Psyllid ID: psy8931

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-----
MGKLKPIDLQVATRSGNKKVTLVNNLDVYGIDLKEFCKLCQHGVAASTCINMVNNAAQVQVQGNQIVFVHNLLTEKFNIQKRFIRGLELAPKKKR
ccccccEEEEEEEEEccEEEEEEccEEEccccHHHHHHHHHHHccEEEEEEccccccEEEEEccHHHHHHHHHHHHcccccccEEEEEEcccccc
ccccccEEEEEEEEcccEEEEEEEcccHccccHHHHHHHHHHHHccccEEcccccccEEEEEccHHHHHHHHHHHHccccHHHEEEHcccccccc
mgklkpidlqvatrsgnkkvtLVNNLDVYGIDLKEFCKLcqhgvaastCINMVNNAAQVQVQGNQIVFVHNLLTEKFNIQKRFIRglelapkkkr
mgklkpidlqvatrsgnkkvtlvNNLDVYGIDLKEFCKLCQHGVAASTCINMVNNAAQVQVQGNQIVFVHNLLTekfniqkrfirglelapkkkr
MGKLKPIDLQVATRSGNKKVTLVNNLDVYGIDLKEFCKLCQHGVAASTCinmvnnaaqvqvqgnqivFVHNLLTEKFNIQKRFIRGLELAPKKKR
****************NKKVTLVNNLDVYGIDLKEFCKLCQHGVAASTCINMVNNAAQVQVQGNQIVFVHNLLTEKFNIQKRFIRGLE*******
***LKPIDLQVATRSGNKKVTLVNNLDVYGIDLKEFCKLCQHGVAASTCINM**NAAQVQVQGNQIVFVHNLLTEKFNIQKRFIRGLELAP****
MGKLKPIDLQVATRSGNKKVTLVNNLDVYGIDLKEFCKLCQHGVAASTCINMVNNAAQVQVQGNQIVFVHNLLTEKFNIQKRFIRGLELAPKKKR
*GKLKPIDLQVATRSGNKKVTLVNNLDVYGIDLKEFCKLCQHGVAASTCINMVNNAAQVQVQGNQIVFVHNLLTEKFNIQKRFIRGLELA*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGKLKPIDLQVATRSGNKKVTLVNNLDVYGIDLKEFCKLCQHGVAASTCINMVNNAAQVQVQGNQIVFVHNLLTEKFNIQKRFIRGLELAPKKKR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query95 2.2.26 [Sep-21-2011]
P0CL18566 Eukaryotic translation in yes N/A 0.989 0.166 0.402 7e-15
Q58CR3579 Eukaryotic translation in yes N/A 0.957 0.157 0.404 2e-14
Q61211570 Eukaryotic translation in yes N/A 0.957 0.159 0.446 4e-14
Q5RA63584 Eukaryotic translation in yes N/A 0.989 0.160 0.404 7e-14
P41214584 Eukaryotic translation in yes N/A 0.989 0.160 0.404 7e-14
Q5PPG7570 Eukaryotic translation in yes N/A 0.957 0.159 0.436 1e-13
>sp|P0CL18|EIF2D_RABIT Eukaryotic translation initiation factor 2D OS=Oryctolagus cuniculus GN=EIF2D PE=1 SV=1 Back     alignment and function desciption
 Score = 79.0 bits (193), Expect = 7e-15,   Method: Composition-based stats.
 Identities = 39/97 (40%), Positives = 61/97 (62%), Gaps = 3/97 (3%)

Query: 2   GKLKPIDLQVATRSGNKKVTLVNNLDVYGIDLKEFCKLCQHGVAASTCINM---VNNAAQ 58
           GK+ PID+ +A R+ NKKVT+V NL+ YG+D        Q    AST +       ++ Q
Sbjct: 468 GKICPIDITLAQRASNKKVTVVRNLEAYGLDPGSVAATLQQRCQASTTVTPAPGAKDSLQ 527

Query: 59  VQVQGNQIVFVHNLLTEKFNIQKRFIRGLELAPKKKR 95
           VQ+QGNQ+  +  LL E++++ +++I+GLE APK  +
Sbjct: 528 VQIQGNQVHHLGRLLLEEYHLPRKYIQGLEHAPKASK 564
Translation initiation factor that is able to deliver tRNA to the P-site of the eukaryotic ribosome in a GTP-independent manner. The binding of Met-tRNA(I) occurs after the AUG codon finds its position in the P-site of 40S ribosomes, the situation that takes place during initiation complex formation on some specific RNAs. Its activity in tRNA binding with 40S subunits does not require the presence of the aminoacyl moiety. Possesses the unique ability to deliver non-Met (elongator) tRNAs into the P-site of the 40S subunit. In addition to its role in initiation, can promote release of deacylated tRNA and mRNA from recycled 40S subunits following ABCE1-mediated dissociation of post-termination ribosomal complexes into subunits.
Oryctolagus cuniculus (taxid: 9986)
>sp|Q58CR3|EIF2D_BOVIN Eukaryotic translation initiation factor 2D OS=Bos taurus GN=EIF2D PE=2 SV=1 Back     alignment and function description
>sp|Q61211|EIF2D_MOUSE Eukaryotic translation initiation factor 2D OS=Mus musculus GN=Eif2d PE=2 SV=3 Back     alignment and function description
>sp|Q5RA63|EIF2D_PONAB Eukaryotic translation initiation factor 2D OS=Pongo abelii GN=EIF2D PE=2 SV=1 Back     alignment and function description
>sp|P41214|EIF2D_HUMAN Eukaryotic translation initiation factor 2D OS=Homo sapiens GN=EIF2D PE=1 SV=3 Back     alignment and function description
>sp|Q5PPG7|EIF2D_RAT Eukaryotic translation initiation factor 2D OS=Rattus norvegicus GN=Eif2d PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query95
156543003 576 PREDICTED: eukaryotic translation initia 0.957 0.157 0.606 1e-23
307168946 579 Ligatin [Camponotus floridanus] 0.989 0.162 0.568 2e-22
270015596 538 hypothetical protein TcasGA2_TC001461 [T 0.978 0.172 0.568 3e-22
332029756 579 Ligatin [Acromyrmex echinatior] 0.989 0.162 0.568 6e-22
350425198 582 PREDICTED: eukaryotic translation initia 0.978 0.159 0.563 1e-21
322798624 576 hypothetical protein SINV_07809 [Solenop 0.968 0.159 0.569 3e-21
307194504 589 Ligatin [Harpegnathos saltator] 0.978 0.157 0.553 3e-21
383865036 579 PREDICTED: LOW QUALITY PROTEIN: eukaryot 0.978 0.160 0.553 1e-20
340709217 582 PREDICTED: eukaryotic translation initia 0.978 0.159 0.563 1e-20
328792244 582 PREDICTED: eukaryotic translation initia 0.978 0.159 0.553 1e-20
>gi|156543003|ref|XP_001603283.1| PREDICTED: eukaryotic translation initiation factor 2D-like [Nasonia vitripennis] Back     alignment and taxonomy information
 Score =  113 bits (283), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 57/94 (60%), Positives = 70/94 (74%), Gaps = 3/94 (3%)

Query: 2   GKLKPIDLQVATRSGNKKVTLVNNLDVYGIDLKEFCKLCQHGVAASTCINMV--NNAAQV 59
           GKL+PID+ VATRSGNKKVTL+NNL+ +GI L+EF K CQ GV AS  I  +       V
Sbjct: 484 GKLEPIDITVATRSGNKKVTLINNLETFGIKLEEFSKECQ-GVGASATITDIPGKKKPSV 542

Query: 60  QVQGNQIVFVHNLLTEKFNIQKRFIRGLELAPKK 93
            VQGNQ+++V+ LLTEK+ I K +IRGLE APKK
Sbjct: 543 LVQGNQVIYVYKLLTEKYRIHKNYIRGLEFAPKK 576

Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|307168946|gb|EFN61832.1| Ligatin [Camponotus floridanus] Back     alignment and taxonomy information
>gi|270015596|gb|EFA12044.1| hypothetical protein TcasGA2_TC001461 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|332029756|gb|EGI69625.1| Ligatin [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|350425198|ref|XP_003494043.1| PREDICTED: eukaryotic translation initiation factor 2D-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|322798624|gb|EFZ20228.1| hypothetical protein SINV_07809 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|307194504|gb|EFN76796.1| Ligatin [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|383865036|ref|XP_003707982.1| PREDICTED: LOW QUALITY PROTEIN: eukaryotic translation initiation factor 2D-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|340709217|ref|XP_003393208.1| PREDICTED: eukaryotic translation initiation factor 2D-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|328792244|ref|XP_392122.4| PREDICTED: eukaryotic translation initiation factor 2D-like [Apis mellifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query95
FB|FBgn0041588563 ligatin "ligatin" [Drosophila 0.957 0.161 0.468 2.2e-13
UNIPROTKB|F1NDA1601 EIF2D "Uncharacterized protein 0.989 0.156 0.360 5.3e-10
WB|WBGene00016113549 C25H3.4 [Caenorhabditis elegan 0.978 0.169 0.346 1.6e-09
UNIPROTKB|E2R801584 EIF2D "Uncharacterized protein 0.989 0.160 0.363 2.2e-09
UNIPROTKB|F1SEZ6585 EIF2D "Uncharacterized protein 0.989 0.160 0.343 9.9e-09
ZFIN|ZDB-GENE-040426-1226590 eif2d "eukaryotic translation 0.989 0.159 0.323 1.3e-08
UNIPROTKB|G8JKW9578 EIF2D "Eukaryotic translation 0.989 0.162 0.333 1.6e-08
UNIPROTKB|Q58CR3579 EIF2D "Eukaryotic translation 0.989 0.162 0.333 1.6e-08
MGI|MGI:109342570 Eif2d "eukaryotic translation 0.957 0.159 0.351 2.6e-08
UNIPROTKB|P41214584 EIF2D "Eukaryotic translation 0.989 0.160 0.343 5.6e-08
FB|FBgn0041588 ligatin "ligatin" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 184 (69.8 bits), Expect = 2.2e-13, P = 2.2e-13
 Identities = 44/94 (46%), Positives = 54/94 (57%)

Query:     5 KP-IDLQVATRSGNKKVTLVNNLDVYGIDLKEFCKLCQHGVAASTCXXXX--XXXXXXXX 61
             KP I + +ATRSGNKKVTLV+N++ YGI L EF KLC+ G AAST               
Sbjct:   466 KPLIQMSLATRSGNKKVTLVSNIEAYGIILAEFIKLCKQGAAASTSVVKLPHQKHEQLQI 525

Query:    62 XXXXXXFVHNLLTEKFNIQKRFIRGLELAPKKKR 95
                   FVH LLTE + +  + I GLELA   K+
Sbjct:   526 QGNQVRFVHTLLTETYKVPPKCILGLELAKDGKK 559
GO:0006413 "translational initiation" evidence=ISS
GO:0003743 "translation initiation factor activity" evidence=ISS
GO:0005737 "cytoplasm" evidence=ISS
UNIPROTKB|F1NDA1 EIF2D "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
WB|WBGene00016113 C25H3.4 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
UNIPROTKB|E2R801 EIF2D "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1SEZ6 EIF2D "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1226 eif2d "eukaryotic translation initiation factor 2D" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|G8JKW9 EIF2D "Eukaryotic translation initiation factor 2D" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q58CR3 EIF2D "Eukaryotic translation initiation factor 2D" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:109342 Eif2d "eukaryotic translation initiation factor 2D" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|P41214 EIF2D "Eukaryotic translation initiation factor 2D" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query95
cd1160885 cd11608, eIF2D_C, C-terminal domain of eIF2D and r 2e-30
pfam0125374 pfam01253, SUI1, Translation initiation factor SUI 2e-14
cd1160786 cd11607, DENR_C, C-terminal domain of DENR and rel 1e-07
>gnl|CDD|211321 cd11608, eIF2D_C, C-terminal domain of eIF2D and related proteins Back     alignment and domain information 
 Score =  102 bits (257), Expect = 2e-30
 Identities = 41/85 (48%), Positives = 56/85 (65%), Gaps = 3/85 (3%)

Query: 6  PIDLQVATRSGNKKVTLVNNLDVYGIDLKEFCKLCQHGVAASTCINMV---NNAAQVQVQ 62
          PID+    R GNKKVTL++ L+ +GID +EF K  Q   AAST ++ +       +VQVQ
Sbjct: 1  PIDITTERRQGNKKVTLISGLESFGIDPEEFAKELQKKCAASTSVSPLPGKKKGVEVQVQ 60

Query: 63 GNQIVFVHNLLTEKFNIQKRFIRGL 87
          GNQ+ FV  LLTEK+ + K++I GL
Sbjct: 61 GNQVKFVAKLLTEKYGVPKKYIDGL 85

eIF2D translation initiation factor (also known as ligatin) is involved in the recruitment and delivery of aminoacyl-tRNAs to the P-site of the eukaryotic ribosome in a GTP-independent manner. Length = 85
>gnl|CDD|216391 pfam01253, SUI1, Translation initiation factor SUI1 Back     alignment and domain information
>gnl|CDD|211320 cd11607, DENR_C, C-terminal domain of DENR and related proteins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 95
PF0125383 SUI1: Translation initiation factor SUI1; InterPro 99.97
TIGR01159173 DRP1 density-regulated protein DRP1. This protein 99.95
COG0023104 SUI1 Translation initiation factor 1 (eIF-1/SUI1) 99.95
KOG2522|consensus560 99.95
cd0047477 SUI1_eIF1 The SUI1/eIF1 (eukaryotic initiation fac 99.95
PRK0093999 translation initiation factor Sui1; Reviewed 99.94
TIGR01160110 SUI1_MOF2 translation initiation factor SUI1, euka 99.92
TIGR01158101 SUI1_rel translation initation factor SUI1, putati 99.91
KOG1770|consensus112 99.88
KOG3239|consensus193 99.87
PRK06824118 translation initiation factor Sui1; Validated 99.84
PRK07451115 translation initiation factor Sui1; Validated 99.84
PRK09019108 translation initiation factor Sui1; Validated 99.82
PF0504687 Img2: Mitochondrial large subunit ribosomal protei 98.45
KOG4034|consensus169 96.84
TIGR00311133 aIF-2beta translation initiation factor aIF-2, bet 95.95
PRK03988138 translation initiation factor IF-2 subunit beta; V 95.67
smart00653110 eIF2B_5 domain present in translation initiation f 95.1
PF01873125 eIF-5_eIF-2B: Domain found in IF2B/IF5; InterPro: 94.29
PRK12336201 translation initiation factor IF-2 subunit beta; P 94.2
PRK1445189 acylphosphatase; Provisional 93.2
PRK1443492 acylphosphatase; Provisional 92.94
PRK1444990 acylphosphatase; Provisional 92.69
PRK1442594 acylphosphatase; Provisional 92.35
PRK1443691 acylphosphatase; Provisional 91.55
PRK1444492 acylphosphatase; Provisional 91.45
PRK14437109 acylphosphatase; Provisional 91.29
PRK1444393 acylphosphatase; Provisional 91.2
PRK1442091 acylphosphatase; Provisional 91.04
PRK1442794 acylphosphatase; Provisional 91.02
PRK14452107 acylphosphatase; Provisional 91.01
PRK1443891 acylphosphatase; Provisional 90.94
PRK1445091 acylphosphatase; Provisional 90.75
PRK14439163 acylphosphatase; Provisional 90.71
PRK1444591 acylphosphatase; Provisional 90.65
PRK1443387 acylphosphatase; Provisional 90.56
PRK1442293 acylphosphatase; Provisional 90.47
PRK1443189 acylphosphatase; Provisional 90.33
PRK1442990 acylphosphatase; Provisional 90.28
PRK1442392 acylphosphatase; Provisional 90.22
PF0070891 Acylphosphatase: Acylphosphatase; InterPro: IPR001 90.17
PRK1444795 acylphosphatase; Provisional 90.15
PRK1444090 acylphosphatase; Provisional 90.1
PRK1444688 acylphosphatase; Provisional 90.05
PRK1442199 acylphosphatase; Provisional 89.5
PRK1442897 acylphosphatase; Provisional 89.43
PRK1444291 acylphosphatase; Provisional 89.35
PRK1442692 acylphosphatase; Provisional 88.6
PRK1443590 acylphosphatase; Provisional 88.0
PRK1444890 acylphosphatase; Provisional 87.85
PRK1444193 acylphosphatase; Provisional 86.98
PRK1443293 acylphosphatase; Provisional 86.4
PRK1442494 acylphosphatase; Provisional 84.87
PRK1443092 acylphosphatase; Provisional 83.29
PF1452793 LAGLIDADG_WhiA: WhiA LAGLIDADG-like domain; PDB: 3 80.39
>PF01253 SUI1: Translation initiation factor SUI1; InterPro: IPR001950 In Saccharomyces cerevisiae (Baker's yeast), SUI1 is a translation initiation factor that functions in concert with eIF-2 and the initiator tRNA-Met in directing the ribosome to the proper start site of translation [] Back     alignment and domain information 
Probab=99.97  E-value=3.7e-30  Score=163.46  Aligned_cols=81  Identities=32%  Similarity=0.479  Sum_probs=70.3

Q ss_pred             CCCccEEEEEeeecCCeeEEEEecccCCCCCHHHHHHHHhhhcccceEEeeCCCC-cEEEEcCChHHHHHHHHhhhcCCC
Q psy8931           2 GKLKPIDLQVATRSGNKKVTLVNNLDVYGIDLKEFCKLCQHGVAASTCINMVNNA-AQVQVQGNQIVFVHNLLTEKFNIQ   80 (95)
Q Consensus         2 G~~~~I~I~~~~R~g~K~vT~V~Gle~f~idl~~lak~lkk~~acs~sv~~~~g~-~eI~iQGd~~~~v~~~L~~~~gip   80 (95)
                      |+.++|+|++++|+|||+||+|+||+.|++|+++||++|+++||||+||.+.++. .+|+|||||+++|.+||.++|++|
T Consensus         2 ~~~~~I~I~~e~r~~~K~vT~V~gl~~~~~d~~~lak~lkk~~ac~~sv~~~~~k~~~I~iQGd~~~~i~~~L~~~~~~~   81 (83)
T PF01253_consen    2 KEPPKIHIRVEKRRGRKFVTIVSGLELFGIDLKELAKELKKKFACGGSVTKDPGKGEEIQIQGDHRDEIKDLLVEKGGIP   81 (83)
T ss_dssp             S-TTCEEEEEEESSSSEEEEEEES--STTSHHHHHHHHHHHHHTS-EEEEE-TTTSSEEEEESS-HHHHHHHHHHHCSSE
T ss_pred             CCCCEEEEEEEeCcCCeEEEEEECCcccccCHHHHHHHHHHhccCceEEeecCCCCCEEEECCcHHHHHHHHHHHhCCCC
Confidence            6789999999999999999999999999999999999999999999999988763 899999999999999999989888


Q ss_pred             cC
Q psy8931          81 KR   82 (95)
Q Consensus        81 ~~   82 (95)
                      ++
T Consensus        82 k~   83 (83)
T PF01253_consen   82 KK   83 (83)
T ss_dssp             -S
T ss_pred             CC
Confidence            64

SUI1 is a protein of 108 residues. Close homologs of SUI1 have been found [] in mammals, insects and plants. SUI1 is also evolutionary related to hypothetical proteins from Escherichia coli (yciH), Haemophilus influenzae (HI1225) and Methanococcus vannielii.; GO: 0003743 translation initiation factor activity, 0006413 translational initiation; PDB: 2OGH_A 1D1R_A 2IF1_A 2XZN_F 2XZM_F.
>TIGR01159 DRP1 density-regulated protein DRP1 Back     alignment and domain information
>COG0023 SUI1 Translation initiation factor 1 (eIF-1/SUI1) and related proteins [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2522|consensus Back     alignment and domain information
>cd00474 SUI1_eIF1 The SUI1/eIF1 (eukaryotic initiation factor 1) fold is found in eukaryotes, archaea, and some bacteria and is thought to play an important role in accurate initiator codon recognition during translation initiation Back     alignment and domain information
>PRK00939 translation initiation factor Sui1; Reviewed Back     alignment and domain information
>TIGR01160 SUI1_MOF2 translation initiation factor SUI1, eukaryotic Back     alignment and domain information
>TIGR01158 SUI1_rel translation initation factor SUI1, putative, prokaryotic Back     alignment and domain information
>KOG1770|consensus Back     alignment and domain information
>KOG3239|consensus Back     alignment and domain information
>PRK06824 translation initiation factor Sui1; Validated Back     alignment and domain information
>PRK07451 translation initiation factor Sui1; Validated Back     alignment and domain information
>PRK09019 translation initiation factor Sui1; Validated Back     alignment and domain information
>PF05046 Img2: Mitochondrial large subunit ribosomal protein (Img2); InterPro: IPR007740 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>KOG4034|consensus Back     alignment and domain information
>TIGR00311 aIF-2beta translation initiation factor aIF-2, beta subunit, putative Back     alignment and domain information
>PRK03988 translation initiation factor IF-2 subunit beta; Validated Back     alignment and domain information
>smart00653 eIF2B_5 domain present in translation initiation factor eIF2B and eIF5 Back     alignment and domain information
>PF01873 eIF-5_eIF-2B: Domain found in IF2B/IF5; InterPro: IPR002735 The beta subunit of archaeal and eukaryotic translation initiation factor 2 (IF2beta) and the N-terminal domain of translation initiation factor 5 (IF5) show significant sequence homology [] Back     alignment and domain information
>PRK12336 translation initiation factor IF-2 subunit beta; Provisional Back     alignment and domain information
>PRK14451 acylphosphatase; Provisional Back     alignment and domain information
>PRK14434 acylphosphatase; Provisional Back     alignment and domain information
>PRK14449 acylphosphatase; Provisional Back     alignment and domain information
>PRK14425 acylphosphatase; Provisional Back     alignment and domain information
>PRK14436 acylphosphatase; Provisional Back     alignment and domain information
>PRK14444 acylphosphatase; Provisional Back     alignment and domain information
>PRK14437 acylphosphatase; Provisional Back     alignment and domain information
>PRK14443 acylphosphatase; Provisional Back     alignment and domain information
>PRK14420 acylphosphatase; Provisional Back     alignment and domain information
>PRK14427 acylphosphatase; Provisional Back     alignment and domain information
>PRK14452 acylphosphatase; Provisional Back     alignment and domain information
>PRK14438 acylphosphatase; Provisional Back     alignment and domain information
>PRK14450 acylphosphatase; Provisional Back     alignment and domain information
>PRK14439 acylphosphatase; Provisional Back     alignment and domain information
>PRK14445 acylphosphatase; Provisional Back     alignment and domain information
>PRK14433 acylphosphatase; Provisional Back     alignment and domain information
>PRK14422 acylphosphatase; Provisional Back     alignment and domain information
>PRK14431 acylphosphatase; Provisional Back     alignment and domain information
>PRK14429 acylphosphatase; Provisional Back     alignment and domain information
>PRK14423 acylphosphatase; Provisional Back     alignment and domain information
>PF00708 Acylphosphatase: Acylphosphatase; InterPro: IPR001792 Acylphosphatase (3 Back     alignment and domain information
>PRK14447 acylphosphatase; Provisional Back     alignment and domain information
>PRK14440 acylphosphatase; Provisional Back     alignment and domain information
>PRK14446 acylphosphatase; Provisional Back     alignment and domain information
>PRK14421 acylphosphatase; Provisional Back     alignment and domain information
>PRK14428 acylphosphatase; Provisional Back     alignment and domain information
>PRK14442 acylphosphatase; Provisional Back     alignment and domain information
>PRK14426 acylphosphatase; Provisional Back     alignment and domain information
>PRK14435 acylphosphatase; Provisional Back     alignment and domain information
>PRK14448 acylphosphatase; Provisional Back     alignment and domain information
>PRK14441 acylphosphatase; Provisional Back     alignment and domain information
>PRK14432 acylphosphatase; Provisional Back     alignment and domain information
>PRK14424 acylphosphatase; Provisional Back     alignment and domain information
>PRK14430 acylphosphatase; Provisional Back     alignment and domain information
>PF14527 LAGLIDADG_WhiA: WhiA LAGLIDADG-like domain; PDB: 3HYI_A 3HYJ_D Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query95
2ogh_A108 Eukaryotic translation initiation factor EIF-1; al 1e-06
2if1_A126 EIF1, SUI1; translation initiation factor; NMR {Ho 4e-05
2xzm_F101 EIF1; ribosome, translation; 3.93A {Tetrahymena th 1e-04
>2ogh_A Eukaryotic translation initiation factor EIF-1; alpha-beta protein; NMR {Saccharomyces cerevisiae} Length = 108 Back     alignment and structure
 Score = 42.2 bits (99), Expect = 1e-06
 Identities = 20/82 (24%), Positives = 38/82 (46%), Gaps = 2/82 (2%)

Query: 5   KPIDLQVATRSGNKKVTLVNNLDVYGIDLKEFCKLCQHGVAASTCINMVNNAAQV-QVQG 63
             I +++  R+G K +T V  +     DLK   K+ +   A +  I       ++ Q+QG
Sbjct: 24  NYIHIRIQQRNGRKTLTTVQGVPE-EYDLKRILKVLKKDFACNGNIVKDPEMGEIIQLQG 82

Query: 64  NQIVFVHNLLTEKFNIQKRFIR 85
           +Q   V   +  +  +QK+ I+
Sbjct: 83  DQRAKVCEFMISQLGLQKKNIK 104
>2if1_A EIF1, SUI1; translation initiation factor; NMR {Homo sapiens} SCOP: d.64.1.1 Length = 126 Back     alignment and structure
>2xzm_F EIF1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_F Length = 101 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query95
2ogh_A108 Eukaryotic translation initiation factor EIF-1; al 99.96
2xzm_F101 EIF1; ribosome, translation; 3.93A {Tetrahymena th 99.96
2if1_A126 EIF1, SUI1; translation initiation factor; NMR {Ho 99.94
1d1r_A116 Hypothetical 11.4 KD protein YCIH in PYRF-OSMB int 99.92
2d74_B148 Translation initiation factor 2 beta subunit; prot 95.24
1nee_A138 EIF-2-beta, probable translation initiation factor 94.69
1k8b_A52 EIF-2-beta, probable translation initiation factor 93.87
2fhm_A91 Probable acylphosphatase; hydrolase; NMR {Bacillus 93.75
1gxu_A91 Hydrogenase maturation protein HYPF; phosphatase, 93.33
2e9h_A157 EIF-5, eukaryotic translation initiation factor 5; 92.47
1urr_A102 CG18505 protein; acylphosphatase, enzyme; 1.5A {Dr 91.15
2lxf_A121 Uncharacterized protein; beaver fever, giardiasis, 91.05
2vh7_A99 Acylphosphatase-1; hydrolase, acetylation; 1.45A { 90.42
3trg_A98 Acylphosphatase; fatty acid and phospholipid metab 90.22
1ulr_A88 Putative acylphosphatase; hydrolase, structural ge 90.17
2bjd_A101 Acylphosphatase; hyperthermophIle, hydrolase; 1.27 89.99
2g2k_A170 EIF-5, eukaryotic translation initiation factor 5; 89.73
1w2i_A91 Acylphosphatase; hydrolase, thermophilic, stabilit 89.12
3hyi_A 295 Protein DUF199/WHIA; laglidadg, homing endonucleas 87.31
2gv1_A92 Probable acylphosphatase; globular alpha-helix/bet 85.12
1aps_A98 Acylphosphatase; hydrolase(acting on acid anhydrid 81.65
>2ogh_A Eukaryotic translation initiation factor EIF-1; alpha-beta protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
Probab=99.96  E-value=3.4e-29  Score=165.68  Aligned_cols=86  Identities=23%  Similarity=0.302  Sum_probs=80.2

Q ss_pred             CCCccEEEEEeeecCCeeEEEEecccCCCCCHHHHHHHHhhhcccceEEeeCCCC-cEEEEcCChHHHHHHHHhhhcCCC
Q psy8931           2 GKLKPIDLQVATRSGNKKVTLVNNLDVYGIDLKEFCKLCQHGVAASTCINMVNNA-AQVQVQGNQIVFVHNLLTEKFNIQ   80 (95)
Q Consensus         2 G~~~~I~I~~~~R~g~K~vT~V~Gle~f~idl~~lak~lkk~~acs~sv~~~~g~-~eI~iQGd~~~~v~~~L~~~~gip   80 (95)
                      |+.++|+|++++|+|||.||+|+||+. ++|+++||++|+++||||+||.+.|+. .+|+|||||++.|.+||.++..+|
T Consensus        21 ~~~~~V~Ir~~~R~g~K~VT~V~Gl~~-~~dlk~lak~lKkk~acggsV~~~~~~g~~I~iQGD~r~~v~~~L~~~g~~~   99 (108)
T 2ogh_A           21 ATSNYIHIRIQQRNGRKTLTTVQGVPE-EYDLKRILKVLKKDFACNGNIVKDPEMGEIIQLQGDQRAKVCEFMISQLGLQ   99 (108)
T ss_dssp             CCSCSEEEEEECCSSSCCEEEEECCCT-TSCHHHHHHHHHHHHCCCEEEECCTTSSCEEEEESSCHHHHHHHHHHHHTSC
T ss_pred             CCCCeEEEEEEEccCCceEEEEeCCCc-chhHHHHHHHHHHHhcCceEEecCCCCceEEEEcCCHHHHHHHHHHHcCCCC
Confidence            678999999999999999999999997 999999999999999999999998776 799999999999999999976679


Q ss_pred             cCceEEcc
Q psy8931          81 KRFIRGLE   88 (95)
Q Consensus        81 ~~~I~~~~   88 (95)
                      +++|++..
T Consensus       100 ~~~I~vhg  107 (108)
T 2ogh_A          100 KKNIKIHG  107 (108)
T ss_dssp             CSCEEECC
T ss_pred             HHHEEEcC
Confidence            99999853
>2xzm_F EIF1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_F Back     alignment and structure
>2if1_A EIF1, SUI1; translation initiation factor; NMR {Homo sapiens} SCOP: d.64.1.1 Back     alignment and structure
>1d1r_A Hypothetical 11.4 KD protein YCIH in PYRF-OSMB intergenic region; alpha-beta plait, open-faced beta sandwich, ferredoxin-like fold; NMR {Escherichia coli} SCOP: d.64.1.1 Back     alignment and structure
>2d74_B Translation initiation factor 2 beta subunit; protein complex; 2.80A {Pyrococcus furiosus} PDB: 2dcu_B* Back     alignment and structure
>1nee_A EIF-2-beta, probable translation initiation factor 2 beta subunit; two domain protein, mixed alpha-beta structure; NMR {Methanothermobacterthermautotrophicus} SCOP: d.241.1.1 g.59.1.1 Back     alignment and structure
>1k8b_A EIF-2-beta, probable translation initiation factor 2 beta subunit; N-terminal domain, AIF2 subunit beta; NMR {Methanocaldococcus jannaschii} SCOP: d.241.1.1 Back     alignment and structure
>2fhm_A Probable acylphosphatase; hydrolase; NMR {Bacillus subtilis} PDB: 2hlt_A 2hlu_A 3br8_A Back     alignment and structure
>1gxu_A Hydrogenase maturation protein HYPF; phosphatase, acylphosphatases, hydrogenase maturations, fibril formation, zinc-finger, complete proteome; 1.27A {Escherichia coli} SCOP: d.58.10.1 PDB: 1gxt_A Back     alignment and structure
>2e9h_A EIF-5, eukaryotic translation initiation factor 5; zinc binding, C4 type zinc finger, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1urr_A CG18505 protein; acylphosphatase, enzyme; 1.5A {Drosophila melanogaster} SCOP: d.58.10.1 Back     alignment and structure
>2lxf_A Uncharacterized protein; beaver fever, giardiasis, seattle structural genomics center infectious disease, ssgcid, structural genomics; NMR {Giardia lamblia} Back     alignment and structure
>2vh7_A Acylphosphatase-1; hydrolase, acetylation; 1.45A {Homo sapiens} PDB: 2w4c_A 2w4p_A 2k7k_A 2k7j_A 2acy_A Back     alignment and structure
>3trg_A Acylphosphatase; fatty acid and phospholipid metabolism, hydrolase; 1.60A {Coxiella burnetii} Back     alignment and structure
>1ulr_A Putative acylphosphatase; hydrolase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.30A {Thermus thermophilus} SCOP: d.58.10.1 Back     alignment and structure
>2bjd_A Acylphosphatase; hyperthermophIle, hydrolase; 1.27A {Sulfolobus solfataricus} PDB: 2bje_A 1y9o_A Back     alignment and structure
>2g2k_A EIF-5, eukaryotic translation initiation factor 5; EIF125 fold; NMR {Homo sapiens} Back     alignment and structure
>1w2i_A Acylphosphatase; hydrolase, thermophilic, stability, amyloid; 1.5A {Pyrococcus horikoshii} SCOP: d.58.10.1 PDB: 1v3z_A 2w4d_A Back     alignment and structure
>3hyi_A Protein DUF199/WHIA; laglidadg, homing endonuclease, helix-turn-helix, HTH, trans regulator; 2.34A {Thermotoga maritima} PDB: 3hyj_A Back     alignment and structure
>2gv1_A Probable acylphosphatase; globular alpha-helix/beta-sheet protein, hydrolase; NMR {Escherichia coli} Back     alignment and structure
>1aps_A Acylphosphatase; hydrolase(acting on acid anhydrides); NMR {Equus caballus} SCOP: d.58.10.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 95
d1d1ra_83 d.64.1.1 (A:) YciH {Escherichia coli [TaxId: 562]} 1e-07
d2if1a_126 d.64.1.1 (A:) Eukaryotic translation initiation fa 9e-07
>d1d1ra_ d.64.1.1 (A:) YciH {Escherichia coli [TaxId: 562]} Length = 83 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: eIF1-like
superfamily: eIF1-like
family: eIF1-like
domain: YciH
species: Escherichia coli [TaxId: 562]

 Score = 42.7 bits (101), Expect = 1e-07
 Identities = 13/73 (17%), Positives = 30/73 (41%), Gaps = 5/73 (6%)

Query: 16 GNKKVTLVNNLDVYGIDLKEFCKLCQHGVAASTCINMVNNAAQVQVQGNQIVFVHNLLTE 75
            K V L+  +D+   +L +     +        +        +++QG++   + +LL  
Sbjct: 16 KGKGVCLITGVDLDDAELTKLAAELKKKCGCGGAV----KDGVIEIQGDKRDLLKSLLEA 71

Query: 76 KFNIQKRFIRGLE 88
          K  ++ +   GLE
Sbjct: 72 K-GMKVKLAGGLE 83
>d2if1a_ d.64.1.1 (A:) Eukaryotic translation initiation factor eIF-1 (SUI1) {Human (Homo sapiens) [TaxId: 9606]} Length = 126 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query95
d2if1a_126 Eukaryotic translation initiation factor eIF-1 (SU 99.94
d1d1ra_83 YciH {Escherichia coli [TaxId: 562]} 99.89
d1neea198 Translation initiation factor 2 beta, aIF2beta, N- 95.94
d1w2ia_90 Acylphosphatase {Pyrococcus horikoshii [TaxId: 539 93.76
d1ulra_87 Acylphosphatase {Thermus thermophilus [TaxId: 274] 93.26
d1urra_97 Acylphosphatase 2 (Cg18505) {Fruit fly (Drosophila 93.05
d1k8ba_52 Translation initiation factor 2 beta, aIF2beta, N- 88.49
d1apsa_98 Acylphosphatase {Horse (Equus caballus) [TaxId: 97 87.85
d2acya_98 Acylphosphatase {Cow (Bos taurus) [TaxId: 9913]} 85.03
>d2if1a_ d.64.1.1 (A:) Eukaryotic translation initiation factor eIF-1 (SUI1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: eIF1-like
superfamily: eIF1-like
family: eIF1-like
domain: Eukaryotic translation initiation factor eIF-1 (SUI1)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.94  E-value=5.1e-28  Score=162.22  Aligned_cols=85  Identities=20%  Similarity=0.223  Sum_probs=77.4

Q ss_pred             CCCccEEEEEeeecCCeeEEEEecccCCCCCHHHHHHHHhhhcccceEEeeCCCC-cEEEEcCChHHHHHHHHhhhcCCC
Q psy8931           2 GKLKPIDLQVATRSGNKKVTLVNNLDVYGIDLKEFCKLCQHGVAASTCINMVNNA-AQVQVQGNQIVFVHNLLTEKFNIQ   80 (95)
Q Consensus         2 G~~~~I~I~~~~R~g~K~vT~V~Gle~f~idl~~lak~lkk~~acs~sv~~~~g~-~eI~iQGd~~~~v~~~L~~~~gip   80 (95)
                      |..++|+|++++|+|||.||+|+||+ +++|+++||++|+++|||||||.+.++. .+|+|||||++.|.+||.++..++
T Consensus        39 ~~~~~I~I~~ekR~G~K~VT~I~Gl~-~~~dlk~laK~lKk~~acggSVk~~~~~~~~I~IQGD~r~~v~~~L~~~g~~~  117 (126)
T d2if1a_          39 GTEDYIHIRIQQRNGRKTLTTVQGIA-DDYDKKKLVKAFKKKFACNGTVIEHPEYGEVIQLQGDQRKNICQFLVEIGLAK  117 (126)
T ss_dssp             SCTTCEECCCCCSSSSCCBCEEBSCC-TTSCHHHHHTTHHHHTCCCEEEECCTTTSSEEEESBCCHHHHHHHHHHHTSSC
T ss_pred             CCcceEEEEEEecCCCCCeEEEECCC-CcccHHHHHHHHHHhcCCCceEEeCCCCCcEEEEcccHHHHHHHHHHHcCCCc
Confidence            56789999999999999999999998 7999999999999999999999987654 899999999999999999966668


Q ss_pred             cCceEEc
Q psy8931          81 KRFIRGL   87 (95)
Q Consensus        81 ~~~I~~~   87 (95)
                      +++|++.
T Consensus       118 k~~I~vH  124 (126)
T d2if1a_         118 DDQLKVH  124 (126)
T ss_dssp             TTTEECC
T ss_pred             cccEEec
Confidence            8888763
>d1d1ra_ d.64.1.1 (A:) YciH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1neea1 d.241.1.1 (A:1-98) Translation initiation factor 2 beta, aIF2beta, N-terminal domain {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1w2ia_ d.58.10.1 (A:) Acylphosphatase {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ulra_ d.58.10.1 (A:) Acylphosphatase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1urra_ d.58.10.1 (A:) Acylphosphatase 2 (Cg18505) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1k8ba_ d.241.1.1 (A:) Translation initiation factor 2 beta, aIF2beta, N-terminal domain {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1apsa_ d.58.10.1 (A:) Acylphosphatase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d2acya_ d.58.10.1 (A:) Acylphosphatase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure