Psyllid ID: psy8923
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 273 | ||||||
| 322792403 | 1241 | hypothetical protein SINV_11551 [Solenop | 0.435 | 0.095 | 0.717 | 2e-45 | |
| 332025894 | 1241 | Protein flightless-1 [Acromyrmex echinat | 0.435 | 0.095 | 0.717 | 3e-45 | |
| 270013772 | 1239 | hypothetical protein TcasGA2_TC012416 [T | 0.435 | 0.096 | 0.701 | 3e-45 | |
| 189240920 | 1238 | PREDICTED: similar to flightless-1 [Trib | 0.435 | 0.096 | 0.701 | 3e-45 | |
| 350411026 | 1239 | PREDICTED: protein flightless-1-like [Bo | 0.435 | 0.096 | 0.717 | 6e-45 | |
| 307204876 | 1256 | Protein flightless-1 [Harpegnathos salta | 0.435 | 0.094 | 0.709 | 6e-45 | |
| 340714520 | 1239 | PREDICTED: protein flightless-1-like iso | 0.435 | 0.096 | 0.717 | 9e-45 | |
| 340714522 | 1248 | PREDICTED: protein flightless-1-like iso | 0.435 | 0.095 | 0.717 | 9e-45 | |
| 307189820 | 1241 | Protein flightless-1 [Camponotus florida | 0.435 | 0.095 | 0.709 | 2e-44 | |
| 383863785 | 1239 | PREDICTED: protein flightless-1-like iso | 0.435 | 0.096 | 0.709 | 2e-44 |
| >gi|322792403|gb|EFZ16387.1| hypothetical protein SINV_11551 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
Score = 188 bits (478), Expect = 2e-45, Method: Compositional matrix adjust.
Identities = 89/124 (71%), Positives = 104/124 (83%), Gaps = 5/124 (4%)
Query: 95 KATLDKRACSAIHAVNLRNFLAAECRTIREEQGDESEEFLSLFNTGISYIEGGRTASGFF 154
KATLDKRAC+AIHAVNLRN+L A+CRTIREEQGDES+EFL LF++GI+YIEGGRT+SGF+
Sbjct: 552 KATLDKRACAAIHAVNLRNYLGAQCRTIREEQGDESDEFLMLFDSGITYIEGGRTSSGFY 611
Query: 155 TVEDTVYTTRLYRVHAPLHQAQASSIHLEPVPVLSESLDPRFVFLLDAGLKLFIWNGPKA 214
TVEDT TRLYRVHA +SIHLEPVPV ESLDP +VF+LD G K+F+W G KA
Sbjct: 612 TVEDTPAITRLYRVHAA-----GASIHLEPVPVCIESLDPDYVFVLDTGNKIFMWYGKKA 666
Query: 215 KNTF 218
K+T
Sbjct: 667 KSTL 670
|
Source: Solenopsis invicta Species: Solenopsis invicta Genus: Solenopsis Family: Formicidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|332025894|gb|EGI66050.1| Protein flightless-1 [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|270013772|gb|EFA10220.1| hypothetical protein TcasGA2_TC012416 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|189240920|ref|XP_968304.2| PREDICTED: similar to flightless-1 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|350411026|ref|XP_003489215.1| PREDICTED: protein flightless-1-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|307204876|gb|EFN83431.1| Protein flightless-1 [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|340714520|ref|XP_003395775.1| PREDICTED: protein flightless-1-like isoform 1 [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|340714522|ref|XP_003395776.1| PREDICTED: protein flightless-1-like isoform 2 [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|307189820|gb|EFN74092.1| Protein flightless-1 [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|383863785|ref|XP_003707360.1| PREDICTED: protein flightless-1-like isoform 1 [Megachile rotundata] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 273 | ||||||
| FB|FBgn0000709 | 1256 | fliI "flightless I" [Drosophil | 0.432 | 0.093 | 0.634 | 4.9e-67 | |
| UNIPROTKB|J3QLG3 | 1258 | FLII "Protein flightless-1 hom | 0.413 | 0.089 | 0.666 | 4.5e-58 | |
| UNIPROTKB|Q13045 | 1269 | FLII "Protein flightless-1 hom | 0.413 | 0.089 | 0.666 | 4.8e-58 | |
| UNIPROTKB|F1N365 | 1268 | FLII "Uncharacterized protein" | 0.413 | 0.089 | 0.666 | 1.6e-57 | |
| UNIPROTKB|F1PUU4 | 1273 | FLII "Uncharacterized protein" | 0.413 | 0.088 | 0.666 | 2e-57 | |
| UNIPROTKB|J9P2Y3 | 1278 | FLII "Uncharacterized protein" | 0.413 | 0.088 | 0.666 | 2.1e-57 | |
| MGI|MGI:1342286 | 1271 | Flii "flightless I homolog (Dr | 0.413 | 0.088 | 0.666 | 4.1e-56 | |
| RGD|1307590 | 1270 | Flii "flightless I homolog (Dr | 0.413 | 0.088 | 0.658 | 2.4e-55 | |
| ZFIN|ZDB-GENE-071212-3 | 1260 | flii "flightless I homolog (Dr | 0.410 | 0.088 | 0.655 | 3e-53 | |
| UNIPROTKB|E1C6H2 | 1201 | FLII "Uncharacterized protein" | 0.413 | 0.094 | 0.683 | 2.6e-51 |
| FB|FBgn0000709 fliI "flightless I" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 408 (148.7 bits), Expect = 4.9e-67, Sum P(4) = 4.9e-67
Identities = 78/123 (63%), Positives = 96/123 (78%)
Query: 95 KATLDKRACSAIHAVNLRNFLAAECRTIREEQGDESEEFLSLFNTGISYIEGGRTASGFF 154
+ATLDKRAC+AIHAVNLRNFL A CRT+REEQGDESE+FLSLF T + YIEGGRTA+GF+
Sbjct: 550 EATLDKRACAAIHAVNLRNFLGARCRTVREEQGDESEQFLSLFETEVIYIEGGRTATGFY 609
Query: 155 TVEDTVYTTRLYRVHAPLHQAQASSIHLEPVPVLSESLDPRFVFLLDAGLKLFIWNGPKA 214
T+E+ ++ TRLY VHA ++IHLEPV SLDPR F+LD G ++IW G ++
Sbjct: 610 TIEEMIHITRLYLVHA-----YGATIHLEPVAPAITSLDPRHAFVLDLGTHIYIWMGERS 664
Query: 215 KNT 217
KNT
Sbjct: 665 KNT 667
|
|
| UNIPROTKB|J3QLG3 FLII "Protein flightless-1 homolog" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q13045 FLII "Protein flightless-1 homolog" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1N365 FLII "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PUU4 FLII "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|J9P2Y3 FLII "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1342286 Flii "flightless I homolog (Drosophila)" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|1307590 Flii "flightless I homolog (Drosophila)" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-071212-3 flii "flightless I homolog (Drosophila)" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E1C6H2 FLII "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 273 | |||
| cd11290 | 113 | cd11290, gelsolin_S1_like, Gelsolin sub-domain 1-l | 2e-23 | |
| cd11280 | 88 | cd11280, gelsolin_like, Tandemly repeated domains | 4e-09 | |
| smart00262 | 90 | smart00262, GEL, Gelsolin homology domain | 5e-06 | |
| pfam00626 | 76 | pfam00626, Gelsolin, Gelsolin repeat | 4e-05 | |
| COG4886 | 394 | COG4886, COG4886, Leucine-rich repeat (LRR) protei | 6e-05 | |
| cd11289 | 92 | cd11289, gelsolin_S2_like, Gelsolin sub-domain 2-l | 7e-05 | |
| pfam12799 | 43 | pfam12799, LRR_4, Leucine Rich repeats (2 copies) | 8e-05 | |
| smart00262 | 90 | smart00262, GEL, Gelsolin homology domain | 1e-04 | |
| pfam13855 | 60 | pfam13855, LRR_8, Leucine rich repeat | 2e-04 | |
| pfam13855 | 60 | pfam13855, LRR_8, Leucine rich repeat | 2e-04 | |
| cd11289 | 92 | cd11289, gelsolin_S2_like, Gelsolin sub-domain 2-l | 3e-04 | |
| smart00262 | 90 | smart00262, GEL, Gelsolin homology domain | 0.001 | |
| cd11280 | 88 | cd11280, gelsolin_like, Tandemly repeated domains | 0.003 | |
| COG4886 | 394 | COG4886, COG4886, Leucine-rich repeat (LRR) protei | 0.003 | |
| cd11292 | 98 | cd11292, gelsolin_S3_like, Gelsolin sub-domain 3-l | 0.003 | |
| cd11288 | 92 | cd11288, gelsolin_S5_like, Gelsolin sub-domain 5-l | 0.003 |
| >gnl|CDD|200446 cd11290, gelsolin_S1_like, Gelsolin sub-domain 1-like domain found in gelsolin, severin, villin, and related proteins | Back alignment and domain information |
|---|
Score = 91.5 bits (228), Expect = 2e-23
Identities = 27/54 (50%), Positives = 33/54 (61%)
Query: 94 TKATLDKRACSAIHAVNLRNFLAAECRTIREEQGDESEEFLSLFNTGISYIEGG 147
+A+ D+ +AI AV L ++L RE QG ESEEFLS F GI YIEGG
Sbjct: 60 KEASQDEAGAAAIKAVELDDYLGGRPVQHREVQGHESEEFLSYFKKGIIYIEGG 113
|
Gelsolin repeats occur in gelsolin, severin, villin, advillin, villidin, supervillin, flightless, quail, fragmin, and other proteins, usually in several copies. They co-occur with villin headpiece domains, leucine-rich repeats, and several other domains. These gelsolin-related actin binding proteins (GRABPs) play regulatory roles in the assembly and disassembly of actin filaments; they are involved in F-actin capping, uncapping, severing, or the nucleation of actin filaments. Severing of actin filaments is Ca2+ dependent. Villins are also linked to generating bundles of F-actin with uniform filament polarity, which is most likely mediated by their extra villin headpiece domain. Many family members have also adopted functions in the nucleus, including the regulation of transcription. Supervillin, gelsolin, and flightless I are involved in intracellular signaling via nuclear hormone receptors. The gelsolin_like domain is distantly related to the actin depolymerizing domains found in cofilin and similar proteins. Length = 113 |
| >gnl|CDD|200436 cd11280, gelsolin_like, Tandemly repeated domains found in gelsolin, severin, villin, and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|214590 smart00262, GEL, Gelsolin homology domain | Back alignment and domain information |
|---|
| >gnl|CDD|201354 pfam00626, Gelsolin, Gelsolin repeat | Back alignment and domain information |
|---|
| >gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|200445 cd11289, gelsolin_S2_like, Gelsolin sub-domain 2-like domain found in gelsolin, severin, villin, and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|205079 pfam12799, LRR_4, Leucine Rich repeats (2 copies) | Back alignment and domain information |
|---|
| >gnl|CDD|214590 smart00262, GEL, Gelsolin homology domain | Back alignment and domain information |
|---|
| >gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat | Back alignment and domain information |
|---|
| >gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat | Back alignment and domain information |
|---|
| >gnl|CDD|200445 cd11289, gelsolin_S2_like, Gelsolin sub-domain 2-like domain found in gelsolin, severin, villin, and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|214590 smart00262, GEL, Gelsolin homology domain | Back alignment and domain information |
|---|
| >gnl|CDD|200436 cd11280, gelsolin_like, Tandemly repeated domains found in gelsolin, severin, villin, and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|200448 cd11292, gelsolin_S3_like, Gelsolin sub-domain 3-like domain found in gelsolin, severin, villin, and related proteins | Back alignment and domain information |
|---|
| >gnl|CDD|200444 cd11288, gelsolin_S5_like, Gelsolin sub-domain 5-like domain found in gelsolin, severin, villin, and related proteins | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 273 | |||
| KOG0443|consensus | 827 | 100.0 | ||
| KOG0443|consensus | 827 | 100.0 | ||
| KOG0444|consensus | 1255 | 100.0 | ||
| KOG0445|consensus | 919 | 99.6 | ||
| KOG0444|consensus | 1255 | 99.58 | ||
| smart00262 | 90 | GEL Gelsolin homology domain. Gelsolin/severin/vil | 99.36 | |
| KOG0445|consensus | 919 | 99.27 | ||
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 99.21 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 99.17 | |
| KOG0617|consensus | 264 | 99.11 | ||
| PF00626 | 76 | Gelsolin: Gelsolin repeat; InterPro: IPR007123 Gel | 98.95 | |
| KOG0617|consensus | 264 | 98.85 | ||
| smart00262 | 90 | GEL Gelsolin homology domain. Gelsolin/severin/vil | 98.85 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 98.77 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 98.77 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 98.75 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 98.74 | |
| PF00626 | 76 | Gelsolin: Gelsolin repeat; InterPro: IPR007123 Gel | 98.72 | |
| KOG4194|consensus | 873 | 98.69 | ||
| KOG0472|consensus | 565 | 98.64 | ||
| PLN03150 | 623 | hypothetical protein; Provisional | 98.58 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 98.56 | |
| KOG4237|consensus | 498 | 98.55 | ||
| KOG0472|consensus | 565 | 98.53 | ||
| KOG4194|consensus | 873 | 98.49 | ||
| KOG4579|consensus | 177 | 98.26 | ||
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 98.26 | |
| KOG1259|consensus | 490 | 98.25 | ||
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 98.22 | |
| KOG4237|consensus | 498 | 98.16 | ||
| KOG0532|consensus | 722 | 98.11 | ||
| KOG0618|consensus | 1081 | 98.08 | ||
| KOG0532|consensus | 722 | 98.07 | ||
| KOG0618|consensus | 1081 | 98.03 | ||
| KOG4579|consensus | 177 | 97.97 | ||
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 97.97 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 97.93 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 97.92 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 97.9 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 97.87 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 97.63 | |
| KOG1259|consensus | 490 | 97.55 | ||
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 97.54 | |
| KOG1859|consensus | 1096 | 97.43 | ||
| KOG0531|consensus | 414 | 97.43 | ||
| KOG1859|consensus | 1096 | 97.41 | ||
| PF00560 | 22 | LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le | 97.36 | |
| KOG4658|consensus | 889 | 97.3 | ||
| KOG1644|consensus | 233 | 97.16 | ||
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 97.1 | |
| KOG0531|consensus | 414 | 97.03 | ||
| PF13504 | 17 | LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO | 96.99 | |
| KOG4658|consensus | 889 | 96.99 | ||
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 96.97 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 96.92 | |
| PF00560 | 22 | LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le | 96.89 | |
| KOG2739|consensus | 260 | 96.84 | ||
| smart00370 | 26 | LRR Leucine-rich repeats, outliers. | 96.78 | |
| smart00369 | 26 | LRR_TYP Leucine-rich repeats, typical (most popula | 96.78 | |
| KOG1644|consensus | 233 | 96.62 | ||
| PF13504 | 17 | LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO | 96.15 | |
| smart00370 | 26 | LRR Leucine-rich repeats, outliers. | 96.09 | |
| smart00369 | 26 | LRR_TYP Leucine-rich repeats, typical (most popula | 96.09 | |
| KOG2739|consensus | 260 | 96.03 | ||
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 96.01 | |
| KOG3207|consensus | 505 | 95.96 | ||
| KOG3207|consensus | 505 | 95.34 | ||
| KOG2982|consensus | 418 | 95.18 | ||
| smart00364 | 26 | LRR_BAC Leucine-rich repeats, bacterial type. | 95.04 | |
| KOG2982|consensus | 418 | 95.03 | ||
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 94.95 | |
| KOG3665|consensus | 699 | 94.78 | ||
| KOG1984|consensus | 1007 | 94.77 | ||
| PF13306 | 129 | LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ | 94.39 | |
| KOG0473|consensus | 326 | 94.11 | ||
| KOG0473|consensus | 326 | 93.63 | ||
| smart00365 | 26 | LRR_SD22 Leucine-rich repeat, SDS22-like subfamily | 93.04 | |
| KOG2123|consensus | 388 | 92.75 | ||
| KOG1909|consensus | 382 | 92.66 | ||
| smart00364 | 26 | LRR_BAC Leucine-rich repeats, bacterial type. | 92.12 | |
| COG5028 | 861 | Vesicle coat complex COPII, subunit SEC24/subunit | 91.49 | |
| COG5028 | 861 | Vesicle coat complex COPII, subunit SEC24/subunit | 91.41 | |
| PTZ00395 | 1560 | Sec24-related protein; Provisional | 89.48 | |
| PF13306 | 129 | LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ | 89.23 | |
| KOG1909|consensus | 382 | 89.17 | ||
| KOG3665|consensus | 699 | 89.1 | ||
| PF13516 | 24 | LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI | 89.08 | |
| KOG1985|consensus | 887 | 88.83 | ||
| KOG1984|consensus | 1007 | 88.69 | ||
| PTZ00395 | 1560 | Sec24-related protein; Provisional | 87.18 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 86.83 | |
| KOG1985|consensus | 887 | 86.04 | ||
| KOG2123|consensus | 388 | 85.64 | ||
| smart00368 | 28 | LRR_RI Leucine rich repeat, ribonuclease inhibitor | 85.57 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 83.74 | |
| KOG2120|consensus | 419 | 81.4 |
| >KOG0443|consensus | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.1e-37 Score=280.66 Aligned_cols=223 Identities=27% Similarity=0.439 Sum_probs=187.3
Q ss_pred cCCccCCEeeccCCcCccCCCCcccc-CC-C--CCCEEecccCCCCCccchhhhhhhcccccchhccccccccchhhhhh
Q psy8923 41 TELQCLRTLNLRYNKIKNSGIPVDLF-HL-E--DLTTLDLSHNNIKQIPDALENAKRTKATLDKRACSAIHAVNLRNFLA 116 (273)
Q Consensus 41 ~~l~~L~~L~l~~N~l~~~~ip~~~~-~l-~--~L~~L~Ls~N~l~~ip~~l~~w~g~~~~~~~~~~~~l~~~~L~~~l~ 116 (273)
++=+.|+...+.+=.+.. +|..-. .. + .-..|.-..++-..+...|++|+|.+++.++.+++++.+++|++.||
T Consensus 16 g~~pGl~IWRIe~f~lv~--VP~s~~G~Fy~GdaYIvL~t~~~k~~~l~~DIHyWLGkd~S~dE~g~aAiktveLD~~Lg 93 (827)
T KOG0443|consen 16 GQKPGLEIWRIENFELVP--VPKSSHGKFYTGDAYIVLKTTLKKNGSLSYDIHYWLGKDSSQDEAGAAAIKTVELDDYLG 93 (827)
T ss_pred ccCCceEEEEeccCeeee--cchhccCceecCceEEEEehhhccCCccceeEEEEecCccchhhhcceeeeeEehhhhhC
Confidence 344667777776666665 776432 11 1 22233333445557778899999999999999999999999999999
Q ss_pred hhhhhcccccCCCchhhHhhccCCcEEecCCcccccceecccCcceeeEEEEecCcccCCCCceEEEEecCCCCCCCCCC
Q psy8923 117 AECRTIREEQGDESEEFLSLFNTGISYIEGGRTASGFFTVEDTVYTTRLYRVHAPLHQAQASSIHLEPVPVLSESLDPRF 196 (273)
Q Consensus 117 ~~~~~~~~~qg~e~~~fl~lf~~~i~~l~g~~~~s~~~~~~~~~~~~~L~~v~g~~~~~~~~~~~~~ev~~~~ssL~s~d 196 (273)
|.++|+|++||+|+..|++||+.++++.+|| ..+|++|++...+..|||||.|+ ++++++|||++|+|||.+|
T Consensus 94 g~~vQhREVQg~ES~~FLsYFK~gi~~~~GG-v~Sg~khv~~~~~~~rL~~~KGk------r~vr~~eV~~~~sS~N~gD 166 (827)
T KOG0443|consen 94 GRAVQHREVQGHESEKFLSYFKPGIIYQEGG-VASGFKHVETEEYQVRLFHCKGK------RNVRVKEVPFSWSSLNHGD 166 (827)
T ss_pred CCcceeehhcccchHHHHhhccCCceecccc-cccCcccccccceeeEEEEEccc------eeEEEEEEEeehhhcCCCc
Confidence 9999999999999999999999999999999 99999999999988899999999 8999999999999999999
Q ss_pred EEEEECCCeEEEEeCCCCCHHHHHHhhhhh---------------------------cccccc---C--C----------
Q psy8923 197 VFLLDAGLKLFIWNGPKAKNTFVFLLDAGL---------------------------KLFIWN---G--P---------- 234 (273)
Q Consensus 197 vfild~~~~~~vW~G~~s~~~e~~~~~~~~---------------------------~~~fw~---~--~---------- 234 (273)
|||||+++++|+|+|..|+..||.-|...+ ..+||. | +
T Consensus 167 vFILD~g~~i~qw~G~~Ss~~ER~KAl~~~~~IrD~e~~Gr~~V~vvdd~~~~~d~d~~~~~~~~~g~~~~~~~~~~~~~ 246 (827)
T KOG0443|consen 167 VFILDTGSKIYQWNGPNSSIQERAKALEVVQYIRDNERDGRCEVAVVDDGKEAADSDLGEFWGFVLGFAPALPKKSPDDD 246 (827)
T ss_pred EEEEEcCCceEEEcCCcccHHHHHHHHHHHHHhhccCCCCceeEEEecCcccccCchHHHHHHhhcCcCccCCCCCcchh
Confidence 999999999999999999999998876543 334554 1 0
Q ss_pred ----------------------------------CCCCceEEEEeCC-ceEEEEeCCCcchHhHHhHHHHhhh
Q psy8923 235 ----------------------------------KAKNTFVFLLDAG-LKLFIWNGPKAKNTFKSKTRLLAEK 272 (273)
Q Consensus 235 ----------------------------------~~~~~~v~~ld~~-~~~~~w~G~~a~~~~~~~~~~~~~~ 272 (273)
-..++++||||+| .+||||+|+.|+.+||+.|+..|+.
T Consensus 247 ~~~~~s~~~kLYkVsd~~g~l~v~~va~~~l~qdlLd~~dCYILD~g~~~IfVW~Gr~as~~ERkaAm~~Aee 319 (827)
T KOG0443|consen 247 DEQANSAAAKLYKVSDASGGLKVPVVADGPLTKDLLDTEDCYILDCGGGEIFVWKGRQASLDERKAAMSSAEE 319 (827)
T ss_pred hhhhhccccEEEEEeccCCCccccccccchhhHHhhccCCeEEEecCCceEEEEeCCCCCHHHHHHHHHHHHH
Confidence 0123459999999 9999999999999999999998875
|
|
| >KOG0443|consensus | Back alignment and domain information |
|---|
| >KOG0444|consensus | Back alignment and domain information |
|---|
| >KOG0445|consensus | Back alignment and domain information |
|---|
| >KOG0444|consensus | Back alignment and domain information |
|---|
| >smart00262 GEL Gelsolin homology domain | Back alignment and domain information |
|---|
| >KOG0445|consensus | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0617|consensus | Back alignment and domain information |
|---|
| >PF00626 Gelsolin: Gelsolin repeat; InterPro: IPR007123 Gelsolin is a cytoplasmic, calcium-regulated, actin-modulating protein that binds to the barbed ends of actin filaments, preventing monomer exchange (end-blocking or capping) [] | Back alignment and domain information |
|---|
| >KOG0617|consensus | Back alignment and domain information |
|---|
| >smart00262 GEL Gelsolin homology domain | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >PF00626 Gelsolin: Gelsolin repeat; InterPro: IPR007123 Gelsolin is a cytoplasmic, calcium-regulated, actin-modulating protein that binds to the barbed ends of actin filaments, preventing monomer exchange (end-blocking or capping) [] | Back alignment and domain information |
|---|
| >KOG4194|consensus | Back alignment and domain information |
|---|
| >KOG0472|consensus | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >KOG4237|consensus | Back alignment and domain information |
|---|
| >KOG0472|consensus | Back alignment and domain information |
|---|
| >KOG4194|consensus | Back alignment and domain information |
|---|
| >KOG4579|consensus | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >KOG1259|consensus | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >KOG4237|consensus | Back alignment and domain information |
|---|
| >KOG0532|consensus | Back alignment and domain information |
|---|
| >KOG0618|consensus | Back alignment and domain information |
|---|
| >KOG0532|consensus | Back alignment and domain information |
|---|
| >KOG0618|consensus | Back alignment and domain information |
|---|
| >KOG4579|consensus | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1259|consensus | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >KOG1859|consensus | Back alignment and domain information |
|---|
| >KOG0531|consensus | Back alignment and domain information |
|---|
| >KOG1859|consensus | Back alignment and domain information |
|---|
| >PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >KOG4658|consensus | Back alignment and domain information |
|---|
| >KOG1644|consensus | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >KOG0531|consensus | Back alignment and domain information |
|---|
| >PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D | Back alignment and domain information |
|---|
| >KOG4658|consensus | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >KOG2739|consensus | Back alignment and domain information |
|---|
| >smart00370 LRR Leucine-rich repeats, outliers | Back alignment and domain information |
|---|
| >smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily | Back alignment and domain information |
|---|
| >KOG1644|consensus | Back alignment and domain information |
|---|
| >PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D | Back alignment and domain information |
|---|
| >smart00370 LRR Leucine-rich repeats, outliers | Back alignment and domain information |
|---|
| >smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily | Back alignment and domain information |
|---|
| >KOG2739|consensus | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >KOG3207|consensus | Back alignment and domain information |
|---|
| >KOG3207|consensus | Back alignment and domain information |
|---|
| >KOG2982|consensus | Back alignment and domain information |
|---|
| >smart00364 LRR_BAC Leucine-rich repeats, bacterial type | Back alignment and domain information |
|---|
| >KOG2982|consensus | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >KOG3665|consensus | Back alignment and domain information |
|---|
| >KOG1984|consensus | Back alignment and domain information |
|---|
| >PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A | Back alignment and domain information |
|---|
| >KOG0473|consensus | Back alignment and domain information |
|---|
| >KOG0473|consensus | Back alignment and domain information |
|---|
| >smart00365 LRR_SD22 Leucine-rich repeat, SDS22-like subfamily | Back alignment and domain information |
|---|
| >KOG2123|consensus | Back alignment and domain information |
|---|
| >KOG1909|consensus | Back alignment and domain information |
|---|
| >smart00364 LRR_BAC Leucine-rich repeats, bacterial type | Back alignment and domain information |
|---|
| >COG5028 Vesicle coat complex COPII, subunit SEC24/subunit SFB2/subunit SFB3 [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >COG5028 Vesicle coat complex COPII, subunit SEC24/subunit SFB2/subunit SFB3 [Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PTZ00395 Sec24-related protein; Provisional | Back alignment and domain information |
|---|
| >PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A | Back alignment and domain information |
|---|
| >KOG1909|consensus | Back alignment and domain information |
|---|
| >KOG3665|consensus | Back alignment and domain information |
|---|
| >PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A | Back alignment and domain information |
|---|
| >KOG1985|consensus | Back alignment and domain information |
|---|
| >KOG1984|consensus | Back alignment and domain information |
|---|
| >PTZ00395 Sec24-related protein; Provisional | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1985|consensus | Back alignment and domain information |
|---|
| >KOG2123|consensus | Back alignment and domain information |
|---|
| >smart00368 LRR_RI Leucine rich repeat, ribonuclease inhibitor type | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2120|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 273 | ||||
| 1jhw_A | 347 | Ca2+-Binding Mimicry In The Crystal Structure Of Th | 1e-09 | ||
| 1j72_A | 347 | Crystal Structure Of Mutant Macrophage Capping Prot | 5e-09 | ||
| 1rgi_G | 346 | Crystal Structure Of Gelsolin Domains G1-G3 Bound T | 1e-08 | ||
| 2fgh_A | 731 | Atp Bound Gelsolin Length = 731 | 2e-08 | ||
| 1d0n_A | 729 | The Crystal Structure Of Calcium-Free Equine Plasma | 3e-08 | ||
| 3ffk_A | 377 | Crystal Structure Of Human Gelsolin Domains G1-G3 B | 5e-08 | ||
| 3ffn_A | 782 | Crystal Structure Of Calcium-Free Human Gelsolin Le | 9e-08 |
| >pdb|1JHW|A Chain A, Ca2+-Binding Mimicry In The Crystal Structure Of The Eu3+-Bound Mutant Human Macrophage Capping Protein Cap G Length = 347 | Back alignment and structure |
|
| >pdb|1J72|A Chain A, Crystal Structure Of Mutant Macrophage Capping Protein (Cap G) With Actin-Severing Activity In The Ca2+-Free Form Length = 347 | Back alignment and structure |
| >pdb|1RGI|G Chain G, Crystal Structure Of Gelsolin Domains G1-G3 Bound To Actin Length = 346 | Back alignment and structure |
| >pdb|2FGH|A Chain A, Atp Bound Gelsolin Length = 731 | Back alignment and structure |
| >pdb|1D0N|A Chain A, The Crystal Structure Of Calcium-Free Equine Plasma Gelsolin. Length = 729 | Back alignment and structure |
| >pdb|3FFK|A Chain A, Crystal Structure Of Human Gelsolin Domains G1-G3 Bound To Actin Length = 377 | Back alignment and structure |
| >pdb|3FFN|A Chain A, Crystal Structure Of Calcium-Free Human Gelsolin Length = 782 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 273 | |||
| 1d0n_A | 729 | Horse plasma gelsolin; mixed alpha-beta structure, | 1e-25 | |
| 1d0n_A | 729 | Horse plasma gelsolin; mixed alpha-beta structure, | 2e-18 | |
| 1d0n_A | 729 | Horse plasma gelsolin; mixed alpha-beta structure, | 2e-06 | |
| 1d0n_A | 729 | Horse plasma gelsolin; mixed alpha-beta structure, | 2e-05 | |
| 1j72_A | 347 | Macrophage capping protein; actin, human, CAP G, G | 1e-25 | |
| 1j72_A | 347 | Macrophage capping protein; actin, human, CAP G, G | 3e-07 | |
| 2fh1_A | 344 | Gelsolin; calcium, contractIle protein; 1.55A {Hom | 2e-19 | |
| 2fh1_A | 344 | Gelsolin; calcium, contractIle protein; 1.55A {Hom | 4e-05 | |
| 1t44_G | 147 | Chimera of gelsolin domain 1 and C-terminal domain | 2e-17 | |
| 3fg7_A | 398 | Villin-1; actin binding protein, gelsolin, actin c | 5e-17 | |
| 3fg7_A | 398 | Villin-1; actin binding protein, gelsolin, actin c | 1e-04 | |
| 3cip_G | 128 | Gelsolin; actin, dictyostelium discoideum, actin-a | 1e-16 | |
| 1svq_A | 114 | Severin; actin-binding; NMR {Dictyostelium discoid | 3e-16 | |
| 2ff3_A | 150 | Gelsolin; protein-protein complex, structural prot | 4e-16 | |
| 2vik_A | 126 | Villin 14T; actin-binding protein, capping protein | 1e-15 | |
| 3fg6_A | 371 | Adseverin, scinderin; C-terminus of adseverin, act | 4e-15 | |
| 3fg6_A | 371 | Adseverin, scinderin; C-terminus of adseverin, act | 3e-06 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 2e-11 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 4e-11 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 4e-08 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 8e-08 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 8e-08 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 2e-07 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 3e-07 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 2e-06 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 1e-05 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 1e-05 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 2e-05 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 7e-05 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 1e-04 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 1e-04 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 6e-04 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 1e-10 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 8e-10 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 2e-08 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 2e-08 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 4e-08 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 2e-07 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 3e-07 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 9e-07 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 1e-06 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 2e-06 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 2e-06 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 3e-04 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 1e-10 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 5e-10 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 1e-09 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 4e-09 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 7e-07 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 2e-10 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 2e-08 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 4e-05 | |
| 1kcq_A | 104 | Gelsolin, brevin, ADF, AGEL; alpha-beta structure, | 4e-10 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 6e-10 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 2e-08 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 1e-07 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 3e-07 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 5e-07 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 6e-07 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 6e-06 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 2e-05 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 4e-05 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 7e-10 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 2e-08 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 6e-08 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 6e-07 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 4e-06 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 3e-05 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 8e-10 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 2e-08 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 2e-08 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 7e-08 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 7e-06 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 9e-05 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 9e-10 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 3e-08 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 2e-07 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 6e-07 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 6e-07 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 7e-07 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 5e-06 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 3e-05 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 6e-05 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 3e-09 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 2e-07 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 2e-07 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 2e-07 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 1e-06 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 2e-06 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 4e-04 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 3e-09 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 6e-08 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 1e-07 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 3e-07 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 5e-07 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 3e-06 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 3e-06 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 5e-06 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 2e-05 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 3e-05 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 7e-05 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 2e-04 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 4e-09 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 1e-07 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 2e-07 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 2e-07 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 5e-07 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 1e-06 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 4e-06 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 5e-06 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 7e-06 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 1e-05 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 4e-05 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 6e-05 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 1e-04 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 1e-04 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 2e-04 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 7e-09 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 1e-08 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 9e-08 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 1e-07 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 1e-06 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 9e-06 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 4e-05 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 5e-04 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 1e-08 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 4e-08 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 5e-08 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 1e-06 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 3e-06 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 4e-06 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 5e-06 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 2e-05 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 9e-05 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 9e-05 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 9e-05 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 1e-04 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 1e-04 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 4e-04 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 2e-08 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 2e-07 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 6e-07 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 2e-08 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 7e-08 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 8e-08 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 1e-07 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 2e-07 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 5e-07 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 6e-07 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 8e-05 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 1e-04 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 1e-04 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 4e-04 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 2e-08 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 6e-07 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 1e-06 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 2e-08 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 5e-08 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 1e-07 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 4e-06 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 1e-05 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 2e-05 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 2e-05 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 8e-05 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 2e-04 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 2e-08 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 5e-08 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 9e-08 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 1e-07 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 2e-07 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 2e-07 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 3e-06 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 1e-05 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 4e-05 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 4e-04 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 3e-08 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 2e-06 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 1e-05 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 4e-08 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 5e-08 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 9e-08 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 2e-07 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 6e-07 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 2e-06 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 2e-06 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 3e-05 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 5e-05 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 4e-08 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 6e-08 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 7e-08 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 5e-07 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 5e-07 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 3e-06 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 1e-05 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 4e-08 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 1e-07 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 5e-07 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 1e-06 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 2e-06 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 2e-06 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 3e-05 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 3e-04 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 4e-04 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 4e-08 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 3e-05 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 5e-08 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 6e-08 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 8e-08 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 1e-07 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 1e-07 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 1e-07 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 2e-07 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 5e-07 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 1e-06 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 6e-06 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 1e-05 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 1e-05 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 4e-05 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 8e-05 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 6e-08 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 2e-06 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 3e-06 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 2e-05 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 2e-05 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 2e-05 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 5e-05 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 7e-08 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 7e-08 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 6e-07 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 2e-06 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 4e-06 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 7e-05 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 5e-04 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 8e-08 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 2e-07 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 3e-06 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 3e-06 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 7e-05 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 6e-04 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 8e-08 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 2e-07 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 6e-07 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 4e-06 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 7e-05 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 1e-04 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 1e-07 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 2e-07 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 3e-06 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 3e-06 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 6e-06 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 7e-04 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 1e-07 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 2e-07 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 8e-07 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 8e-06 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 7e-04 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 1e-07 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 3e-07 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 5e-07 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 7e-07 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 8e-07 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 1e-06 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 3e-06 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 5e-06 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 1e-04 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 5e-04 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 6e-04 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 2e-07 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 4e-06 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 5e-05 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 2e-04 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 6e-04 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 2e-07 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 2e-06 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 7e-06 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 5e-04 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 2e-07 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 3e-06 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 9e-06 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 5e-05 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 6e-05 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 8e-05 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 3e-07 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 2e-06 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 1e-04 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 3e-07 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 4e-07 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 5e-06 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 5e-04 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 4e-07 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 2e-05 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 1e-04 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 1e-04 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 5e-07 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 7e-07 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 1e-06 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 2e-05 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 3e-05 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 5e-05 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 5e-07 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 2e-06 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 2e-06 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 2e-06 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 3e-06 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 3e-06 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 5e-06 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 8e-06 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 1e-05 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 2e-05 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 2e-05 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 6e-07 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 1e-06 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 2e-06 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 3e-06 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 4e-06 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 6e-06 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 6e-06 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 2e-05 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 5e-05 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 8e-05 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 2e-04 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 6e-04 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 9e-07 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 3e-06 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 7e-05 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 2e-04 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 1e-06 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 1e-06 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 2e-06 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 1e-06 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 1e-06 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 3e-06 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 3e-06 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 6e-06 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 2e-05 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 2e-05 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 3e-05 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 5e-05 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 7e-05 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 1e-04 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 2e-04 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 4e-04 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 5e-04 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 1e-06 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 2e-06 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 5e-06 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 2e-05 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 3e-05 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 3e-05 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 2e-04 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 2e-06 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 3e-06 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 1e-05 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 2e-05 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 2e-05 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 6e-05 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 6e-05 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 8e-05 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 9e-05 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 1e-04 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 5e-04 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 2e-06 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 7e-06 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 1e-05 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 2e-05 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 2e-06 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 7e-06 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 4e-05 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 4e-04 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 2e-06 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 8e-06 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 9e-06 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 1e-05 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 9e-05 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 3e-06 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 3e-06 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 2e-05 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 8e-05 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 1e-04 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 4e-06 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 1e-05 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 6e-06 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 7e-06 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 6e-06 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 8e-06 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 6e-06 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 7e-06 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 2e-05 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 1e-04 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 7e-04 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 8e-06 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 2e-05 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 6e-04 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-05 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 3e-05 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 1e-04 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 2e-04 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 6e-04 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 8e-04 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 4e-05 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 1e-04 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 1e-04 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 2e-04 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 3e-04 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 5e-04 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 6e-04 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 4e-04 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 8e-04 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 6e-04 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 9e-04 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 7e-04 |
| >1d0n_A Horse plasma gelsolin; mixed alpha-beta structure, actin-binding protein, protein D packing, contractIle protein; 2.50A {Equus caballus} SCOP: d.109.1.1 d.109.1.1 d.109.1.1 d.109.1.1 d.109.1.1 d.109.1.1 PDB: 2fgh_A* 3ffn_A 3ffk_A* 1rgi_G* Length = 729 | Back alignment and structure |
|---|
Score = 105 bits (262), Expect = 1e-25
Identities = 36/121 (29%), Positives = 54/121 (44%), Gaps = 6/121 (4%)
Query: 95 KATLDKRACSAIHAVNLRNFLAAECRTIREEQGDESEEFLSLFNTGISYIEGGRTASGFF 154
+ + D+ +AI V L ++L RE QG ES FL F +G+ Y +GG +
Sbjct: 66 ECSQDESGAAAIFTVQLDDYLNGRAVQHREVQGFESATFLGYFKSGLKYKKGGVASGFKH 125
Query: 155 TVEDTVYTTRLYRVHAPLHQAQASSIHLEPVPVLSESLDPRFVFLLDAGLKLFIWNGPKA 214
V + V RL +V + VPV ES + F+LD G ++ W G K+
Sbjct: 126 VVPNEVVVQRLLQVKGRRV------VRATEVPVSWESFNNGDCFILDLGNNIYQWCGSKS 179
Query: 215 K 215
Sbjct: 180 N 180
|
| >1d0n_A Horse plasma gelsolin; mixed alpha-beta structure, actin-binding protein, protein D packing, contractIle protein; 2.50A {Equus caballus} SCOP: d.109.1.1 d.109.1.1 d.109.1.1 d.109.1.1 d.109.1.1 d.109.1.1 PDB: 2fgh_A* 3ffn_A 3ffk_A* 1rgi_G* Length = 729 | Back alignment and structure |
|---|
| >1d0n_A Horse plasma gelsolin; mixed alpha-beta structure, actin-binding protein, protein D packing, contractIle protein; 2.50A {Equus caballus} SCOP: d.109.1.1 d.109.1.1 d.109.1.1 d.109.1.1 d.109.1.1 d.109.1.1 PDB: 2fgh_A* 3ffn_A 3ffk_A* 1rgi_G* Length = 729 | Back alignment and structure |
|---|
| >1d0n_A Horse plasma gelsolin; mixed alpha-beta structure, actin-binding protein, protein D packing, contractIle protein; 2.50A {Equus caballus} SCOP: d.109.1.1 d.109.1.1 d.109.1.1 d.109.1.1 d.109.1.1 d.109.1.1 PDB: 2fgh_A* 3ffn_A 3ffk_A* 1rgi_G* Length = 729 | Back alignment and structure |
|---|
| >1j72_A Macrophage capping protein; actin, human, CAP G, GCAP39, MBHL, GELS structural protein; 2.50A {Homo sapiens} SCOP: d.109.1.1 d.109.1.1 d.109.1.1 PDB: 1jhw_A Length = 347 | Back alignment and structure |
|---|
| >1j72_A Macrophage capping protein; actin, human, CAP G, GCAP39, MBHL, GELS structural protein; 2.50A {Homo sapiens} SCOP: d.109.1.1 d.109.1.1 d.109.1.1 PDB: 1jhw_A Length = 347 | Back alignment and structure |
|---|
| >2fh1_A Gelsolin; calcium, contractIle protein; 1.55A {Homo sapiens} SCOP: d.109.1.1 d.109.1.1 d.109.1.1 PDB: 1p8x_A 2fh2_A 2fh3_A 2fh4_A 1h1v_G* 1nph_A Length = 344 | Back alignment and structure |
|---|
| >2fh1_A Gelsolin; calcium, contractIle protein; 1.55A {Homo sapiens} SCOP: d.109.1.1 d.109.1.1 d.109.1.1 PDB: 1p8x_A 2fh2_A 2fh3_A 2fh4_A 1h1v_G* 1nph_A Length = 344 | Back alignment and structure |
|---|
| >1t44_G Chimera of gelsolin domain 1 and C-terminal domain of thymosin beta-4; structural protein; HET: ATP; 2.00A {Homo sapiens} SCOP: d.109.1.1 Length = 147 | Back alignment and structure |
|---|
| >3fg7_A Villin-1; actin binding protein, gelsolin, actin capping, actin-binding, calcium, cytoplasm, cytoskeleton, structural protein; 2.00A {Homo sapiens} Length = 398 | Back alignment and structure |
|---|
| >3fg7_A Villin-1; actin binding protein, gelsolin, actin capping, actin-binding, calcium, cytoplasm, cytoskeleton, structural protein; 2.00A {Homo sapiens} Length = 398 | Back alignment and structure |
|---|
| >3cip_G Gelsolin; actin, dictyostelium discoideum, actin-associated methyl histidine, ATP-binding, cytoskeleton, nucleotide-BIN phosphoprotein; HET: HIC ATP; 1.60A {Homo sapiens} SCOP: d.109.1.1 PDB: 3ci5_G* 1p8z_G* 1d4x_G* 1nlv_G* 1mdu_A* 1nm1_G* 1nmd_G* 1yag_G* 1yvn_G* 3cjb_G* 3cjc_G* 1esv_S* 1eqy_S* 1c0g_S* 1c0f_S* 1dej_S* 3a5l_S* 3a5m_S* 3a5n_S* 3a5o_S* Length = 128 | Back alignment and structure |
|---|
| >1svq_A Severin; actin-binding; NMR {Dictyostelium discoideum} SCOP: d.109.1.1 PDB: 1svr_A 1svy_A Length = 114 | Back alignment and structure |
|---|
| >2ff3_A Gelsolin; protein-protein complex, structural protein/contractIle protein complex; HET: ATP; 2.00A {Homo sapiens} SCOP: d.109.1.1 PDB: 2ff6_G* Length = 150 | Back alignment and structure |
|---|
| >2vik_A Villin 14T; actin-binding protein, capping protein, calcium-binding protein, cytoskeletal protein; NMR {Gallus gallus} SCOP: d.109.1.1 PDB: 2vil_A Length = 126 | Back alignment and structure |
|---|
| >3fg6_A Adseverin, scinderin; C-terminus of adseverin, actin capping, actin-binding, cytos phosphoprotein, actin-binding protein; 3.00A {Homo sapiens} Length = 371 | Back alignment and structure |
|---|
| >3fg6_A Adseverin, scinderin; C-terminus of adseverin, actin capping, actin-binding, cytos phosphoprotein, actin-binding protein; 3.00A {Homo sapiens} Length = 371 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 | Back alignment and structure |
|---|
| >1kcq_A Gelsolin, brevin, ADF, AGEL; alpha-beta structure, actin-binding protein, familial amyloi finnish type, cadmium binding, metal binding; 1.65A {Homo sapiens} SCOP: d.109.1.1 Length = 104 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Length = 170 | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Length = 174 | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Length = 177 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 273 | |||
| 1j72_A | 347 | Macrophage capping protein; actin, human, CAP G, G | 100.0 | |
| 3fg6_A | 371 | Adseverin, scinderin; C-terminus of adseverin, act | 100.0 | |
| 3fg7_A | 398 | Villin-1; actin binding protein, gelsolin, actin c | 100.0 | |
| 2fh1_A | 344 | Gelsolin; calcium, contractIle protein; 1.55A {Hom | 100.0 | |
| 1d0n_A | 729 | Horse plasma gelsolin; mixed alpha-beta structure, | 100.0 | |
| 1d0n_A | 729 | Horse plasma gelsolin; mixed alpha-beta structure, | 100.0 | |
| 1svq_A | 114 | Severin; actin-binding; NMR {Dictyostelium discoid | 99.76 | |
| 1j72_A | 347 | Macrophage capping protein; actin, human, CAP G, G | 99.71 | |
| 1kcq_A | 104 | Gelsolin, brevin, ADF, AGEL; alpha-beta structure, | 99.71 | |
| 3tu5_B | 297 | Gelsolin, protein cordon-BLeu, thymosin beta-4; un | 99.68 | |
| 3fg7_A | 398 | Villin-1; actin binding protein, gelsolin, actin c | 99.56 | |
| 3fg6_A | 371 | Adseverin, scinderin; C-terminus of adseverin, act | 99.51 | |
| 2fh1_A | 344 | Gelsolin; calcium, contractIle protein; 1.55A {Hom | 99.46 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 99.31 | |
| 1t44_G | 147 | Chimera of gelsolin domain 1 and C-terminal domain | 99.27 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 99.25 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 99.25 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 99.25 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 99.23 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.22 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 99.22 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 99.21 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 99.2 | |
| 2ff3_A | 150 | Gelsolin; protein-protein complex, structural prot | 99.19 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 99.19 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 99.19 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 99.18 | |
| 3cip_G | 128 | Gelsolin; actin, dictyostelium discoideum, actin-a | 99.18 | |
| 2vik_A | 126 | Villin 14T; actin-binding protein, capping protein | 99.16 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 99.16 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.16 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 99.14 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 99.14 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 99.14 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 99.12 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 99.12 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 99.11 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 99.11 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 99.11 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 99.11 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 99.09 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 99.09 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 99.09 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 99.07 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 99.06 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 99.05 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 99.05 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 99.04 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 99.04 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 99.02 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 99.02 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 99.01 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 99.01 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 99.01 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 98.99 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 98.98 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.97 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 98.97 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 98.97 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 98.96 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 98.95 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 98.94 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 98.94 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 98.93 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 98.93 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 98.93 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 98.93 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 98.92 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 98.9 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.9 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 98.9 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 98.89 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 98.89 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 98.89 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 98.88 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 98.88 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 98.88 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 98.88 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 98.88 | |
| 1kcq_A | 104 | Gelsolin, brevin, ADF, AGEL; alpha-beta structure, | 98.87 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 98.87 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 98.87 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 98.87 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 98.87 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 98.86 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 98.86 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 98.85 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 98.85 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 98.85 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 98.85 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 98.84 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.84 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 98.84 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 98.82 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 98.82 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 98.81 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 98.81 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.8 | |
| 1svq_A | 114 | Severin; actin-binding; NMR {Dictyostelium discoid | 98.8 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 98.79 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 98.78 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 98.77 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 98.77 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 98.77 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 98.77 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 98.76 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 98.76 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 98.76 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 98.75 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 98.75 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 98.74 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 98.74 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 98.74 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 98.72 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 98.72 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 98.72 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 98.72 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 98.7 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 98.7 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 98.69 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 98.68 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 98.68 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 98.68 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 98.68 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 98.68 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 98.67 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 98.67 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 98.66 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 98.66 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 98.65 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 98.65 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 98.63 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 98.61 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 98.6 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 98.58 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 98.58 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 98.57 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 98.56 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 98.54 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 98.52 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 98.51 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 98.48 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 98.45 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 98.44 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 98.42 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 98.41 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 98.39 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 98.37 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 98.18 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 98.15 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 98.09 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 98.06 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 97.96 | |
| 3rfe_A | 130 | Platelet glycoprotein IB beta chain; platelet surf | 97.95 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 97.89 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 97.81 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 97.72 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 97.56 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 97.55 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 97.52 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 97.51 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 97.48 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 97.37 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 97.29 | |
| 3rfe_A | 130 | Platelet glycoprotein IB beta chain; platelet surf | 97.27 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 97.22 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 97.14 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 96.91 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 96.85 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 96.77 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 96.62 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 96.04 | |
| 4h09_A | 379 | Hypothetical leucine rich repeat protein; two LRR_ | 95.83 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 95.78 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 95.64 | |
| 4h09_A | 379 | Hypothetical leucine rich repeat protein; two LRR_ | 95.55 | |
| 3tu5_B | 297 | Gelsolin, protein cordon-BLeu, thymosin beta-4; un | 95.29 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 95.27 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 95.17 | |
| 4fs7_A | 394 | Uncharacterized protein; leucine-rich repeats, pro | 95.16 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 95.11 | |
| 4fs7_A | 394 | Uncharacterized protein; leucine-rich repeats, pro | 94.55 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 94.24 | |
| 2vik_A | 126 | Villin 14T; actin-binding protein, capping protein | 93.5 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 92.72 | |
| 3cip_G | 128 | Gelsolin; actin, dictyostelium discoideum, actin-a | 92.01 | |
| 2ff3_A | 150 | Gelsolin; protein-protein complex, structural prot | 91.64 | |
| 1t44_G | 147 | Chimera of gelsolin domain 1 and C-terminal domain | 90.58 | |
| 3eh1_A | 751 | Protein transport protein SEC24B; copii coat prote | 88.85 | |
| 1pcx_A | 810 | Protein transport protein SEC24; 2.50A {Saccharomy | 87.45 | |
| 3eh1_A | 751 | Protein transport protein SEC24B; copii coat prote | 87.09 | |
| 3eh2_A | 766 | Protein transport protein SEC24C; copii-coat prote | 86.3 | |
| 1pcx_A | 810 | Protein transport protein SEC24; 2.50A {Saccharomy | 86.28 | |
| 3efo_B | 770 | SEC24 related gene family, member D; copii, coat p | 85.98 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 85.76 | |
| 3eh2_A | 766 | Protein transport protein SEC24C; copii-coat prote | 85.69 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 85.25 | |
| 3efo_B | 770 | SEC24 related gene family, member D; copii, coat p | 85.1 | |
| 2nut_A | 769 | Protein transport protein SEC23A; human copii SEC2 | 82.53 | |
| 1m2o_A | 768 | SEC23, protein transport protein SEC23, SEC23P; zi | 82.05 |
| >1j72_A Macrophage capping protein; actin, human, CAP G, GCAP39, MBHL, GELS structural protein; 2.50A {Homo sapiens} SCOP: d.109.1.1 d.109.1.1 d.109.1.1 PDB: 1jhw_A | Back alignment and structure |
|---|
Probab=100.00 E-value=1.2e-37 Score=270.95 Aligned_cols=222 Identities=25% Similarity=0.320 Sum_probs=180.4
Q ss_pred hcCCccCCEeeccCCcCccCCCCcccc-CC-CCCCEEecccCCCCCccchhhhhhhcccccchhccccccccchhhhhhh
Q psy8923 40 LTELQCLRTLNLRYNKIKNSGIPVDLF-HL-EDLTTLDLSHNNIKQIPDALENAKRTKATLDKRACSAIHAVNLRNFLAA 117 (273)
Q Consensus 40 ~~~l~~L~~L~l~~N~l~~~~ip~~~~-~l-~~L~~L~Ls~N~l~~ip~~l~~w~g~~~~~~~~~~~~l~~~~L~~~l~~ 117 (273)
.++-+.|+...+.+..+.. +|+... .+ ..=.++-|.--.-.. ..||.|+|.+++.++.+++++.+.+|++.+++
T Consensus 15 ~~~~~g~~iWrie~~~~~~--vp~~~~G~Fy~gd~Yivl~t~~~~~--~~i~~W~G~~ss~de~~~aa~~t~~ld~~lgg 90 (347)
T 1j72_A 15 SVQDPGLHVWRVEKLKPVP--VAQENQGVFFSGDSYLVLHNGPEEV--SHLHLWIGQQSSRDEQGACAVLAVQLDDYLGG 90 (347)
T ss_dssp TTSSSEEEEEEECSSSEEE--CCTTTTTEEETTSEEEEEEECSSSC--EEEEEEECTTSCHHHHHHHHHHHHHHHHHTTT
T ss_pred cccCCCeEEEEEcCCEEEE--CCHHHcCeecCCCEEEEEEeecCCC--eEEEEEcCCCCCHHHHHHHHHHHHHHHHHhCC
Confidence 3445677777777766665 775322 11 111122222111111 67999999999999999999999999999999
Q ss_pred hhhhcccccCCCchhhHhhccCCcEEecCCcccccceecccCc-ceeeEEEEecCcccCCCCceEEEEecCCCCCCCCCC
Q psy8923 118 ECRTIREEQGDESEEFLSLFNTGISYIEGGRTASGFFTVEDTV-YTTRLYRVHAPLHQAQASSIHLEPVPVLSESLDPRF 196 (273)
Q Consensus 118 ~~~~~~~~qg~e~~~fl~lf~~~i~~l~g~~~~s~~~~~~~~~-~~~~L~~v~g~~~~~~~~~~~~~ev~~~~ssL~s~d 196 (273)
.++|+|+.||+||++|+++|++++++++|+ ..+++.++.+.. ..++||||+|+ +++++.|||++++|||++|
T Consensus 91 ~~vq~R~~Qg~Es~~Fl~~F~~~~~i~~Gg-~~sgf~~~~~~~~~~~rL~~v~G~------~~v~~~eV~~~~~sLns~d 163 (347)
T 1j72_A 91 RPVQHREVQGNESDLFMSYFPRGLKYQEGG-VESGFKHVVPNEVVVQRLYQVKGK------KNIRATERALNWDSFNTGD 163 (347)
T ss_dssp CSEEEEEETTSCCHHHHTTCSSCCEEECSS-CCTTCCCCCCCCCEEEEEEEEECS------SSCEEEEECSSGGGCBTTS
T ss_pred CCcEEEeeCCCCCHHHHHhhCCCeEEeeCC-ccccccccccCCCCCcEEEEEECC------CceEEEEEeeeHHHcCCCc
Confidence 999999999999999999999999999999 889998887655 46799999998 6889999999999999999
Q ss_pred EEEEECCCeEEEEeCCCCCHHHHHHhhhhh----------------------cccccc--C---CC--------------
Q psy8923 197 VFLLDAGLKLFIWNGPKAKNTFVFLLDAGL----------------------KLFIWN--G---PK-------------- 235 (273)
Q Consensus 197 vfild~~~~~~vW~G~~s~~~e~~~~~~~~----------------------~~~fw~--~---~~-------------- 235 (273)
|||||+++.+|+|+|++|+.+||..|..+| +.+||. | .+
T Consensus 164 ~FIL~~~~~iy~W~G~~s~~~Er~~A~~~a~~i~~~~~~g~~~v~~v~EG~E~~~Fw~~LGg~~~~~~~~~~~d~~~~~~ 243 (347)
T 1j72_A 164 CFILDLGQNIFAWCGGKSNILERNKARDLALAIRDSERQGKAQVEIVTDGEEPAEMIQVLGPKPALKEGNPEEDLTADKA 243 (347)
T ss_dssp EEEEEETTEEEEEECTTCCHHHHHHHHHHHHHHHTTSCCSSCEEEEEETTCCCHHHHHHHCSCCCCBCSCCSSCCTTSSS
T ss_pred eEEEecCCEEEEEECCCCCHHHHHHHHHHHHHHHhhccCCCceEEEEeCCCCHHHHHHHhCCCcccccCCcchhhhhhhh
Confidence 999999999999999999999999876443 557777 2 00
Q ss_pred --------------------------------CCCceEEEEeCC--ceEEEEeCCCcchHhHHhHHHHhhh
Q psy8923 236 --------------------------------AKNTFVFLLDAG--LKLFIWNGPKAKNTFKSKTRLLAEK 272 (273)
Q Consensus 236 --------------------------------~~~~~v~~ld~~--~~~~~w~G~~a~~~~~~~~~~~~~~ 272 (273)
..+++|||||++ .+||||+|++|+..||+.|+++|++
T Consensus 244 ~~~~~rLy~vs~~~G~~~v~ev~~~~~~~q~~L~s~dv~ILD~g~~~~IyVW~G~~a~~~er~~A~~~A~~ 314 (347)
T 1j72_A 244 NAQAAALYKVSDATGQMNLTKVADSSPFALELLISDDCFVLDNGLCGKIYIWKGRKANEKERQAALQVAEG 314 (347)
T ss_dssp SSCCCEEEEEECTTSSCEEEEEECSSSBCGGGCCTTSEEEEECGGGSEEEEEECTTCCHHHHHHHHHHHHH
T ss_pred cccCCEEEEEECCCCCEEEEeeccCCCCCHHHcCCCCEEEEecCCCcEEEEEeCCCCCHHHHHHHHHHHHH
Confidence 011359999999 9999999999999999999999986
|
| >3fg6_A Adseverin, scinderin; C-terminus of adseverin, actin capping, actin-binding, cytos phosphoprotein, actin-binding protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3fg7_A Villin-1; actin binding protein, gelsolin, actin capping, actin-binding, calcium, cytoplasm, cytoskeleton, structural protein; 2.00A {Homo sapiens} PDB: 2llf_A | Back alignment and structure |
|---|
| >2fh1_A Gelsolin; calcium, contractIle protein; 1.55A {Homo sapiens} SCOP: d.109.1.1 d.109.1.1 d.109.1.1 PDB: 1p8x_A 2fh2_A 2fh3_A 2fh4_A 1h1v_G* 1nph_A | Back alignment and structure |
|---|
| >1d0n_A Horse plasma gelsolin; mixed alpha-beta structure, actin-binding protein, protein D packing, contractIle protein; 2.50A {Equus caballus} SCOP: d.109.1.1 d.109.1.1 d.109.1.1 d.109.1.1 d.109.1.1 d.109.1.1 PDB: 2fgh_A* 3ffn_A 3ffk_A* 1rgi_G* | Back alignment and structure |
|---|
| >1d0n_A Horse plasma gelsolin; mixed alpha-beta structure, actin-binding protein, protein D packing, contractIle protein; 2.50A {Equus caballus} SCOP: d.109.1.1 d.109.1.1 d.109.1.1 d.109.1.1 d.109.1.1 d.109.1.1 PDB: 2fgh_A* 3ffn_A 3ffk_A* 1rgi_G* | Back alignment and structure |
|---|
| >1svq_A Severin; actin-binding; NMR {Dictyostelium discoideum} SCOP: d.109.1.1 PDB: 1svr_A 1svy_A | Back alignment and structure |
|---|
| >1j72_A Macrophage capping protein; actin, human, CAP G, GCAP39, MBHL, GELS structural protein; 2.50A {Homo sapiens} SCOP: d.109.1.1 d.109.1.1 d.109.1.1 PDB: 1jhw_A | Back alignment and structure |
|---|
| >1kcq_A Gelsolin, brevin, ADF, AGEL; alpha-beta structure, actin-binding protein, familial amyloi finnish type, cadmium binding, metal binding; 1.65A {Homo sapiens} SCOP: d.109.1.1 | Back alignment and structure |
|---|
| >3tu5_B Gelsolin, protein cordon-BLeu, thymosin beta-4; unusual hairpin conformation in the D-loop, structural prote binding protein complex; HET: ATP; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3fg7_A Villin-1; actin binding protein, gelsolin, actin capping, actin-binding, calcium, cytoplasm, cytoskeleton, structural protein; 2.00A {Homo sapiens} PDB: 2llf_A | Back alignment and structure |
|---|
| >3fg6_A Adseverin, scinderin; C-terminus of adseverin, actin capping, actin-binding, cytos phosphoprotein, actin-binding protein; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2fh1_A Gelsolin; calcium, contractIle protein; 1.55A {Homo sapiens} SCOP: d.109.1.1 d.109.1.1 d.109.1.1 PDB: 1p8x_A 2fh2_A 2fh3_A 2fh4_A 1h1v_G* 1nph_A | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >1t44_G Chimera of gelsolin domain 1 and C-terminal domain of thymosin beta-4; structural protein; HET: ATP; 2.00A {Homo sapiens} SCOP: d.109.1.1 | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >2ff3_A Gelsolin; protein-protein complex, structural protein/contractIle protein complex; HET: ATP; 2.00A {Homo sapiens} SCOP: d.109.1.1 PDB: 2ff6_G* | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >3cip_G Gelsolin; actin, dictyostelium discoideum, actin-associated methyl histidine, ATP-binding, cytoskeleton, nucleotide-BIN phosphoprotein; HET: HIC ATP; 1.60A {Homo sapiens} SCOP: d.109.1.1 PDB: 3ci5_G* 1p8z_G* 1d4x_G* 1nlv_G* 1mdu_A* 1nm1_G* 1nmd_G* 1yag_G* 1yvn_G* 3cjb_G* 3cjc_G* 1esv_S* 1eqy_S* 1c0g_S* 1c0f_S* 1dej_S* 3a5l_S* 3a5m_S* 3a5n_S* 3a5o_S* | Back alignment and structure |
|---|
| >2vik_A Villin 14T; actin-binding protein, capping protein, calcium-binding protein, cytoskeletal protein; NMR {Gallus gallus} SCOP: d.109.1.1 PDB: 2vil_A | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >1kcq_A Gelsolin, brevin, ADF, AGEL; alpha-beta structure, actin-binding protein, familial amyloi finnish type, cadmium binding, metal binding; 1.65A {Homo sapiens} SCOP: d.109.1.1 | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1svq_A Severin; actin-binding; NMR {Dictyostelium discoideum} SCOP: d.109.1.1 PDB: 1svr_A 1svy_A | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
| >4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} | Back alignment and structure |
|---|
| >3tu5_B Gelsolin, protein cordon-BLeu, thymosin beta-4; unusual hairpin conformation in the D-loop, structural prote binding protein complex; HET: ATP; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >2vik_A Villin 14T; actin-binding protein, capping protein, calcium-binding protein, cytoskeletal protein; NMR {Gallus gallus} SCOP: d.109.1.1 PDB: 2vil_A | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >3cip_G Gelsolin; actin, dictyostelium discoideum, actin-associated methyl histidine, ATP-binding, cytoskeleton, nucleotide-BIN phosphoprotein; HET: HIC ATP; 1.60A {Homo sapiens} SCOP: d.109.1.1 PDB: 3ci5_G* 1p8z_G* 1d4x_G* 1nlv_G* 1mdu_A* 1nm1_G* 1nmd_G* 1yag_G* 1yvn_G* 3cjb_G* 3cjc_G* 1esv_S* 1eqy_S* 1c0g_S* 1c0f_S* 1dej_S* 3a5l_S* 3a5m_S* 3a5n_S* 3a5o_S* | Back alignment and structure |
|---|
| >2ff3_A Gelsolin; protein-protein complex, structural protein/contractIle protein complex; HET: ATP; 2.00A {Homo sapiens} SCOP: d.109.1.1 PDB: 2ff6_G* | Back alignment and structure |
|---|
| >1t44_G Chimera of gelsolin domain 1 and C-terminal domain of thymosin beta-4; structural protein; HET: ATP; 2.00A {Homo sapiens} SCOP: d.109.1.1 | Back alignment and structure |
|---|
| >3eh1_A Protein transport protein SEC24B; copii coat protein, vesicle transport, transport signal sequence, cytoplasm, endoplasmic reticulum; 1.80A {Homo sapiens} PDB: 2nut_B 2nup_B 3egd_B 3egx_B | Back alignment and structure |
|---|
| >1pcx_A Protein transport protein SEC24; 2.50A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 PDB: 1pd0_A 1pd1_A | Back alignment and structure |
|---|
| >3eh1_A Protein transport protein SEC24B; copii coat protein, vesicle transport, transport signal sequence, cytoplasm, endoplasmic reticulum; 1.80A {Homo sapiens} PDB: 2nut_B 2nup_B 3egd_B 3egx_B | Back alignment and structure |
|---|
| >3eh2_A Protein transport protein SEC24C; copii-coat protein, vesicle transport, cytoplasm, endoplasmic reticulum, ER-golgi transport, golgi apparatus; 2.35A {Homo sapiens} | Back alignment and structure |
|---|
| >1pcx_A Protein transport protein SEC24; 2.50A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 PDB: 1pd0_A 1pd1_A | Back alignment and structure |
|---|
| >3efo_B SEC24 related gene family, member D; copii, coat protein, transport signal, disease mutation, endoplasmic reticulum, ER-golgi transport, golgi apparatus, membrane; 2.70A {Homo sapiens} PDB: 3eg9_B | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 | Back alignment and structure |
|---|
| >3eh2_A Protein transport protein SEC24C; copii-coat protein, vesicle transport, cytoplasm, endoplasmic reticulum, ER-golgi transport, golgi apparatus; 2.35A {Homo sapiens} | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 | Back alignment and structure |
|---|
| >3efo_B SEC24 related gene family, member D; copii, coat protein, transport signal, disease mutation, endoplasmic reticulum, ER-golgi transport, golgi apparatus, membrane; 2.70A {Homo sapiens} PDB: 3eg9_B | Back alignment and structure |
|---|
| >2nut_A Protein transport protein SEC23A; human copii SEC23/24 complexed with SEC22, protein transport; 2.30A {Homo sapiens} PDB: 2nup_A 3egd_A 3eg9_A 3egx_A 3efo_A | Back alignment and structure |
|---|
| >1m2o_A SEC23, protein transport protein SEC23, SEC23P; zinc-finger, beta barrel, VWA domain, gelsolin domain,; HET: GNP; 2.50A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 PDB: 1m2v_A 2qtv_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 273 | ||||
| d1j72a1 | 114 | d.109.1.1 (A:11-124) Macrophage capping protein Ca | 5e-17 | |
| d3cipg1 | 124 | d.109.1.1 (G:2-125) Gelsolin {Human (Homo sapiens) | 1e-15 | |
| d2fh1a1 | 121 | d.109.1.1 (A:412-532) Gelsolin {Human (Homo sapien | 6e-15 | |
| d2vika_ | 126 | d.109.1.1 (A:) Villin, domain 1 (res. 1-126) {Chic | 3e-14 | |
| d1j72a2 | 116 | d.109.1.1 (A:125-240) Macrophage capping protein C | 2e-10 | |
| d1svya_ | 102 | d.109.1.1 (A:) Severin, domain 2 {Dictyostelium di | 4e-09 | |
| d2fh1a2 | 96 | d.109.1.1 (A:533-628) Gelsolin {Human (Homo sapien | 1e-08 | |
| d2fh1a2 | 96 | d.109.1.1 (A:533-628) Gelsolin {Human (Homo sapien | 7e-04 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 3e-08 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 5e-06 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 4e-05 | |
| d1kcqa_ | 104 | d.109.1.1 (A:) Gelsolin {Human (Homo sapiens) [Tax | 1e-07 | |
| d1kcqa_ | 104 | d.109.1.1 (A:) Gelsolin {Human (Homo sapiens) [Tax | 0.001 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 3e-07 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 4e-07 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 2e-05 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 2e-05 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 0.002 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 1e-06 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 5e-06 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 4e-05 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 0.003 | |
| d2fh1a3 | 113 | d.109.1.1 (A:629-741) Gelsolin {Human (Homo sapien | 3e-06 | |
| d1a9na_ | 162 | c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom | 1e-05 | |
| d2ca6a1 | 344 | c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom | 2e-05 | |
| d2ca6a1 | 344 | c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom | 2e-04 | |
| d1p9ag_ | 266 | c.10.2.7 (G:) von Willebrand factor binding domain | 4e-05 | |
| d1dcea3 | 124 | c.10.2.2 (A:444-567) Rab geranylgeranyltransferase | 5e-05 | |
| d1dcea3 | 124 | c.10.2.2 (A:444-567) Rab geranylgeranyltransferase | 8e-04 | |
| d1xkua_ | 305 | c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 | 6e-05 | |
| d1xkua_ | 305 | c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 | 0.002 | |
| d1ogqa_ | 313 | c.10.2.8 (A:) Polygalacturonase inhibiting protein | 6e-05 | |
| d1ogqa_ | 313 | c.10.2.8 (A:) Polygalacturonase inhibiting protein | 0.003 | |
| d1xwdc1 | 242 | c.10.2.7 (C:18-259) Follicle-stimulating hormone r | 3e-04 | |
| d1xwdc1 | 242 | c.10.2.7 (C:18-259) Follicle-stimulating hormone r | 0.003 | |
| d1d0na3 | 121 | d.109.1.1 (A:263-383) Gelsolin {Horse (Equus cabal | 4e-04 | |
| d1h6ua2 | 227 | c.10.2.1 (A:36-262) Internalin H {Listeria monocyt | 8e-04 | |
| d1koha1 | 162 | c.10.2.3 (A:201-362) mRNA export factor tap {Human | 0.001 |
| >d1j72a1 d.109.1.1 (A:11-124) Macrophage capping protein Cap G {Human (Homo sapiens) [TaxId: 9606]} Length = 114 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Gelsolin-like superfamily: Actin depolymerizing proteins family: Gelsolin-like domain: Macrophage capping protein Cap G species: Human (Homo sapiens) [TaxId: 9606]
Score = 72.9 bits (179), Expect = 5e-17
Identities = 22/58 (37%), Positives = 34/58 (58%), Gaps = 1/58 (1%)
Query: 95 KATLDKRACSAIHAVNLRNFLAAECRTIREEQGDESEEFLSLFNTGISYIEGGRTASG 152
+++ D++ A+ AV L ++L RE QG+ES+ F+S F G+ Y EGG SG
Sbjct: 58 QSSRDEQGACAVLAVQLDDYLGGRPVQHREVQGNESDLFMSYFPRGLKYQEGG-VESG 114
|
| >d3cipg1 d.109.1.1 (G:2-125) Gelsolin {Human (Homo sapiens) [TaxId: 9606]} Length = 124 | Back information, alignment and structure |
|---|
| >d2fh1a1 d.109.1.1 (A:412-532) Gelsolin {Human (Homo sapiens) [TaxId: 9606]} Length = 121 | Back information, alignment and structure |
|---|
| >d2vika_ d.109.1.1 (A:) Villin, domain 1 (res. 1-126) {Chicken (Gallus gallus) [TaxId: 9031]} Length = 126 | Back information, alignment and structure |
|---|
| >d1j72a2 d.109.1.1 (A:125-240) Macrophage capping protein Cap G {Human (Homo sapiens) [TaxId: 9606]} Length = 116 | Back information, alignment and structure |
|---|
| >d1svya_ d.109.1.1 (A:) Severin, domain 2 {Dictyostelium discoideum [TaxId: 44689]} Length = 102 | Back information, alignment and structure |
|---|
| >d2fh1a2 d.109.1.1 (A:533-628) Gelsolin {Human (Homo sapiens) [TaxId: 9606]} Length = 96 | Back information, alignment and structure |
|---|
| >d2fh1a2 d.109.1.1 (A:533-628) Gelsolin {Human (Homo sapiens) [TaxId: 9606]} Length = 96 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1kcqa_ d.109.1.1 (A:) Gelsolin {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1kcqa_ d.109.1.1 (A:) Gelsolin {Human (Homo sapiens) [TaxId: 9606]} Length = 104 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d2fh1a3 d.109.1.1 (A:629-741) Gelsolin {Human (Homo sapiens) [TaxId: 9606]} Length = 113 | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 | Back information, alignment and structure |
|---|
| >d1d0na3 d.109.1.1 (A:263-383) Gelsolin {Horse (Equus caballus) [TaxId: 9796]} Length = 121 | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Length = 162 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 273 | |||
| d2fh1a2 | 96 | Gelsolin {Human (Homo sapiens) [TaxId: 9606]} | 99.71 | |
| d1j72a2 | 116 | Macrophage capping protein Cap G {Human (Homo sapi | 99.68 | |
| d1svya_ | 102 | Severin, domain 2 {Dictyostelium discoideum [TaxId | 99.67 | |
| d1kcqa_ | 104 | Gelsolin {Human (Homo sapiens) [TaxId: 9606]} | 99.65 | |
| d2fh1a3 | 113 | Gelsolin {Human (Homo sapiens) [TaxId: 9606]} | 99.55 | |
| d1j72a3 | 107 | Macrophage capping protein Cap G {Human (Homo sapi | 99.41 | |
| d1d0na3 | 121 | Gelsolin {Horse (Equus caballus) [TaxId: 9796]} | 99.4 | |
| d2vika_ | 126 | Villin, domain 1 (res. 1-126) {Chicken (Gallus gal | 99.22 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 99.21 | |
| d1j72a1 | 114 | Macrophage capping protein Cap G {Human (Homo sapi | 99.21 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 99.17 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 99.15 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 99.13 | |
| d3cipg1 | 124 | Gelsolin {Human (Homo sapiens) [TaxId: 9606]} | 99.11 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 99.11 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 99.02 | |
| d2fh1a3 | 113 | Gelsolin {Human (Homo sapiens) [TaxId: 9606]} | 98.96 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 98.96 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 98.95 | |
| d2fh1a2 | 96 | Gelsolin {Human (Homo sapiens) [TaxId: 9606]} | 98.95 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 98.94 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 98.91 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 98.91 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 98.9 | |
| d1svya_ | 102 | Severin, domain 2 {Dictyostelium discoideum [TaxId | 98.9 | |
| d2fh1a1 | 121 | Gelsolin {Human (Homo sapiens) [TaxId: 9606]} | 98.89 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 98.85 | |
| d1kcqa_ | 104 | Gelsolin {Human (Homo sapiens) [TaxId: 9606]} | 98.84 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 98.84 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 98.83 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 98.81 | |
| d1j72a2 | 116 | Macrophage capping protein Cap G {Human (Homo sapi | 98.76 | |
| d1d0na3 | 121 | Gelsolin {Horse (Equus caballus) [TaxId: 9796]} | 98.66 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 98.64 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 98.62 | |
| d1j72a3 | 107 | Macrophage capping protein Cap G {Human (Homo sapi | 98.61 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.61 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 98.57 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.47 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 98.47 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 98.45 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 98.44 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.44 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 98.42 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 98.39 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 98.3 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 98.27 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 98.2 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 98.05 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 97.69 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 97.34 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 97.3 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 96.82 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 96.58 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 96.49 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 96.34 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 96.14 | |
| d1pd0a4 | 173 | Sec24 {Baker's yeast (Saccharomyces cerevisiae) [T | 96.09 | |
| d1pd0a4 | 173 | Sec24 {Baker's yeast (Saccharomyces cerevisiae) [T | 95.93 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 95.89 | |
| d2fh1a1 | 121 | Gelsolin {Human (Homo sapiens) [TaxId: 9606]} | 95.59 | |
| d3cipg1 | 124 | Gelsolin {Human (Homo sapiens) [TaxId: 9606]} | 95.06 | |
| d1j72a1 | 114 | Macrophage capping protein Cap G {Human (Homo sapi | 95.06 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 93.95 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 91.85 | |
| d2vika_ | 126 | Villin, domain 1 (res. 1-126) {Chicken (Gallus gal | 91.72 |
| >d2fh1a2 d.109.1.1 (A:533-628) Gelsolin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: Gelsolin-like superfamily: Actin depolymerizing proteins family: Gelsolin-like domain: Gelsolin species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.71 E-value=7.9e-18 Score=116.58 Aligned_cols=61 Identities=23% Similarity=0.284 Sum_probs=56.0
Q ss_pred eeeEEEEecCcccCCCCceEEEEecCCCCCCCCCCEEEEECCCeEEEEeCCCCCHHHHHHhhhhh
Q psy8923 162 TTRLYRVHAPLHQAQASSIHLEPVPVLSESLDPRFVFLLDAGLKLFIWNGPKAKNTFVFLLDAGL 226 (273)
Q Consensus 162 ~~~L~~v~g~~~~~~~~~~~~~ev~~~~ssL~s~dvfild~~~~~~vW~G~~s~~~e~~~~~~~~ 226 (273)
.+|||||+|+ ...++++.||++++++||++||||||+++.+|+|.|++|+..||..|...|
T Consensus 3 ~~RLf~v~g~----~~~~~~~~EV~~~~ssLns~d~fILd~~~~iyvW~G~~s~~~er~~a~~~a 63 (96)
T d2fh1a2 3 STRLFQVRAN----SAGATRAVEVLPKAGALNSNDAFVLKTPSAAYLWVGTGASEAEKTGAQELL 63 (96)
T ss_dssp SSEEEEEEEC----TTCCEEEEEECCSGGGCBTTSEEEEECSSCEEEEECTTCCHHHHHHHHHHH
T ss_pred CcEEEEEECC----CCCeEEEEEeCCCHHHhCCCCeEEEECCCEEEEEECCCCCHHHHHHHHHHH
Confidence 4799999998 456788999999999999999999999999999999999999999988765
|
| >d1j72a2 d.109.1.1 (A:125-240) Macrophage capping protein Cap G {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1svya_ d.109.1.1 (A:) Severin, domain 2 {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d1kcqa_ d.109.1.1 (A:) Gelsolin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fh1a3 d.109.1.1 (A:629-741) Gelsolin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j72a3 d.109.1.1 (A:241-347) Macrophage capping protein Cap G {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1d0na3 d.109.1.1 (A:263-383) Gelsolin {Horse (Equus caballus) [TaxId: 9796]} | Back information, alignment and structure |
|---|
| >d2vika_ d.109.1.1 (A:) Villin, domain 1 (res. 1-126) {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1j72a1 d.109.1.1 (A:11-124) Macrophage capping protein Cap G {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d3cipg1 d.109.1.1 (G:2-125) Gelsolin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fh1a3 d.109.1.1 (A:629-741) Gelsolin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d2fh1a2 d.109.1.1 (A:533-628) Gelsolin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1svya_ d.109.1.1 (A:) Severin, domain 2 {Dictyostelium discoideum [TaxId: 44689]} | Back information, alignment and structure |
|---|
| >d2fh1a1 d.109.1.1 (A:412-532) Gelsolin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1kcqa_ d.109.1.1 (A:) Gelsolin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j72a2 d.109.1.1 (A:125-240) Macrophage capping protein Cap G {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1d0na3 d.109.1.1 (A:263-383) Gelsolin {Horse (Equus caballus) [TaxId: 9796]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1j72a3 d.109.1.1 (A:241-347) Macrophage capping protein Cap G {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1pd0a4 d.109.2.1 (A:754-926) Sec24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1pd0a4 d.109.2.1 (A:754-926) Sec24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d2fh1a1 d.109.1.1 (A:412-532) Gelsolin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3cipg1 d.109.1.1 (G:2-125) Gelsolin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1j72a1 d.109.1.1 (A:11-124) Macrophage capping protein Cap G {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d2vika_ d.109.1.1 (A:) Villin, domain 1 (res. 1-126) {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|