Psyllid ID: psy8923


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270---
MVGFEPGTFCMASKSESVTIGLTEHLSIVNNNLEKLFGELTELQCLRTLNLRYNKIKNSGIPVDLFHLEDLTTLDLSHNNIKQIPDALENAKRTKATLDKRACSAIHAVNLRNFLAAECRTIREEQGDESEEFLSLFNTGISYIEGGRTASGFFTVEDTVYTTRLYRVHAPLHQAQASSIHLEPVPVLSESLDPRFVFLLDAGLKLFIWNGPKAKNTFVFLLDAGLKLFIWNGPKAKNTFVFLLDAGLKLFIWNGPKAKNTFKSKTRLLAEKI
cccccccccccccccccccccEEEEEEEEcccccccccccccccEEEEEEEEcccccccccccccccccccEEEEcccccccccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHccccEEEEcccccccHHHHHHcccccEEEcccccccccccccccccccEEEEEEcccccccccEEEEEEEEcccccccccEEEEEEcccEEEEEEccccccHHHHHHHHHHHHHHHccccccccEEEEEEcccccEEEEccccccccccccccccccc
ccccccccEEEEEccccccccccccHEEEcccHHHcccccccccccEEEEEEEEccEEccccHHHcccccEEEEEEEEcccccccEEEEEEEcccccHHHHHHHHHHHHHHHHHHccccEEEEEEcccccHHHHHHHccccEEEccccccccccccccccccccEEEEEEEEcccccEEEEEEEEcccHHHcccccEEEEEcccEEEEEEcccccHHHHHHHHHHHHHHHHcccccccEEEEEEcccccHHHHHHccccccccccHHHHcccc
mvgfepgtfcmasksesvtiGLTEHLSIVNNNLEKLFGELTELQCLRTLNLRYNkiknsgipvdlfhledlttldlshnnIKQIPDALENAKRTKATLDKRACSAIHAVNLRNFLAAECRTIREEQGDESEEFLSLFNTGIsyieggrtasgfftvedtvyttrlyrvhaplhqaqassihlepvpvlsesldpRFVFLLDAGLKLfiwngpkakNTFVFLLDAGLKLfiwngpkakNTFVFLLDAGLKLFiwngpkakntfKSKTRLLAEKI
MVGFEPGTFCMASKSESVTIGLTEHLSIVNNNLEKLFGELTELQCLRTLNLRYNKIKNSGIPVDLFHLEDLTTLDLSHNNIKQIPDALENAKRTKATLDKRACSAIHAVNLRNFLAAECRTIReeqgdeseEFLSLFNTGISYIEGGRTASGFFTVEDTVYTTRLYRVHAPLHQAQASSIHLEPVPVLSESLDPRFVFLLDAGLKLFIWNGPKAKNTFVFLLDAGLKLFIWNGPKAKNTFVFLLDAGLKLFiwngpkakntfksktrllaeki
MVGFEPGTFCMASKSESVTIGLTEHLSIVNNNLEKLFGELTELQCLRTLNLRYNKIKNSGIPVDLFHLEDLTTLDLSHNNIKQIPDALENAKRTKATLDKRACSAIHAVNLRNFLAAECRTIREEQGDESEEFLSLFNTGISYIEGGRTASGFFTVEDTVYTTRLYRVHAPLHQAQASSIHLEPVPVLSESLDPRFVFLLDAGLKLFIWNGPKAKNTFVFLLDAGLKLFIWNGPKAKNTFVFLLDAGLKLFIWNGPKAKNTFKSKTRLLAEKI
********FCMA***ESVTIGLTEHLSIVNNNLEKLFGELTELQCLRTLNLRYNKIKNSGIPVDLFHLEDLTTLDLSHNNIKQIPDALENAKRTKATLDKRACSAIHAVNLRNFLAAECRTIRE******EEFLSLFNTGISYIEGGRTASGFFTVEDTVYTTRLYRVHAPLHQAQASSIHLEPVPVLSESLDPRFVFLLDAGLKLFIWNGPKAKNTFVFLLDAGLKLFIWNGPKAKNTFVFLLDAGLKLFIWNGP*****************
**GFE*GTFCMASKSESVTIGLTEHLSIVNNNLEKLFGELTELQCLRTLNLRYNKIKNSGIPVDLFHLEDLTTLDLSHNNIKQIPDALENAKRTKATLDKRACSAIHAVNLRNFLAAECRT*********EEFLSLFNTGISYIEGGRTASGFFTVEDTVYTTRLYRVHAPLHQAQASSIHLEPVPVLSESLDPRFVFLLDAGLKLFIWNGPKAKNTFVFLLD***************TFVFLLDAGLKLFIWNG***********R******
MVGFEPGTFCMASKSESVTIGLTEHLSIVNNNLEKLFGELTELQCLRTLNLRYNKIKNSGIPVDLFHLEDLTTLDLSHNNIKQIPDALENAKRTKATLDKRACSAIHAVNLRNFLAAECRTIREEQGDESEEFLSLFNTGISYIEGGRTASGFFTVEDTVYTTRLYRVHAPLHQAQASSIHLEPVPVLSESLDPRFVFLLDAGLKLFIWNGPKAKNTFVFLLDAGLKLFIWNGPKAKNTFVFLLDAGLKLFIWNGPKAKNTFKSKTRLLAEKI
**GFEPGTFCMASKSESVTIGLTEHLSIVNNNLEKLFGELTELQCLRTLNLRYNKIKNSGIPVDLFHLEDLTTLDLSHNNIKQIPDALENAKRTKATLDKRACSAIHAVNLRNFLAAECRTIREEQGDESEEFLSLFNTGISYIEGGRTASGFFTV**TVYTTRLYRVHAPLHQAQASSIHLEPVPVLSESLDPRFVFLLDAGLKLFIWNGPKAKNTFVFLLDAGLKLFIWNGPKAKNTFVFLLDAGLKLFIWNGPKAKN*************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVGFEPGTFCMASKSESVTIGLTEHLSIVNNNLEKLFGELTELQCLRTLNLRYNKIKNSGIPVDLFHLEDLTTLDLSHNNIKQIPDALENAKRTKATLDKRACSAIHAVNLRNFLAAECRTIREEQGDESEEFLSLFNTGISYIEGGRTASGFFTVEDTVYTTRLYRVHAPLHQAQASSIHLEPVPVLSESLDPRFVFLLDAGLKLFIWNGPKAKNTFVFLLDAGLKLFIWNGPKAKNTFVFLLDAGLKLFIWNGPKAKNTFKSKTRLLAEKI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query273 2.2.26 [Sep-21-2011]
Q9JJ28 1271 Protein flightless-1 homo yes N/A 0.413 0.088 0.666 4e-41
Q13045 1269 Protein flightless-1 homo yes N/A 0.413 0.089 0.666 6e-41
Q24020 1256 Protein flightless-1 OS=D yes N/A 0.435 0.094 0.629 9e-41
P34268 1257 Protein flightless-1 homo yes N/A 0.428 0.093 0.565 5e-33
Q7JQD3367 Gelsolin-like protein 1 O N/A N/A 0.501 0.373 0.351 5e-13
O81644 976 Villin-2 OS=Arabidopsis t yes N/A 0.395 0.110 0.382 1e-10
O88398 819 Advillin OS=Mus musculus no N/A 0.413 0.137 0.344 7e-10
O75366 819 Advillin OS=Homo sapiens no N/A 0.413 0.137 0.344 2e-09
Q9WU06 829 Advillin OS=Rattus norveg no N/A 0.413 0.136 0.344 3e-09
O93510 778 Gelsolin OS=Gallus gallus no N/A 0.402 0.141 0.338 4e-09
>sp|Q9JJ28|FLII_MOUSE Protein flightless-1 homolog OS=Mus musculus GN=Flii PE=1 SV=1 Back     alignment and function desciption
 Score =  168 bits (425), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 80/120 (66%), Positives = 95/120 (79%), Gaps = 7/120 (5%)

Query: 95  KATLDKRACSAIHAVNLRNFLAAECRTIREEQGDESEEFLSLFNTGISYIEGGRTASGFF 154
           +ATLDK+ACSAIHAVNLRN+L AECRT+REE GDESEEFL +F+  ISYIEGG TASGF+
Sbjct: 552 EATLDKKACSAIHAVNLRNYLGAECRTVREEMGDESEEFLQVFDNDISYIEGG-TASGFY 610

Query: 155 TVEDTVYTTRLYRVHAPLHQAQASSIHLEPVPVLSESLDPRFVFLLDAGLKLFIWNGPKA 214
           TVEDT Y TR+YRV+         +I LEPVP+   SLDPRFVFLLD GL +++W G +A
Sbjct: 611 TVEDTHYVTRMYRVYG------KKNIKLEPVPLKGSSLDPRFVFLLDQGLDIYVWRGAQA 664




May play a role as coactivator in transcriptional activation by hormone-activated nuclear receptors (NR) and acts in cooperation with NCOA2 and CARM1. Involved in estrogen hormone signaling (By similarity). Essential for early embryonic development. May play a role in regulation of cytoskeletal rearrangements involved in cytokinesis and cell migration.
Mus musculus (taxid: 10090)
>sp|Q13045|FLII_HUMAN Protein flightless-1 homolog OS=Homo sapiens GN=FLII PE=1 SV=2 Back     alignment and function description
>sp|Q24020|FLII_DROME Protein flightless-1 OS=Drosophila melanogaster GN=fliI PE=2 SV=1 Back     alignment and function description
>sp|P34268|FLII_CAEEL Protein flightless-1 homolog OS=Caenorhabditis elegans GN=fli-1 PE=2 SV=2 Back     alignment and function description
>sp|Q7JQD3|GELS1_LUMTE Gelsolin-like protein 1 OS=Lumbricus terrestris GN=AM PE=1 SV=1 Back     alignment and function description
>sp|O81644|VILI2_ARATH Villin-2 OS=Arabidopsis thaliana GN=VLN2 PE=1 SV=2 Back     alignment and function description
>sp|O88398|AVIL_MOUSE Advillin OS=Mus musculus GN=Avil PE=1 SV=2 Back     alignment and function description
>sp|O75366|AVIL_HUMAN Advillin OS=Homo sapiens GN=AVIL PE=1 SV=3 Back     alignment and function description
>sp|Q9WU06|AVIL_RAT Advillin OS=Rattus norvegicus GN=Avil PE=2 SV=1 Back     alignment and function description
>sp|O93510|GELS_CHICK Gelsolin OS=Gallus gallus GN=GSN PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query273
322792403 1241 hypothetical protein SINV_11551 [Solenop 0.435 0.095 0.717 2e-45
332025894 1241 Protein flightless-1 [Acromyrmex echinat 0.435 0.095 0.717 3e-45
270013772 1239 hypothetical protein TcasGA2_TC012416 [T 0.435 0.096 0.701 3e-45
189240920 1238 PREDICTED: similar to flightless-1 [Trib 0.435 0.096 0.701 3e-45
350411026 1239 PREDICTED: protein flightless-1-like [Bo 0.435 0.096 0.717 6e-45
307204876 1256 Protein flightless-1 [Harpegnathos salta 0.435 0.094 0.709 6e-45
340714520 1239 PREDICTED: protein flightless-1-like iso 0.435 0.096 0.717 9e-45
340714522 1248 PREDICTED: protein flightless-1-like iso 0.435 0.095 0.717 9e-45
307189820 1241 Protein flightless-1 [Camponotus florida 0.435 0.095 0.709 2e-44
383863785 1239 PREDICTED: protein flightless-1-like iso 0.435 0.096 0.709 2e-44
>gi|322792403|gb|EFZ16387.1| hypothetical protein SINV_11551 [Solenopsis invicta] Back     alignment and taxonomy information
 Score =  188 bits (478), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 89/124 (71%), Positives = 104/124 (83%), Gaps = 5/124 (4%)

Query: 95  KATLDKRACSAIHAVNLRNFLAAECRTIREEQGDESEEFLSLFNTGISYIEGGRTASGFF 154
           KATLDKRAC+AIHAVNLRN+L A+CRTIREEQGDES+EFL LF++GI+YIEGGRT+SGF+
Sbjct: 552 KATLDKRACAAIHAVNLRNYLGAQCRTIREEQGDESDEFLMLFDSGITYIEGGRTSSGFY 611

Query: 155 TVEDTVYTTRLYRVHAPLHQAQASSIHLEPVPVLSESLDPRFVFLLDAGLKLFIWNGPKA 214
           TVEDT   TRLYRVHA       +SIHLEPVPV  ESLDP +VF+LD G K+F+W G KA
Sbjct: 612 TVEDTPAITRLYRVHAA-----GASIHLEPVPVCIESLDPDYVFVLDTGNKIFMWYGKKA 666

Query: 215 KNTF 218
           K+T 
Sbjct: 667 KSTL 670




Source: Solenopsis invicta

Species: Solenopsis invicta

Genus: Solenopsis

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|332025894|gb|EGI66050.1| Protein flightless-1 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|270013772|gb|EFA10220.1| hypothetical protein TcasGA2_TC012416 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|189240920|ref|XP_968304.2| PREDICTED: similar to flightless-1 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|350411026|ref|XP_003489215.1| PREDICTED: protein flightless-1-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|307204876|gb|EFN83431.1| Protein flightless-1 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|340714520|ref|XP_003395775.1| PREDICTED: protein flightless-1-like isoform 1 [Bombus terrestris] Back     alignment and taxonomy information
>gi|340714522|ref|XP_003395776.1| PREDICTED: protein flightless-1-like isoform 2 [Bombus terrestris] Back     alignment and taxonomy information
>gi|307189820|gb|EFN74092.1| Protein flightless-1 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|383863785|ref|XP_003707360.1| PREDICTED: protein flightless-1-like isoform 1 [Megachile rotundata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query273
FB|FBgn0000709 1256 fliI "flightless I" [Drosophil 0.432 0.093 0.634 4.9e-67
UNIPROTKB|J3QLG3 1258 FLII "Protein flightless-1 hom 0.413 0.089 0.666 4.5e-58
UNIPROTKB|Q13045 1269 FLII "Protein flightless-1 hom 0.413 0.089 0.666 4.8e-58
UNIPROTKB|F1N365 1268 FLII "Uncharacterized protein" 0.413 0.089 0.666 1.6e-57
UNIPROTKB|F1PUU4 1273 FLII "Uncharacterized protein" 0.413 0.088 0.666 2e-57
UNIPROTKB|J9P2Y3 1278 FLII "Uncharacterized protein" 0.413 0.088 0.666 2.1e-57
MGI|MGI:1342286 1271 Flii "flightless I homolog (Dr 0.413 0.088 0.666 4.1e-56
RGD|1307590 1270 Flii "flightless I homolog (Dr 0.413 0.088 0.658 2.4e-55
ZFIN|ZDB-GENE-071212-3 1260 flii "flightless I homolog (Dr 0.410 0.088 0.655 3e-53
UNIPROTKB|E1C6H2 1201 FLII "Uncharacterized protein" 0.413 0.094 0.683 2.6e-51
FB|FBgn0000709 fliI "flightless I" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 408 (148.7 bits), Expect = 4.9e-67, Sum P(4) = 4.9e-67
 Identities = 78/123 (63%), Positives = 96/123 (78%)

Query:    95 KATLDKRACSAIHAVNLRNFLAAECRTIREEQGDESEEFLSLFNTGISYIEGGRTASGFF 154
             +ATLDKRAC+AIHAVNLRNFL A CRT+REEQGDESE+FLSLF T + YIEGGRTA+GF+
Sbjct:   550 EATLDKRACAAIHAVNLRNFLGARCRTVREEQGDESEQFLSLFETEVIYIEGGRTATGFY 609

Query:   155 TVEDTVYTTRLYRVHAPLHQAQASSIHLEPVPVLSESLDPRFVFLLDAGLKLFIWNGPKA 214
             T+E+ ++ TRLY VHA       ++IHLEPV     SLDPR  F+LD G  ++IW G ++
Sbjct:   610 TIEEMIHITRLYLVHA-----YGATIHLEPVAPAITSLDPRHAFVLDLGTHIYIWMGERS 664

Query:   215 KNT 217
             KNT
Sbjct:   665 KNT 667


GO:0007629 "flight behavior" evidence=IMP
GO:0010004 "gastrulation involving germ band extension" evidence=IMP
GO:0003779 "actin binding" evidence=ISS;NAS
GO:0005509 "calcium ion binding" evidence=ISS;NAS
GO:0030239 "myofibril assembly" evidence=IMP
GO:0007527 "adult somatic muscle development" evidence=IMP
UNIPROTKB|J3QLG3 FLII "Protein flightless-1 homolog" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q13045 FLII "Protein flightless-1 homolog" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1N365 FLII "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PUU4 FLII "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|J9P2Y3 FLII "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1342286 Flii "flightless I homolog (Drosophila)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1307590 Flii "flightless I homolog (Drosophila)" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-071212-3 flii "flightless I homolog (Drosophila)" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1C6H2 FLII "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9JJ28FLII_MOUSENo assigned EC number0.66660.41390.0889yesN/A
Q24020FLII_DROMENo assigned EC number0.62900.43580.0947yesN/A
P34268FLII_CAEELNo assigned EC number0.56550.42850.0930yesN/A
Q13045FLII_HUMANNo assigned EC number0.66660.41390.0890yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query273
cd11290113 cd11290, gelsolin_S1_like, Gelsolin sub-domain 1-l 2e-23
cd1128088 cd11280, gelsolin_like, Tandemly repeated domains 4e-09
smart0026290 smart00262, GEL, Gelsolin homology domain 5e-06
pfam0062676 pfam00626, Gelsolin, Gelsolin repeat 4e-05
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 6e-05
cd1128992 cd11289, gelsolin_S2_like, Gelsolin sub-domain 2-l 7e-05
pfam1279943 pfam12799, LRR_4, Leucine Rich repeats (2 copies) 8e-05
smart0026290 smart00262, GEL, Gelsolin homology domain 1e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 2e-04
cd1128992 cd11289, gelsolin_S2_like, Gelsolin sub-domain 2-l 3e-04
smart0026290 smart00262, GEL, Gelsolin homology domain 0.001
cd1128088 cd11280, gelsolin_like, Tandemly repeated domains 0.003
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.003
cd1129298 cd11292, gelsolin_S3_like, Gelsolin sub-domain 3-l 0.003
cd1128892 cd11288, gelsolin_S5_like, Gelsolin sub-domain 5-l 0.003
>gnl|CDD|200446 cd11290, gelsolin_S1_like, Gelsolin sub-domain 1-like domain found in gelsolin, severin, villin, and related proteins Back     alignment and domain information
 Score = 91.5 bits (228), Expect = 2e-23
 Identities = 27/54 (50%), Positives = 33/54 (61%)

Query: 94  TKATLDKRACSAIHAVNLRNFLAAECRTIREEQGDESEEFLSLFNTGISYIEGG 147
            +A+ D+   +AI AV L ++L       RE QG ESEEFLS F  GI YIEGG
Sbjct: 60  KEASQDEAGAAAIKAVELDDYLGGRPVQHREVQGHESEEFLSYFKKGIIYIEGG 113


Gelsolin repeats occur in gelsolin, severin, villin, advillin, villidin, supervillin, flightless, quail, fragmin, and other proteins, usually in several copies. They co-occur with villin headpiece domains, leucine-rich repeats, and several other domains. These gelsolin-related actin binding proteins (GRABPs) play regulatory roles in the assembly and disassembly of actin filaments; they are involved in F-actin capping, uncapping, severing, or the nucleation of actin filaments. Severing of actin filaments is Ca2+ dependent. Villins are also linked to generating bundles of F-actin with uniform filament polarity, which is most likely mediated by their extra villin headpiece domain. Many family members have also adopted functions in the nucleus, including the regulation of transcription. Supervillin, gelsolin, and flightless I are involved in intracellular signaling via nuclear hormone receptors. The gelsolin_like domain is distantly related to the actin depolymerizing domains found in cofilin and similar proteins. Length = 113

>gnl|CDD|200436 cd11280, gelsolin_like, Tandemly repeated domains found in gelsolin, severin, villin, and related proteins Back     alignment and domain information
>gnl|CDD|214590 smart00262, GEL, Gelsolin homology domain Back     alignment and domain information
>gnl|CDD|201354 pfam00626, Gelsolin, Gelsolin repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|200445 cd11289, gelsolin_S2_like, Gelsolin sub-domain 2-like domain found in gelsolin, severin, villin, and related proteins Back     alignment and domain information
>gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) Back     alignment and domain information
>gnl|CDD|214590 smart00262, GEL, Gelsolin homology domain Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|200445 cd11289, gelsolin_S2_like, Gelsolin sub-domain 2-like domain found in gelsolin, severin, villin, and related proteins Back     alignment and domain information
>gnl|CDD|214590 smart00262, GEL, Gelsolin homology domain Back     alignment and domain information
>gnl|CDD|200436 cd11280, gelsolin_like, Tandemly repeated domains found in gelsolin, severin, villin, and related proteins Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>gnl|CDD|200448 cd11292, gelsolin_S3_like, Gelsolin sub-domain 3-like domain found in gelsolin, severin, villin, and related proteins Back     alignment and domain information
>gnl|CDD|200444 cd11288, gelsolin_S5_like, Gelsolin sub-domain 5-like domain found in gelsolin, severin, villin, and related proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 273
KOG0443|consensus 827 100.0
KOG0443|consensus 827 100.0
KOG0444|consensus 1255 100.0
KOG0445|consensus 919 99.6
KOG0444|consensus1255 99.58
smart0026290 GEL Gelsolin homology domain. Gelsolin/severin/vil 99.36
KOG0445|consensus 919 99.27
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 99.21
PLN03150623 hypothetical protein; Provisional 99.17
KOG0617|consensus264 99.11
PF0062676 Gelsolin: Gelsolin repeat; InterPro: IPR007123 Gel 98.95
KOG0617|consensus264 98.85
smart0026290 GEL Gelsolin homology domain. Gelsolin/severin/vil 98.85
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.77
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 98.77
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 98.75
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 98.74
PF0062676 Gelsolin: Gelsolin repeat; InterPro: IPR007123 Gel 98.72
KOG4194|consensus 873 98.69
KOG0472|consensus 565 98.64
PLN03150623 hypothetical protein; Provisional 98.58
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.56
KOG4237|consensus 498 98.55
KOG0472|consensus565 98.53
KOG4194|consensus 873 98.49
KOG4579|consensus177 98.26
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.26
KOG1259|consensus490 98.25
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 98.22
KOG4237|consensus498 98.16
KOG0532|consensus 722 98.11
KOG0618|consensus 1081 98.08
KOG0532|consensus 722 98.07
KOG0618|consensus 1081 98.03
KOG4579|consensus177 97.97
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 97.97
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 97.93
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 97.92
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 97.9
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 97.87
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 97.63
KOG1259|consensus490 97.55
PLN032101153 Resistant to P. syringae 6; Provisional 97.54
KOG1859|consensus 1096 97.43
KOG0531|consensus414 97.43
KOG1859|consensus 1096 97.41
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 97.36
KOG4658|consensus889 97.3
KOG1644|consensus233 97.16
PLN03210 1153 Resistant to P. syringae 6; Provisional 97.1
KOG0531|consensus414 97.03
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 96.99
KOG4658|consensus889 96.99
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 96.97
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 96.92
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 96.89
KOG2739|consensus260 96.84
smart0037026 LRR Leucine-rich repeats, outliers. 96.78
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 96.78
KOG1644|consensus233 96.62
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 96.15
smart0037026 LRR Leucine-rich repeats, outliers. 96.09
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 96.09
KOG2739|consensus260 96.03
PRK15386 426 type III secretion protein GogB; Provisional 96.01
KOG3207|consensus505 95.96
KOG3207|consensus505 95.34
KOG2982|consensus418 95.18
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 95.04
KOG2982|consensus418 95.03
PRK15386 426 type III secretion protein GogB; Provisional 94.95
KOG3665|consensus 699 94.78
KOG1984|consensus1007 94.77
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 94.39
KOG0473|consensus326 94.11
KOG0473|consensus326 93.63
smart0036526 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily 93.04
KOG2123|consensus388 92.75
KOG1909|consensus382 92.66
smart0036426 LRR_BAC Leucine-rich repeats, bacterial type. 92.12
COG5028861 Vesicle coat complex COPII, subunit SEC24/subunit 91.49
COG5028861 Vesicle coat complex COPII, subunit SEC24/subunit 91.41
PTZ003951560 Sec24-related protein; Provisional 89.48
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 89.23
KOG1909|consensus382 89.17
KOG3665|consensus 699 89.1
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 89.08
KOG1985|consensus887 88.83
KOG1984|consensus1007 88.69
PTZ003951560 Sec24-related protein; Provisional 87.18
COG5238 388 RNA1 Ran GTPase-activating protein (RanGAP) involv 86.83
KOG1985|consensus887 86.04
KOG2123|consensus 388 85.64
smart0036828 LRR_RI Leucine rich repeat, ribonuclease inhibitor 85.57
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 83.74
KOG2120|consensus419 81.4
>KOG0443|consensus Back     alignment and domain information
Probab=100.00  E-value=1.1e-37  Score=280.66  Aligned_cols=223  Identities=27%  Similarity=0.439  Sum_probs=187.3

Q ss_pred             cCCccCCEeeccCCcCccCCCCcccc-CC-C--CCCEEecccCCCCCccchhhhhhhcccccchhccccccccchhhhhh
Q psy8923          41 TELQCLRTLNLRYNKIKNSGIPVDLF-HL-E--DLTTLDLSHNNIKQIPDALENAKRTKATLDKRACSAIHAVNLRNFLA  116 (273)
Q Consensus        41 ~~l~~L~~L~l~~N~l~~~~ip~~~~-~l-~--~L~~L~Ls~N~l~~ip~~l~~w~g~~~~~~~~~~~~l~~~~L~~~l~  116 (273)
                      ++=+.|+...+.+=.+..  +|..-. .. +  .-..|.-..++-..+...|++|+|.+++.++.+++++.+++|++.||
T Consensus        16 g~~pGl~IWRIe~f~lv~--VP~s~~G~Fy~GdaYIvL~t~~~k~~~l~~DIHyWLGkd~S~dE~g~aAiktveLD~~Lg   93 (827)
T KOG0443|consen   16 GQKPGLEIWRIENFELVP--VPKSSHGKFYTGDAYIVLKTTLKKNGSLSYDIHYWLGKDSSQDEAGAAAIKTVELDDYLG   93 (827)
T ss_pred             ccCCceEEEEeccCeeee--cchhccCceecCceEEEEehhhccCCccceeEEEEecCccchhhhcceeeeeEehhhhhC
Confidence            344667777776666665  776432 11 1  22233333445557778899999999999999999999999999999


Q ss_pred             hhhhhcccccCCCchhhHhhccCCcEEecCCcccccceecccCcceeeEEEEecCcccCCCCceEEEEecCCCCCCCCCC
Q psy8923         117 AECRTIREEQGDESEEFLSLFNTGISYIEGGRTASGFFTVEDTVYTTRLYRVHAPLHQAQASSIHLEPVPVLSESLDPRF  196 (273)
Q Consensus       117 ~~~~~~~~~qg~e~~~fl~lf~~~i~~l~g~~~~s~~~~~~~~~~~~~L~~v~g~~~~~~~~~~~~~ev~~~~ssL~s~d  196 (273)
                      |.++|+|++||+|+..|++||+.++++.+|| ..+|++|++...+..|||||.|+      ++++++|||++|+|||.+|
T Consensus        94 g~~vQhREVQg~ES~~FLsYFK~gi~~~~GG-v~Sg~khv~~~~~~~rL~~~KGk------r~vr~~eV~~~~sS~N~gD  166 (827)
T KOG0443|consen   94 GRAVQHREVQGHESEKFLSYFKPGIIYQEGG-VASGFKHVETEEYQVRLFHCKGK------RNVRVKEVPFSWSSLNHGD  166 (827)
T ss_pred             CCcceeehhcccchHHHHhhccCCceecccc-cccCcccccccceeeEEEEEccc------eeEEEEEEEeehhhcCCCc
Confidence            9999999999999999999999999999999 99999999999988899999999      8999999999999999999


Q ss_pred             EEEEECCCeEEEEeCCCCCHHHHHHhhhhh---------------------------cccccc---C--C----------
Q psy8923         197 VFLLDAGLKLFIWNGPKAKNTFVFLLDAGL---------------------------KLFIWN---G--P----------  234 (273)
Q Consensus       197 vfild~~~~~~vW~G~~s~~~e~~~~~~~~---------------------------~~~fw~---~--~----------  234 (273)
                      |||||+++++|+|+|..|+..||.-|...+                           ..+||.   |  +          
T Consensus       167 vFILD~g~~i~qw~G~~Ss~~ER~KAl~~~~~IrD~e~~Gr~~V~vvdd~~~~~d~d~~~~~~~~~g~~~~~~~~~~~~~  246 (827)
T KOG0443|consen  167 VFILDTGSKIYQWNGPNSSIQERAKALEVVQYIRDNERDGRCEVAVVDDGKEAADSDLGEFWGFVLGFAPALPKKSPDDD  246 (827)
T ss_pred             EEEEEcCCceEEEcCCcccHHHHHHHHHHHHHhhccCCCCceeEEEecCcccccCchHHHHHHhhcCcCccCCCCCcchh
Confidence            999999999999999999999998876543                           334554   1  0          


Q ss_pred             ----------------------------------CCCCceEEEEeCC-ceEEEEeCCCcchHhHHhHHHHhhh
Q psy8923         235 ----------------------------------KAKNTFVFLLDAG-LKLFIWNGPKAKNTFKSKTRLLAEK  272 (273)
Q Consensus       235 ----------------------------------~~~~~~v~~ld~~-~~~~~w~G~~a~~~~~~~~~~~~~~  272 (273)
                                                        -..++++||||+| .+||||+|+.|+.+||+.|+..|+.
T Consensus       247 ~~~~~s~~~kLYkVsd~~g~l~v~~va~~~l~qdlLd~~dCYILD~g~~~IfVW~Gr~as~~ERkaAm~~Aee  319 (827)
T KOG0443|consen  247 DEQANSAAAKLYKVSDASGGLKVPVVADGPLTKDLLDTEDCYILDCGGGEIFVWKGRQASLDERKAAMSSAEE  319 (827)
T ss_pred             hhhhhccccEEEEEeccCCCccccccccchhhHHhhccCCeEEEecCCceEEEEeCCCCCHHHHHHHHHHHHH
Confidence                                              0123459999999 9999999999999999999998875



>KOG0443|consensus Back     alignment and domain information
>KOG0444|consensus Back     alignment and domain information
>KOG0445|consensus Back     alignment and domain information
>KOG0444|consensus Back     alignment and domain information
>smart00262 GEL Gelsolin homology domain Back     alignment and domain information
>KOG0445|consensus Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0617|consensus Back     alignment and domain information
>PF00626 Gelsolin: Gelsolin repeat; InterPro: IPR007123 Gelsolin is a cytoplasmic, calcium-regulated, actin-modulating protein that binds to the barbed ends of actin filaments, preventing monomer exchange (end-blocking or capping) [] Back     alignment and domain information
>KOG0617|consensus Back     alignment and domain information
>smart00262 GEL Gelsolin homology domain Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF00626 Gelsolin: Gelsolin repeat; InterPro: IPR007123 Gelsolin is a cytoplasmic, calcium-regulated, actin-modulating protein that binds to the barbed ends of actin filaments, preventing monomer exchange (end-blocking or capping) [] Back     alignment and domain information
>KOG4194|consensus Back     alignment and domain information
>KOG0472|consensus Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG4237|consensus Back     alignment and domain information
>KOG0472|consensus Back     alignment and domain information
>KOG4194|consensus Back     alignment and domain information
>KOG4579|consensus Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1259|consensus Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG4237|consensus Back     alignment and domain information
>KOG0532|consensus Back     alignment and domain information
>KOG0618|consensus Back     alignment and domain information
>KOG0532|consensus Back     alignment and domain information
>KOG0618|consensus Back     alignment and domain information
>KOG4579|consensus Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>KOG1259|consensus Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG1859|consensus Back     alignment and domain information
>KOG0531|consensus Back     alignment and domain information
>KOG1859|consensus Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4658|consensus Back     alignment and domain information
>KOG1644|consensus Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>KOG0531|consensus Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG4658|consensus Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG2739|consensus Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG1644|consensus Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG2739|consensus Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3207|consensus Back     alignment and domain information
>KOG3207|consensus Back     alignment and domain information
>KOG2982|consensus Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>KOG2982|consensus Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG3665|consensus Back     alignment and domain information
>KOG1984|consensus Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG0473|consensus Back     alignment and domain information
>KOG0473|consensus Back     alignment and domain information
>smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily Back     alignment and domain information
>KOG2123|consensus Back     alignment and domain information
>KOG1909|consensus Back     alignment and domain information
>smart00364 LRR_BAC Leucine-rich repeats, bacterial type Back     alignment and domain information
>COG5028 Vesicle coat complex COPII, subunit SEC24/subunit SFB2/subunit SFB3 [Intracellular trafficking and secretion] Back     alignment and domain information
>COG5028 Vesicle coat complex COPII, subunit SEC24/subunit SFB2/subunit SFB3 [Intracellular trafficking and secretion] Back     alignment and domain information
>PTZ00395 Sec24-related protein; Provisional Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG1909|consensus Back     alignment and domain information
>KOG3665|consensus Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG1985|consensus Back     alignment and domain information
>KOG1984|consensus Back     alignment and domain information
>PTZ00395 Sec24-related protein; Provisional Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG1985|consensus Back     alignment and domain information
>KOG2123|consensus Back     alignment and domain information
>smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG2120|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query273
1jhw_A 347 Ca2+-Binding Mimicry In The Crystal Structure Of Th 1e-09
1j72_A 347 Crystal Structure Of Mutant Macrophage Capping Prot 5e-09
1rgi_G 346 Crystal Structure Of Gelsolin Domains G1-G3 Bound T 1e-08
2fgh_A 731 Atp Bound Gelsolin Length = 731 2e-08
1d0n_A 729 The Crystal Structure Of Calcium-Free Equine Plasma 3e-08
3ffk_A 377 Crystal Structure Of Human Gelsolin Domains G1-G3 B 5e-08
3ffn_A 782 Crystal Structure Of Calcium-Free Human Gelsolin Le 9e-08
>pdb|1JHW|A Chain A, Ca2+-Binding Mimicry In The Crystal Structure Of The Eu3+-Bound Mutant Human Macrophage Capping Protein Cap G Length = 347 Back     alignment and structure

Iteration: 1

Score = 60.1 bits (144), Expect = 1e-09, Method: Compositional matrix adjust. Identities = 40/121 (33%), Positives = 61/121 (50%), Gaps = 8/121 (6%) Query: 95 KATLDKRACSAIHAVNLRNFLAAECRTIREEQGDESEEFLSLFNTGISYIEGGRTASGF- 153 +++ D++ A+ AV L ++L RE QG+ES+ F+S F G+ Y EGG SGF Sbjct: 68 QSSRDEQGACAVLAVQLDDYLGGRPVQHREVQGNESDLFMSYFPRGLKYQEGG-VESGFK 126 Query: 154 FTVEDTVYTTRLYRVHAPLHQAQASSIHLEPVPVLSESLDPRFVFLLDAGLKLFIWNGPK 213 V + V RLY+V A +I + +S + F+LD G +F W G K Sbjct: 127 HVVPNEVVVQRLYQVKG------AKNIRATERALNWDSFNTGDCFILDLGQNIFAWCGGK 180 Query: 214 A 214 + Sbjct: 181 S 181
>pdb|1J72|A Chain A, Crystal Structure Of Mutant Macrophage Capping Protein (Cap G) With Actin-Severing Activity In The Ca2+-Free Form Length = 347 Back     alignment and structure
>pdb|1RGI|G Chain G, Crystal Structure Of Gelsolin Domains G1-G3 Bound To Actin Length = 346 Back     alignment and structure
>pdb|2FGH|A Chain A, Atp Bound Gelsolin Length = 731 Back     alignment and structure
>pdb|1D0N|A Chain A, The Crystal Structure Of Calcium-Free Equine Plasma Gelsolin. Length = 729 Back     alignment and structure
>pdb|3FFK|A Chain A, Crystal Structure Of Human Gelsolin Domains G1-G3 Bound To Actin Length = 377 Back     alignment and structure
>pdb|3FFN|A Chain A, Crystal Structure Of Calcium-Free Human Gelsolin Length = 782 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query273
1d0n_A 729 Horse plasma gelsolin; mixed alpha-beta structure, 1e-25
1d0n_A 729 Horse plasma gelsolin; mixed alpha-beta structure, 2e-18
1d0n_A729 Horse plasma gelsolin; mixed alpha-beta structure, 2e-06
1d0n_A 729 Horse plasma gelsolin; mixed alpha-beta structure, 2e-05
1j72_A 347 Macrophage capping protein; actin, human, CAP G, G 1e-25
1j72_A347 Macrophage capping protein; actin, human, CAP G, G 3e-07
2fh1_A 344 Gelsolin; calcium, contractIle protein; 1.55A {Hom 2e-19
2fh1_A344 Gelsolin; calcium, contractIle protein; 1.55A {Hom 4e-05
1t44_G147 Chimera of gelsolin domain 1 and C-terminal domain 2e-17
3fg7_A 398 Villin-1; actin binding protein, gelsolin, actin c 5e-17
3fg7_A398 Villin-1; actin binding protein, gelsolin, actin c 1e-04
3cip_G128 Gelsolin; actin, dictyostelium discoideum, actin-a 1e-16
1svq_A114 Severin; actin-binding; NMR {Dictyostelium discoid 3e-16
2ff3_A150 Gelsolin; protein-protein complex, structural prot 4e-16
2vik_A126 Villin 14T; actin-binding protein, capping protein 1e-15
3fg6_A371 Adseverin, scinderin; C-terminus of adseverin, act 4e-15
3fg6_A371 Adseverin, scinderin; C-terminus of adseverin, act 3e-06
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-11
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-11
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 4e-08
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-08
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 8e-08
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-07
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-07
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-06
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-05
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-05
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-05
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 7e-05
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-04
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-04
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 6e-04
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-10
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 8e-10
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-08
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-08
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-08
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-07
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-07
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 9e-07
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 1e-06
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 2e-06
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-06
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 3e-04
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-10
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-09
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 4e-09
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-07
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-10
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-08
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 4e-05
1kcq_A104 Gelsolin, brevin, ADF, AGEL; alpha-beta structure, 4e-10
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-10
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-08
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-07
3o6n_A 390 APL1; leucine-rich repeat, protein binding; HET: N 3e-07
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 5e-07
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-07
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 6e-06
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-05
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 4e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-10
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 2e-08
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-08
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-07
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-06
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 3e-05
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 8e-10
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-08
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-08
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-08
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 7e-06
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 9e-05
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 9e-10
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-08
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 2e-07
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 6e-07
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 6e-07
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 7e-07
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 5e-06
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-05
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 6e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 3e-09
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-07
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-07
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-07
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-06
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-06
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-04
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-09
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 6e-08
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-07
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-07
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-07
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-06
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-06
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 5e-06
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-05
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 3e-05
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-05
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 2e-04
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 4e-09
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-07
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 2e-07
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-07
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 5e-07
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-06
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-06
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 5e-06
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 7e-06
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 1e-05
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 4e-05
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 6e-05
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-04
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 1e-04
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 2e-04
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 7e-09
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-08
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 9e-08
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-07
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-06
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 9e-06
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-05
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-04
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-08
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-08
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-08
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-06
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-06
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-06
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-06
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 2e-05
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-05
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-05
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-05
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-04
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-04
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 4e-04
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 6e-07
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-08
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-08
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-08
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-07
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 2e-07
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 5e-07
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-07
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 8e-05
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-04
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-04
3fxi_A 605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-08
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 6e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-06
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 5e-08
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-06
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 1e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-05
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-05
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 8e-05
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 2e-04
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-08
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-08
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-08
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-07
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-07
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-07
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-06
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 1e-05
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-05
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 4e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-08
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 1e-05
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-08
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-08
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 9e-08
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-07
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 6e-07
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-06
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-06
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-05
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 5e-05
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 4e-08
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 6e-08
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 7e-08
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-07
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 5e-07
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 3e-06
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-05
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-08
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-07
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-07
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-06
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-06
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-06
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-05
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 3e-04
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 4e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-08
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-05
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 5e-08
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 6e-08
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 8e-08
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-07
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-07
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-07
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-07
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 5e-07
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-06
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 6e-06
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-05
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 1e-05
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 4e-05
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 8e-05
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 6e-08
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-06
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-06
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-05
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-05
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-05
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 5e-05
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 7e-08
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 7e-08
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 6e-07
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-06
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-06
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 7e-05
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 5e-04
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 8e-08
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 2e-07
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-06
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-06
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 7e-05
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 6e-04
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 8e-08
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-07
3v47_A 455 TOLL-like receptor 5B and variable lymphocyte REC 6e-07
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 4e-06
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 7e-05
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-04
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-07
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-07
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-06
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-06
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 6e-06
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 7e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 8e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 8e-06
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 7e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 8e-07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-06
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 3e-06
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-06
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 5e-04
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 6e-04
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-07
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-06
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 5e-05
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-04
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 6e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 7e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 5e-04
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-07
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-06
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 9e-06
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-05
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-05
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 8e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-06
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-07
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 5e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 5e-04
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 4e-07
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-05
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-04
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 1e-04
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 5e-07
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 7e-07
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 1e-06
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 2e-05
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-05
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 5e-05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-07
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 3e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 8e-06
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-05
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-05
1o6v_A466 Internalin A; bacterial infection, extracellular r 6e-07
1o6v_A466 Internalin A; bacterial infection, extracellular r 1e-06
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-06
1o6v_A466 Internalin A; bacterial infection, extracellular r 3e-06
1o6v_A 466 Internalin A; bacterial infection, extracellular r 4e-06
1o6v_A466 Internalin A; bacterial infection, extracellular r 6e-06
1o6v_A466 Internalin A; bacterial infection, extracellular r 6e-06
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-05
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-05
1o6v_A466 Internalin A; bacterial infection, extracellular r 8e-05
1o6v_A 466 Internalin A; bacterial infection, extracellular r 2e-04
1o6v_A 466 Internalin A; bacterial infection, extracellular r 6e-04
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 9e-07
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 3e-06
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 7e-05
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 2e-06
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-06
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-06
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 3e-06
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-06
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 6e-06
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 2e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 7e-05
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 1e-04
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 2e-04
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 4e-04
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 5e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 1e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 5e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 3e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-04
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-06
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-06
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-05
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-05
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 2e-05
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-05
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 6e-05
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 8e-05
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 9e-05
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-04
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 5e-04
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-06
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 7e-06
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-05
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 2e-05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 7e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-04
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 2e-06
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 8e-06
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 9e-06
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-05
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 9e-05
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-06
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-06
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-05
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 8e-05
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 1e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-06
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 6e-06
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 7e-06
1w8a_A192 SLIT protein; signaling protein, secreted protein, 6e-06
1w8a_A192 SLIT protein; signaling protein, secreted protein, 8e-06
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 6e-06
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 7e-06
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-05
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-04
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 7e-04
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 8e-06
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 2e-05
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 6e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 3e-05
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 1e-04
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-04
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 6e-04
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 8e-04
1m2v_B926 SEC24, protein transport protein SEC24, SEC24P, SE 4e-05
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 1e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-04
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 3e-04
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 5e-04
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 6e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 4e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 8e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 6e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 9e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 7e-04
>1d0n_A Horse plasma gelsolin; mixed alpha-beta structure, actin-binding protein, protein D packing, contractIle protein; 2.50A {Equus caballus} SCOP: d.109.1.1 d.109.1.1 d.109.1.1 d.109.1.1 d.109.1.1 d.109.1.1 PDB: 2fgh_A* 3ffn_A 3ffk_A* 1rgi_G* Length = 729 Back     alignment and structure
 Score =  105 bits (262), Expect = 1e-25
 Identities = 36/121 (29%), Positives = 54/121 (44%), Gaps = 6/121 (4%)

Query: 95  KATLDKRACSAIHAVNLRNFLAAECRTIREEQGDESEEFLSLFNTGISYIEGGRTASGFF 154
           + + D+   +AI  V L ++L       RE QG ES  FL  F +G+ Y +GG  +    
Sbjct: 66  ECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESATFLGYFKSGLKYKKGGVASGFKH 125

Query: 155 TVEDTVYTTRLYRVHAPLHQAQASSIHLEPVPVLSESLDPRFVFLLDAGLKLFIWNGPKA 214
            V + V   RL +V           +    VPV  ES +    F+LD G  ++ W G K+
Sbjct: 126 VVPNEVVVQRLLQVKGRRV------VRATEVPVSWESFNNGDCFILDLGNNIYQWCGSKS 179

Query: 215 K 215
            
Sbjct: 180 N 180


>1d0n_A Horse plasma gelsolin; mixed alpha-beta structure, actin-binding protein, protein D packing, contractIle protein; 2.50A {Equus caballus} SCOP: d.109.1.1 d.109.1.1 d.109.1.1 d.109.1.1 d.109.1.1 d.109.1.1 PDB: 2fgh_A* 3ffn_A 3ffk_A* 1rgi_G* Length = 729 Back     alignment and structure
>1d0n_A Horse plasma gelsolin; mixed alpha-beta structure, actin-binding protein, protein D packing, contractIle protein; 2.50A {Equus caballus} SCOP: d.109.1.1 d.109.1.1 d.109.1.1 d.109.1.1 d.109.1.1 d.109.1.1 PDB: 2fgh_A* 3ffn_A 3ffk_A* 1rgi_G* Length = 729 Back     alignment and structure
>1d0n_A Horse plasma gelsolin; mixed alpha-beta structure, actin-binding protein, protein D packing, contractIle protein; 2.50A {Equus caballus} SCOP: d.109.1.1 d.109.1.1 d.109.1.1 d.109.1.1 d.109.1.1 d.109.1.1 PDB: 2fgh_A* 3ffn_A 3ffk_A* 1rgi_G* Length = 729 Back     alignment and structure
>1j72_A Macrophage capping protein; actin, human, CAP G, GCAP39, MBHL, GELS structural protein; 2.50A {Homo sapiens} SCOP: d.109.1.1 d.109.1.1 d.109.1.1 PDB: 1jhw_A Length = 347 Back     alignment and structure
>1j72_A Macrophage capping protein; actin, human, CAP G, GCAP39, MBHL, GELS structural protein; 2.50A {Homo sapiens} SCOP: d.109.1.1 d.109.1.1 d.109.1.1 PDB: 1jhw_A Length = 347 Back     alignment and structure
>2fh1_A Gelsolin; calcium, contractIle protein; 1.55A {Homo sapiens} SCOP: d.109.1.1 d.109.1.1 d.109.1.1 PDB: 1p8x_A 2fh2_A 2fh3_A 2fh4_A 1h1v_G* 1nph_A Length = 344 Back     alignment and structure
>2fh1_A Gelsolin; calcium, contractIle protein; 1.55A {Homo sapiens} SCOP: d.109.1.1 d.109.1.1 d.109.1.1 PDB: 1p8x_A 2fh2_A 2fh3_A 2fh4_A 1h1v_G* 1nph_A Length = 344 Back     alignment and structure
>1t44_G Chimera of gelsolin domain 1 and C-terminal domain of thymosin beta-4; structural protein; HET: ATP; 2.00A {Homo sapiens} SCOP: d.109.1.1 Length = 147 Back     alignment and structure
>3fg7_A Villin-1; actin binding protein, gelsolin, actin capping, actin-binding, calcium, cytoplasm, cytoskeleton, structural protein; 2.00A {Homo sapiens} Length = 398 Back     alignment and structure
>3fg7_A Villin-1; actin binding protein, gelsolin, actin capping, actin-binding, calcium, cytoplasm, cytoskeleton, structural protein; 2.00A {Homo sapiens} Length = 398 Back     alignment and structure
>3cip_G Gelsolin; actin, dictyostelium discoideum, actin-associated methyl histidine, ATP-binding, cytoskeleton, nucleotide-BIN phosphoprotein; HET: HIC ATP; 1.60A {Homo sapiens} SCOP: d.109.1.1 PDB: 3ci5_G* 1p8z_G* 1d4x_G* 1nlv_G* 1mdu_A* 1nm1_G* 1nmd_G* 1yag_G* 1yvn_G* 3cjb_G* 3cjc_G* 1esv_S* 1eqy_S* 1c0g_S* 1c0f_S* 1dej_S* 3a5l_S* 3a5m_S* 3a5n_S* 3a5o_S* Length = 128 Back     alignment and structure
>1svq_A Severin; actin-binding; NMR {Dictyostelium discoideum} SCOP: d.109.1.1 PDB: 1svr_A 1svy_A Length = 114 Back     alignment and structure
>2ff3_A Gelsolin; protein-protein complex, structural protein/contractIle protein complex; HET: ATP; 2.00A {Homo sapiens} SCOP: d.109.1.1 PDB: 2ff6_G* Length = 150 Back     alignment and structure
>2vik_A Villin 14T; actin-binding protein, capping protein, calcium-binding protein, cytoskeletal protein; NMR {Gallus gallus} SCOP: d.109.1.1 PDB: 2vil_A Length = 126 Back     alignment and structure
>3fg6_A Adseverin, scinderin; C-terminus of adseverin, actin capping, actin-binding, cytos phosphoprotein, actin-binding protein; 3.00A {Homo sapiens} Length = 371 Back     alignment and structure
>3fg6_A Adseverin, scinderin; C-terminus of adseverin, actin capping, actin-binding, cytos phosphoprotein, actin-binding protein; 3.00A {Homo sapiens} Length = 371 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1kcq_A Gelsolin, brevin, ADF, AGEL; alpha-beta structure, actin-binding protein, familial amyloi finnish type, cadmium binding, metal binding; 1.65A {Homo sapiens} SCOP: d.109.1.1 Length = 104 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query273
1j72_A347 Macrophage capping protein; actin, human, CAP G, G 100.0
3fg6_A371 Adseverin, scinderin; C-terminus of adseverin, act 100.0
3fg7_A398 Villin-1; actin binding protein, gelsolin, actin c 100.0
2fh1_A344 Gelsolin; calcium, contractIle protein; 1.55A {Hom 100.0
1d0n_A 729 Horse plasma gelsolin; mixed alpha-beta structure, 100.0
1d0n_A729 Horse plasma gelsolin; mixed alpha-beta structure, 100.0
1svq_A114 Severin; actin-binding; NMR {Dictyostelium discoid 99.76
1j72_A347 Macrophage capping protein; actin, human, CAP G, G 99.71
1kcq_A104 Gelsolin, brevin, ADF, AGEL; alpha-beta structure, 99.71
3tu5_B297 Gelsolin, protein cordon-BLeu, thymosin beta-4; un 99.68
3fg7_A398 Villin-1; actin binding protein, gelsolin, actin c 99.56
3fg6_A371 Adseverin, scinderin; C-terminus of adseverin, act 99.51
2fh1_A344 Gelsolin; calcium, contractIle protein; 1.55A {Hom 99.46
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.31
1t44_G147 Chimera of gelsolin domain 1 and C-terminal domain 99.27
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.25
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.25
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.25
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.23
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.22
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 99.22
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.21
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.2
2ff3_A150 Gelsolin; protein-protein complex, structural prot 99.19
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.19
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 99.19
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.18
3cip_G128 Gelsolin; actin, dictyostelium discoideum, actin-a 99.18
2vik_A126 Villin 14T; actin-binding protein, capping protein 99.16
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.16
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.16
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.14
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.14
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.14
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.12
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.12
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.11
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.11
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.11
4g8a_A 635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 99.11
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.09
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.09
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.07
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.06
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.05
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.05
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.02
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.02
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.01
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.01
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.01
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 98.99
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 98.98
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.97
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 98.97
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 98.97
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.96
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 98.95
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 98.94
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 98.94
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 98.93
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 98.93
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 98.93
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 98.93
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 98.92
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 98.9
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 98.9
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 98.9
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 98.89
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 98.89
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 98.89
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 98.88
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 98.88
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 98.88
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 98.88
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 98.88
1kcq_A104 Gelsolin, brevin, ADF, AGEL; alpha-beta structure, 98.87
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 98.87
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 98.87
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 98.87
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 98.87
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 98.86
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 98.86
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 98.85
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 98.85
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 98.85
4ezg_A197 Putative uncharacterized protein; internalin-A, le 98.85
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 98.84
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 98.84
3zyi_A 452 Leucine-rich repeat-containing protein 4; cell adh 98.84
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 98.82
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 98.82
4ezg_A197 Putative uncharacterized protein; internalin-A, le 98.81
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.81
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 98.8
1svq_A114 Severin; actin-binding; NMR {Dictyostelium discoid 98.8
2z7x_B 520 TOLL-like receptor 1, variable lymphocyte recepto; 98.79
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 98.78
3a79_B 562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 98.77
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 98.77
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 98.77
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 98.77
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 98.76
1ziw_A 680 TOLL-like receptor 3; innate immunity, immune syst 98.76
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 98.76
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 98.75
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 98.75
2z81_A 549 CD282 antigen, TOLL-like receptor 2, variable lymp 98.74
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 98.74
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 98.74
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 98.72
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 98.72
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 98.72
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 98.72
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 98.7
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 98.7
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 98.69
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 98.68
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 98.68
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 98.68
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 98.68
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 98.68
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 98.67
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 98.67
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 98.66
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 98.66
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 98.65
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 98.65
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 98.63
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 98.61
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 98.6
3bz5_A 457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 98.58
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 98.58
4fmz_A347 Internalin; leucine rich repeat, structural genomi 98.57
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 98.56
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 98.54
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 98.52
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 98.51
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.48
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 98.45
4fmz_A347 Internalin; leucine rich repeat, structural genomi 98.44
1o6v_A 466 Internalin A; bacterial infection, extracellular r 98.42
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 98.41
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 98.39
1o6v_A 466 Internalin A; bacterial infection, extracellular r 98.37
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 98.18
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 98.15
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 98.09
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 98.06
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 97.96
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.95
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 97.89
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 97.81
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 97.72
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 97.56
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 97.55
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 97.52
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 97.51
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 97.48
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 97.37
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.29
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.27
4fdw_A401 Leucine rich hypothetical protein; putative cell s 97.22
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 97.14
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 96.91
3ogk_B 592 Coronatine-insensitive protein 1; leucine rich rep 96.85
4fdw_A401 Leucine rich hypothetical protein; putative cell s 96.77
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 96.62
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 96.04
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 95.83
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 95.78
4gt6_A394 Cell surface protein; leucine rich repeats, putati 95.64
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 95.55
3tu5_B 297 Gelsolin, protein cordon-BLeu, thymosin beta-4; un 95.29
4gt6_A394 Cell surface protein; leucine rich repeats, putati 95.27
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 95.17
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 95.16
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 95.11
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 94.55
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 94.24
2vik_A126 Villin 14T; actin-binding protein, capping protein 93.5
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 92.72
3cip_G128 Gelsolin; actin, dictyostelium discoideum, actin-a 92.01
2ff3_A150 Gelsolin; protein-protein complex, structural prot 91.64
1t44_G147 Chimera of gelsolin domain 1 and C-terminal domain 90.58
3eh1_A751 Protein transport protein SEC24B; copii coat prote 88.85
1pcx_A810 Protein transport protein SEC24; 2.50A {Saccharomy 87.45
3eh1_A751 Protein transport protein SEC24B; copii coat prote 87.09
3eh2_A766 Protein transport protein SEC24C; copii-coat prote 86.3
1pcx_A810 Protein transport protein SEC24; 2.50A {Saccharomy 86.28
3efo_B770 SEC24 related gene family, member D; copii, coat p 85.98
1m2v_B926 SEC24, protein transport protein SEC24, SEC24P, SE 85.76
3eh2_A766 Protein transport protein SEC24C; copii-coat prote 85.69
1m2v_B926 SEC24, protein transport protein SEC24, SEC24P, SE 85.25
3efo_B770 SEC24 related gene family, member D; copii, coat p 85.1
2nut_A769 Protein transport protein SEC23A; human copii SEC2 82.53
1m2o_A768 SEC23, protein transport protein SEC23, SEC23P; zi 82.05
>1j72_A Macrophage capping protein; actin, human, CAP G, GCAP39, MBHL, GELS structural protein; 2.50A {Homo sapiens} SCOP: d.109.1.1 d.109.1.1 d.109.1.1 PDB: 1jhw_A Back     alignment and structure
Probab=100.00  E-value=1.2e-37  Score=270.95  Aligned_cols=222  Identities=25%  Similarity=0.320  Sum_probs=180.4

Q ss_pred             hcCCccCCEeeccCCcCccCCCCcccc-CC-CCCCEEecccCCCCCccchhhhhhhcccccchhccccccccchhhhhhh
Q psy8923          40 LTELQCLRTLNLRYNKIKNSGIPVDLF-HL-EDLTTLDLSHNNIKQIPDALENAKRTKATLDKRACSAIHAVNLRNFLAA  117 (273)
Q Consensus        40 ~~~l~~L~~L~l~~N~l~~~~ip~~~~-~l-~~L~~L~Ls~N~l~~ip~~l~~w~g~~~~~~~~~~~~l~~~~L~~~l~~  117 (273)
                      .++-+.|+...+.+..+..  +|+... .+ ..=.++-|.--.-..  ..||.|+|.+++.++.+++++.+.+|++.+++
T Consensus        15 ~~~~~g~~iWrie~~~~~~--vp~~~~G~Fy~gd~Yivl~t~~~~~--~~i~~W~G~~ss~de~~~aa~~t~~ld~~lgg   90 (347)
T 1j72_A           15 SVQDPGLHVWRVEKLKPVP--VAQENQGVFFSGDSYLVLHNGPEEV--SHLHLWIGQQSSRDEQGACAVLAVQLDDYLGG   90 (347)
T ss_dssp             TTSSSEEEEEEECSSSEEE--CCTTTTTEEETTSEEEEEEECSSSC--EEEEEEECTTSCHHHHHHHHHHHHHHHHHTTT
T ss_pred             cccCCCeEEEEEcCCEEEE--CCHHHcCeecCCCEEEEEEeecCCC--eEEEEEcCCCCCHHHHHHHHHHHHHHHHHhCC
Confidence            3445677777777766665  775322 11 111122222111111  67999999999999999999999999999999


Q ss_pred             hhhhcccccCCCchhhHhhccCCcEEecCCcccccceecccCc-ceeeEEEEecCcccCCCCceEEEEecCCCCCCCCCC
Q psy8923         118 ECRTIREEQGDESEEFLSLFNTGISYIEGGRTASGFFTVEDTV-YTTRLYRVHAPLHQAQASSIHLEPVPVLSESLDPRF  196 (273)
Q Consensus       118 ~~~~~~~~qg~e~~~fl~lf~~~i~~l~g~~~~s~~~~~~~~~-~~~~L~~v~g~~~~~~~~~~~~~ev~~~~ssL~s~d  196 (273)
                      .++|+|+.||+||++|+++|++++++++|+ ..+++.++.+.. ..++||||+|+      +++++.|||++++|||++|
T Consensus        91 ~~vq~R~~Qg~Es~~Fl~~F~~~~~i~~Gg-~~sgf~~~~~~~~~~~rL~~v~G~------~~v~~~eV~~~~~sLns~d  163 (347)
T 1j72_A           91 RPVQHREVQGNESDLFMSYFPRGLKYQEGG-VESGFKHVVPNEVVVQRLYQVKGK------KNIRATERALNWDSFNTGD  163 (347)
T ss_dssp             CSEEEEEETTSCCHHHHTTCSSCCEEECSS-CCTTCCCCCCCCCEEEEEEEEECS------SSCEEEEECSSGGGCBTTS
T ss_pred             CCcEEEeeCCCCCHHHHHhhCCCeEEeeCC-ccccccccccCCCCCcEEEEEECC------CceEEEEEeeeHHHcCCCc
Confidence            999999999999999999999999999999 889998887655 46799999998      6889999999999999999


Q ss_pred             EEEEECCCeEEEEeCCCCCHHHHHHhhhhh----------------------cccccc--C---CC--------------
Q psy8923         197 VFLLDAGLKLFIWNGPKAKNTFVFLLDAGL----------------------KLFIWN--G---PK--------------  235 (273)
Q Consensus       197 vfild~~~~~~vW~G~~s~~~e~~~~~~~~----------------------~~~fw~--~---~~--------------  235 (273)
                      |||||+++.+|+|+|++|+.+||..|..+|                      +.+||.  |   .+              
T Consensus       164 ~FIL~~~~~iy~W~G~~s~~~Er~~A~~~a~~i~~~~~~g~~~v~~v~EG~E~~~Fw~~LGg~~~~~~~~~~~d~~~~~~  243 (347)
T 1j72_A          164 CFILDLGQNIFAWCGGKSNILERNKARDLALAIRDSERQGKAQVEIVTDGEEPAEMIQVLGPKPALKEGNPEEDLTADKA  243 (347)
T ss_dssp             EEEEEETTEEEEEECTTCCHHHHHHHHHHHHHHHTTSCCSSCEEEEEETTCCCHHHHHHHCSCCCCBCSCCSSCCTTSSS
T ss_pred             eEEEecCCEEEEEECCCCCHHHHHHHHHHHHHHHhhccCCCceEEEEeCCCCHHHHHHHhCCCcccccCCcchhhhhhhh
Confidence            999999999999999999999999876443                      557777  2   00              


Q ss_pred             --------------------------------CCCceEEEEeCC--ceEEEEeCCCcchHhHHhHHHHhhh
Q psy8923         236 --------------------------------AKNTFVFLLDAG--LKLFIWNGPKAKNTFKSKTRLLAEK  272 (273)
Q Consensus       236 --------------------------------~~~~~v~~ld~~--~~~~~w~G~~a~~~~~~~~~~~~~~  272 (273)
                                                      ..+++|||||++  .+||||+|++|+..||+.|+++|++
T Consensus       244 ~~~~~rLy~vs~~~G~~~v~ev~~~~~~~q~~L~s~dv~ILD~g~~~~IyVW~G~~a~~~er~~A~~~A~~  314 (347)
T 1j72_A          244 NAQAAALYKVSDATGQMNLTKVADSSPFALELLISDDCFVLDNGLCGKIYIWKGRKANEKERQAALQVAEG  314 (347)
T ss_dssp             SSCCCEEEEEECTTSSCEEEEEECSSSBCGGGCCTTSEEEEECGGGSEEEEEECTTCCHHHHHHHHHHHHH
T ss_pred             cccCCEEEEEECCCCCEEEEeeccCCCCCHHHcCCCCEEEEecCCCcEEEEEeCCCCCHHHHHHHHHHHHH
Confidence                                            011359999999  9999999999999999999999986



>3fg6_A Adseverin, scinderin; C-terminus of adseverin, actin capping, actin-binding, cytos phosphoprotein, actin-binding protein; 3.00A {Homo sapiens} Back     alignment and structure
>3fg7_A Villin-1; actin binding protein, gelsolin, actin capping, actin-binding, calcium, cytoplasm, cytoskeleton, structural protein; 2.00A {Homo sapiens} PDB: 2llf_A Back     alignment and structure
>2fh1_A Gelsolin; calcium, contractIle protein; 1.55A {Homo sapiens} SCOP: d.109.1.1 d.109.1.1 d.109.1.1 PDB: 1p8x_A 2fh2_A 2fh3_A 2fh4_A 1h1v_G* 1nph_A Back     alignment and structure
>1d0n_A Horse plasma gelsolin; mixed alpha-beta structure, actin-binding protein, protein D packing, contractIle protein; 2.50A {Equus caballus} SCOP: d.109.1.1 d.109.1.1 d.109.1.1 d.109.1.1 d.109.1.1 d.109.1.1 PDB: 2fgh_A* 3ffn_A 3ffk_A* 1rgi_G* Back     alignment and structure
>1d0n_A Horse plasma gelsolin; mixed alpha-beta structure, actin-binding protein, protein D packing, contractIle protein; 2.50A {Equus caballus} SCOP: d.109.1.1 d.109.1.1 d.109.1.1 d.109.1.1 d.109.1.1 d.109.1.1 PDB: 2fgh_A* 3ffn_A 3ffk_A* 1rgi_G* Back     alignment and structure
>1svq_A Severin; actin-binding; NMR {Dictyostelium discoideum} SCOP: d.109.1.1 PDB: 1svr_A 1svy_A Back     alignment and structure
>1j72_A Macrophage capping protein; actin, human, CAP G, GCAP39, MBHL, GELS structural protein; 2.50A {Homo sapiens} SCOP: d.109.1.1 d.109.1.1 d.109.1.1 PDB: 1jhw_A Back     alignment and structure
>1kcq_A Gelsolin, brevin, ADF, AGEL; alpha-beta structure, actin-binding protein, familial amyloi finnish type, cadmium binding, metal binding; 1.65A {Homo sapiens} SCOP: d.109.1.1 Back     alignment and structure
>3tu5_B Gelsolin, protein cordon-BLeu, thymosin beta-4; unusual hairpin conformation in the D-loop, structural prote binding protein complex; HET: ATP; 3.00A {Homo sapiens} Back     alignment and structure
>3fg7_A Villin-1; actin binding protein, gelsolin, actin capping, actin-binding, calcium, cytoplasm, cytoskeleton, structural protein; 2.00A {Homo sapiens} PDB: 2llf_A Back     alignment and structure
>3fg6_A Adseverin, scinderin; C-terminus of adseverin, actin capping, actin-binding, cytos phosphoprotein, actin-binding protein; 3.00A {Homo sapiens} Back     alignment and structure
>2fh1_A Gelsolin; calcium, contractIle protein; 1.55A {Homo sapiens} SCOP: d.109.1.1 d.109.1.1 d.109.1.1 PDB: 1p8x_A 2fh2_A 2fh3_A 2fh4_A 1h1v_G* 1nph_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>1t44_G Chimera of gelsolin domain 1 and C-terminal domain of thymosin beta-4; structural protein; HET: ATP; 2.00A {Homo sapiens} SCOP: d.109.1.1 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2ff3_A Gelsolin; protein-protein complex, structural protein/contractIle protein complex; HET: ATP; 2.00A {Homo sapiens} SCOP: d.109.1.1 PDB: 2ff6_G* Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3cip_G Gelsolin; actin, dictyostelium discoideum, actin-associated methyl histidine, ATP-binding, cytoskeleton, nucleotide-BIN phosphoprotein; HET: HIC ATP; 1.60A {Homo sapiens} SCOP: d.109.1.1 PDB: 3ci5_G* 1p8z_G* 1d4x_G* 1nlv_G* 1mdu_A* 1nm1_G* 1nmd_G* 1yag_G* 1yvn_G* 3cjb_G* 3cjc_G* 1esv_S* 1eqy_S* 1c0g_S* 1c0f_S* 1dej_S* 3a5l_S* 3a5m_S* 3a5n_S* 3a5o_S* Back     alignment and structure
>2vik_A Villin 14T; actin-binding protein, capping protein, calcium-binding protein, cytoskeletal protein; NMR {Gallus gallus} SCOP: d.109.1.1 PDB: 2vil_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>1kcq_A Gelsolin, brevin, ADF, AGEL; alpha-beta structure, actin-binding protein, familial amyloi finnish type, cadmium binding, metal binding; 1.65A {Homo sapiens} SCOP: d.109.1.1 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1svq_A Severin; actin-binding; NMR {Dictyostelium discoideum} SCOP: d.109.1.1 PDB: 1svr_A 1svy_A Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>3tu5_B Gelsolin, protein cordon-BLeu, thymosin beta-4; unusual hairpin conformation in the D-loop, structural prote binding protein complex; HET: ATP; 3.00A {Homo sapiens} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>2vik_A Villin 14T; actin-binding protein, capping protein, calcium-binding protein, cytoskeletal protein; NMR {Gallus gallus} SCOP: d.109.1.1 PDB: 2vil_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3cip_G Gelsolin; actin, dictyostelium discoideum, actin-associated methyl histidine, ATP-binding, cytoskeleton, nucleotide-BIN phosphoprotein; HET: HIC ATP; 1.60A {Homo sapiens} SCOP: d.109.1.1 PDB: 3ci5_G* 1p8z_G* 1d4x_G* 1nlv_G* 1mdu_A* 1nm1_G* 1nmd_G* 1yag_G* 1yvn_G* 3cjb_G* 3cjc_G* 1esv_S* 1eqy_S* 1c0g_S* 1c0f_S* 1dej_S* 3a5l_S* 3a5m_S* 3a5n_S* 3a5o_S* Back     alignment and structure
>2ff3_A Gelsolin; protein-protein complex, structural protein/contractIle protein complex; HET: ATP; 2.00A {Homo sapiens} SCOP: d.109.1.1 PDB: 2ff6_G* Back     alignment and structure
>1t44_G Chimera of gelsolin domain 1 and C-terminal domain of thymosin beta-4; structural protein; HET: ATP; 2.00A {Homo sapiens} SCOP: d.109.1.1 Back     alignment and structure
>3eh1_A Protein transport protein SEC24B; copii coat protein, vesicle transport, transport signal sequence, cytoplasm, endoplasmic reticulum; 1.80A {Homo sapiens} PDB: 2nut_B 2nup_B 3egd_B 3egx_B Back     alignment and structure
>1pcx_A Protein transport protein SEC24; 2.50A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 PDB: 1pd0_A 1pd1_A Back     alignment and structure
>3eh1_A Protein transport protein SEC24B; copii coat protein, vesicle transport, transport signal sequence, cytoplasm, endoplasmic reticulum; 1.80A {Homo sapiens} PDB: 2nut_B 2nup_B 3egd_B 3egx_B Back     alignment and structure
>3eh2_A Protein transport protein SEC24C; copii-coat protein, vesicle transport, cytoplasm, endoplasmic reticulum, ER-golgi transport, golgi apparatus; 2.35A {Homo sapiens} Back     alignment and structure
>1pcx_A Protein transport protein SEC24; 2.50A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 PDB: 1pd0_A 1pd1_A Back     alignment and structure
>3efo_B SEC24 related gene family, member D; copii, coat protein, transport signal, disease mutation, endoplasmic reticulum, ER-golgi transport, golgi apparatus, membrane; 2.70A {Homo sapiens} PDB: 3eg9_B Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Back     alignment and structure
>3eh2_A Protein transport protein SEC24C; copii-coat protein, vesicle transport, cytoplasm, endoplasmic reticulum, ER-golgi transport, golgi apparatus; 2.35A {Homo sapiens} Back     alignment and structure
>1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Back     alignment and structure
>3efo_B SEC24 related gene family, member D; copii, coat protein, transport signal, disease mutation, endoplasmic reticulum, ER-golgi transport, golgi apparatus, membrane; 2.70A {Homo sapiens} PDB: 3eg9_B Back     alignment and structure
>2nut_A Protein transport protein SEC23A; human copii SEC23/24 complexed with SEC22, protein transport; 2.30A {Homo sapiens} PDB: 2nup_A 3egd_A 3eg9_A 3egx_A 3efo_A Back     alignment and structure
>1m2o_A SEC23, protein transport protein SEC23, SEC23P; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 PDB: 1m2v_A 2qtv_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 273
d1j72a1114 d.109.1.1 (A:11-124) Macrophage capping protein Ca 5e-17
d3cipg1124 d.109.1.1 (G:2-125) Gelsolin {Human (Homo sapiens) 1e-15
d2fh1a1121 d.109.1.1 (A:412-532) Gelsolin {Human (Homo sapien 6e-15
d2vika_126 d.109.1.1 (A:) Villin, domain 1 (res. 1-126) {Chic 3e-14
d1j72a2116 d.109.1.1 (A:125-240) Macrophage capping protein C 2e-10
d1svya_102 d.109.1.1 (A:) Severin, domain 2 {Dictyostelium di 4e-09
d2fh1a296 d.109.1.1 (A:533-628) Gelsolin {Human (Homo sapien 1e-08
d2fh1a296 d.109.1.1 (A:533-628) Gelsolin {Human (Homo sapien 7e-04
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 4e-05
d1kcqa_104 d.109.1.1 (A:) Gelsolin {Human (Homo sapiens) [Tax 1e-07
d1kcqa_104 d.109.1.1 (A:) Gelsolin {Human (Homo sapiens) [Tax 0.001
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 3e-07
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-07
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-05
d1z7xw1 460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 0.002
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-06
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-06
d2omza2 384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 4e-05
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 0.003
d2fh1a3113 d.109.1.1 (A:629-741) Gelsolin {Human (Homo sapien 3e-06
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 1e-05
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 2e-05
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 2e-04
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 5e-05
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 8e-04
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 6e-05
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 0.002
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 6e-05
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 0.003
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 3e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.003
d1d0na3121 d.109.1.1 (A:263-383) Gelsolin {Horse (Equus cabal 4e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 8e-04
d1koha1162 c.10.2.3 (A:201-362) mRNA export factor tap {Human 0.001
>d1j72a1 d.109.1.1 (A:11-124) Macrophage capping protein Cap G {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Gelsolin-like
superfamily: Actin depolymerizing proteins
family: Gelsolin-like
domain: Macrophage capping protein Cap G
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 72.9 bits (179), Expect = 5e-17
 Identities = 22/58 (37%), Positives = 34/58 (58%), Gaps = 1/58 (1%)

Query: 95  KATLDKRACSAIHAVNLRNFLAAECRTIREEQGDESEEFLSLFNTGISYIEGGRTASG 152
           +++ D++   A+ AV L ++L       RE QG+ES+ F+S F  G+ Y EGG   SG
Sbjct: 58  QSSRDEQGACAVLAVQLDDYLGGRPVQHREVQGNESDLFMSYFPRGLKYQEGG-VESG 114


>d3cipg1 d.109.1.1 (G:2-125) Gelsolin {Human (Homo sapiens) [TaxId: 9606]} Length = 124 Back     information, alignment and structure
>d2fh1a1 d.109.1.1 (A:412-532) Gelsolin {Human (Homo sapiens) [TaxId: 9606]} Length = 121 Back     information, alignment and structure
>d2vika_ d.109.1.1 (A:) Villin, domain 1 (res. 1-126) {Chicken (Gallus gallus) [TaxId: 9031]} Length = 126 Back     information, alignment and structure
>d1j72a2 d.109.1.1 (A:125-240) Macrophage capping protein Cap G {Human (Homo sapiens) [TaxId: 9606]} Length = 116 Back     information, alignment and structure
>d1svya_ d.109.1.1 (A:) Severin, domain 2 {Dictyostelium discoideum [TaxId: 44689]} Length = 102 Back     information, alignment and structure
>d2fh1a2 d.109.1.1 (A:533-628) Gelsolin {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2fh1a2 d.109.1.1 (A:533-628) Gelsolin {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1kcqa_ d.109.1.1 (A:) Gelsolin {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1kcqa_ d.109.1.1 (A:) Gelsolin {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2fh1a3 d.109.1.1 (A:629-741) Gelsolin {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1d0na3 d.109.1.1 (A:263-383) Gelsolin {Horse (Equus caballus) [TaxId: 9796]} Length = 121 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query273
d2fh1a296 Gelsolin {Human (Homo sapiens) [TaxId: 9606]} 99.71
d1j72a2116 Macrophage capping protein Cap G {Human (Homo sapi 99.68
d1svya_102 Severin, domain 2 {Dictyostelium discoideum [TaxId 99.67
d1kcqa_104 Gelsolin {Human (Homo sapiens) [TaxId: 9606]} 99.65
d2fh1a3113 Gelsolin {Human (Homo sapiens) [TaxId: 9606]} 99.55
d1j72a3107 Macrophage capping protein Cap G {Human (Homo sapi 99.41
d1d0na3121 Gelsolin {Horse (Equus caballus) [TaxId: 9796]} 99.4
d2vika_126 Villin, domain 1 (res. 1-126) {Chicken (Gallus gal 99.22
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.21
d1j72a1114 Macrophage capping protein Cap G {Human (Homo sapi 99.21
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.17
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.15
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.13
d3cipg1124 Gelsolin {Human (Homo sapiens) [TaxId: 9606]} 99.11
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.11
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.02
d2fh1a3113 Gelsolin {Human (Homo sapiens) [TaxId: 9606]} 98.96
d2ifga3156 High affinity nerve growth factor receptor, N-term 98.96
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 98.95
d2fh1a296 Gelsolin {Human (Homo sapiens) [TaxId: 9606]} 98.95
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 98.94
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 98.91
d1p9ag_266 von Willebrand factor binding domain of glycoprote 98.91
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 98.9
d1svya_102 Severin, domain 2 {Dictyostelium discoideum [TaxId 98.9
d2fh1a1121 Gelsolin {Human (Homo sapiens) [TaxId: 9606]} 98.89
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 98.85
d1kcqa_104 Gelsolin {Human (Homo sapiens) [TaxId: 9606]} 98.84
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 98.84
d1p9ag_266 von Willebrand factor binding domain of glycoprote 98.83
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 98.81
d1j72a2116 Macrophage capping protein Cap G {Human (Homo sapi 98.76
d1d0na3121 Gelsolin {Horse (Equus caballus) [TaxId: 9796]} 98.66
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.64
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 98.62
d1j72a3107 Macrophage capping protein Cap G {Human (Homo sapi 98.61
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.61
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 98.57
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.47
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 98.47
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 98.45
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 98.44
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.44
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 98.42
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 98.39
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 98.3
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.27
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 98.2
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 98.05
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 97.69
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 97.34
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 97.3
d1z7xw1 460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 96.82
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 96.58
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 96.49
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 96.34
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 96.14
d1pd0a4173 Sec24 {Baker's yeast (Saccharomyces cerevisiae) [T 96.09
d1pd0a4173 Sec24 {Baker's yeast (Saccharomyces cerevisiae) [T 95.93
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 95.89
d2fh1a1121 Gelsolin {Human (Homo sapiens) [TaxId: 9606]} 95.59
d3cipg1124 Gelsolin {Human (Homo sapiens) [TaxId: 9606]} 95.06
d1j72a1114 Macrophage capping protein Cap G {Human (Homo sapi 95.06
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 93.95
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 91.85
d2vika_126 Villin, domain 1 (res. 1-126) {Chicken (Gallus gal 91.72
>d2fh1a2 d.109.1.1 (A:533-628) Gelsolin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Gelsolin-like
superfamily: Actin depolymerizing proteins
family: Gelsolin-like
domain: Gelsolin
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.71  E-value=7.9e-18  Score=116.58  Aligned_cols=61  Identities=23%  Similarity=0.284  Sum_probs=56.0

Q ss_pred             eeeEEEEecCcccCCCCceEEEEecCCCCCCCCCCEEEEECCCeEEEEeCCCCCHHHHHHhhhhh
Q psy8923         162 TTRLYRVHAPLHQAQASSIHLEPVPVLSESLDPRFVFLLDAGLKLFIWNGPKAKNTFVFLLDAGL  226 (273)
Q Consensus       162 ~~~L~~v~g~~~~~~~~~~~~~ev~~~~ssL~s~dvfild~~~~~~vW~G~~s~~~e~~~~~~~~  226 (273)
                      .+|||||+|+    ...++++.||++++++||++||||||+++.+|+|.|++|+..||..|...|
T Consensus         3 ~~RLf~v~g~----~~~~~~~~EV~~~~ssLns~d~fILd~~~~iyvW~G~~s~~~er~~a~~~a   63 (96)
T d2fh1a2           3 STRLFQVRAN----SAGATRAVEVLPKAGALNSNDAFVLKTPSAAYLWVGTGASEAEKTGAQELL   63 (96)
T ss_dssp             SSEEEEEEEC----TTCCEEEEEECCSGGGCBTTSEEEEECSSCEEEEECTTCCHHHHHHHHHHH
T ss_pred             CcEEEEEECC----CCCeEEEEEeCCCHHHhCCCCeEEEECCCEEEEEECCCCCHHHHHHHHHHH
Confidence            4799999998    456788999999999999999999999999999999999999999988765



>d1j72a2 d.109.1.1 (A:125-240) Macrophage capping protein Cap G {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1svya_ d.109.1.1 (A:) Severin, domain 2 {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d1kcqa_ d.109.1.1 (A:) Gelsolin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fh1a3 d.109.1.1 (A:629-741) Gelsolin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j72a3 d.109.1.1 (A:241-347) Macrophage capping protein Cap G {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d0na3 d.109.1.1 (A:263-383) Gelsolin {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d2vika_ d.109.1.1 (A:) Villin, domain 1 (res. 1-126) {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1j72a1 d.109.1.1 (A:11-124) Macrophage capping protein Cap G {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d3cipg1 d.109.1.1 (G:2-125) Gelsolin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fh1a3 d.109.1.1 (A:629-741) Gelsolin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d2fh1a2 d.109.1.1 (A:533-628) Gelsolin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1svya_ d.109.1.1 (A:) Severin, domain 2 {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d2fh1a1 d.109.1.1 (A:412-532) Gelsolin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kcqa_ d.109.1.1 (A:) Gelsolin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j72a2 d.109.1.1 (A:125-240) Macrophage capping protein Cap G {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d0na3 d.109.1.1 (A:263-383) Gelsolin {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1j72a3 d.109.1.1 (A:241-347) Macrophage capping protein Cap G {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pd0a4 d.109.2.1 (A:754-926) Sec24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pd0a4 d.109.2.1 (A:754-926) Sec24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d2fh1a1 d.109.1.1 (A:412-532) Gelsolin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3cipg1 d.109.1.1 (G:2-125) Gelsolin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j72a1 d.109.1.1 (A:11-124) Macrophage capping protein Cap G {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2vika_ d.109.1.1 (A:) Villin, domain 1 (res. 1-126) {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure