [TaxId: 2743]} | Back information, alignment and structure |
|---|
| >d1v10a3 b.6.1.3 (A:305-494) Laccase {Rigidoporus lignosus [TaxId: 219653]} | Back information, alignment and structure |
|---|
| >d1qhqa_ b.6.1.1 (A:) Auracyanin {Chloroflexus aurantiacus [TaxId: 1108]} | Back information, alignment and structure |
|---|
| >d1gyca3 b.6.1.3 (A:301-499) Laccase {Trametes versicolor, laccase 2 [TaxId: 5325]} | Back information, alignment and structure |
|---|
| >d1sddb1 b.6.1.3 (B:1657-1723) Coagulation factor V {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2q9oa3 b.6.1.3 (A:344-559) Laccase {Melanocarpus albomyces [TaxId: 204285]} | Back information, alignment and structure |
|---|
| >d2plta_ b.6.1.1 (A:) Plastocyanin {Green alga (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d2ov0a1 b.6.1.1 (A:1-105) Amicyanin {Paracoccus denitrificans [TaxId: 266]} | Back information, alignment and structure |
|---|
| >d2q5ba1 b.6.1.1 (A:1-105) Plastocyanin {Cyanobacterium (Phormidium laminosum) [TaxId: 32059]} | Back information, alignment and structure |
|---|
| >d1pcsa_ b.6.1.1 (A:) Plastocyanin {Cyanobacterium (Synechocystis sp.), pcc 6803 [TaxId: 1143]} | Back information, alignment and structure |
|---|
| >d1plca_ b.6.1.1 (A:) Plastocyanin {Poplar (Populus nigra), variant italica [TaxId: 3691]} | Back information, alignment and structure |
|---|
| >d1bypa_ b.6.1.1 (A:) Plastocyanin {White campion (Silene pratensis) [TaxId: 52853]} | Back information, alignment and structure |
|---|
| >d1v10a2 b.6.1.3 (A:137-304) Laccase {Rigidoporus lignosus [TaxId: 219653]} | Back information, alignment and structure |
|---|
| >d1bxua_ b.6.1.1 (A:) Plastocyanin {Cyanobacterium (Synechocystis sp.), pcc 7942 [TaxId: 1143]} | Back information, alignment and structure |
|---|
| >d2q9oa2 b.6.1.3 (A:163-343) Laccase {Melanocarpus albomyces [TaxId: 204285]} | Back information, alignment and structure |
|---|
| >d1kdja_ b.6.1.1 (A:) Plastocyanin {Fern (Adiantum capillus-veneris) [TaxId: 13818]} | Back information, alignment and structure |
|---|
| >d2jxma1 b.6.1.1 (A:1-97) Plastocyanin {Photosynthetic prokaryote (Prochlorothrix hollandica) [TaxId: 1223]} | Back information, alignment and structure |
|---|
| >d1gyca2 b.6.1.3 (A:131-300) Laccase {Trametes versicolor, laccase 2 [TaxId: 5325]} | Back information, alignment and structure |
|---|
| >d2cj3a1 b.6.1.1 (A:1-105) Plastocyanin {Anabaena variabilis [TaxId: 1172]} | Back information, alignment and structure |
|---|
| >d1hfua2 b.6.1.3 (A:132-303) Laccase {Inky cap fungus (Coprinus cinereus) [TaxId: 5346]} | Back information, alignment and structure |
|---|
| >d2cuaa_ b.6.1.2 (A:) Cytochrome c oxidase {Thermus thermophilus, ba3 type [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1id2a_ b.6.1.1 (A:) Amicyanin {Paracoccus versutus (Thiobacillus versutus) [TaxId: 34007]} | Back information, alignment and structure |
|---|
| >d1aoza2 b.6.1.3 (A:130-338) Ascorbate oxidase {Zucchini (Cucurbita pepo var. medullosa) [TaxId: 3663]} | Back information, alignment and structure |
|---|
| >d2ccwa1 b.6.1.1 (A:1-129) Azurin {Alcaligenes xylosoxidans, NCIMB (11015), different isoforms [TaxId: 85698]} | Back information, alignment and structure |
|---|
| >d1iuza_ b.6.1.1 (A:) Plastocyanin {Ulva pertusa, a sea lettuce [TaxId: 3120]} | Back information, alignment and structure |
|---|
| >d1cuoa_ b.6.1.1 (A:) Azurin {Methylomonas sp. j [TaxId: 32038]} | Back information, alignment and structure |
|---|
| >d1pmya_ b.6.1.1 (A:) Pseudoazurin {Methylobacterium extorquens, strain am1 [TaxId: 408]} | Back information, alignment and structure |
|---|
| >d1nwpa_ b.6.1.1 (A:) Azurin {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1jzga_ b.6.1.1 (A:) Azurin {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1mzya2 b.6.1.3 (A:194-371) Nitrite reductase, NIR {Rhodobacter sphaeroides [TaxId: 1063]} | Back information, alignment and structure |
|---|
| >d1paza_ b.6.1.1 (A:) Pseudoazurin {Alcaligenes faecalis, strain s-6 [TaxId: 511]} | Back information, alignment and structure |
|---|
| >d1bqka_ b.6.1.1 (A:) Pseudoazurin {Achromobacter cycloclastes [TaxId: 223]} | Back information, alignment and structure |
|---|
| >d1adwa_ b.6.1.1 (A:) Pseudoazurin {Thiosphaera pantotropha [TaxId: 82367]} | Back information, alignment and structure |
|---|
| >d1kv7a2 b.6.1.3 (A:171-335) multi-copper oxidase CueO {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1gska2 b.6.1.3 (A:183-356) Spore coat protein A, CotA {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1cyxa_ b.6.1.2 (A:) Quinol oxidase (CyoA) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1ejxb_ b.85.3.1 (B:) Urease, beta-subunit {Klebsiella aerogenes [TaxId: 28451]} | Back information, alignment and structure |
|---|
| >d2nqda1 b.1.26.1 (A:3-110) Chagasin {Trypanosoma cruzi [TaxId: 5693]} | Back information, alignment and structure |
|---|
| >d4ubpb_ b.85.3.1 (B:) Urease, beta-subunit {Bacillus pasteurii [TaxId: 1474]} | Back information, alignment and structure |
|---|
| >d1xvsa_ b.1.23.1 (A:) ApaG {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d1nepa_ b.1.18.7 (A:) Epididymal secretory protein E1 (Niemann-Pick C2 protein) {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1e9ya1 b.85.3.1 (A:106-238) Urease, beta-subunit {Helicobacter pylori [TaxId: 210]} | Back information, alignment and structure |
|---|
| >d1w8oa1 b.1.18.2 (A:403-505) Sialidase, "linker" domain {Micromonospora viridifaciens [TaxId: 1881]} | Back information, alignment and structure |
|---|
| >d1xwva_ b.1.18.7 (A:) Major mite allergen {House-dust mite (Dermatophagoides farinae), Der f 2 [TaxId: 6954]} | Back information, alignment and structure |
|---|
| >d1tzaa_ b.1.23.1 (A:) ApaG {Shewanella oneidensis [TaxId: 70863]} | Back information, alignment and structure |
|---|
| >d2vzsa2 b.1.4.1 (A:778-899) Exochitosanase CsxA, domains 2, 4 and 5 {Amycolatopsis orientalis [TaxId: 31958]} | Back information, alignment and structure |
|---|