Psyllid ID: psy8953


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280------
MSIELNVQSIRLTGSSGKILVNGQERKSACIEQFLKLSCYIQQDDALRPKLTVTEAMMIASHLKLGFKVSTQEKKDQVSLELWNNFCKKKKKKKRGLDSSSCSQCVSLLANLAKQGRTVVATIHTPSALLFEKFDSLYALAKGHCIYRGSISRLVPHLASLGLPCPAYHNPADFPNLAKQGRTVVATIHTPSALLFEKFDSLYALAKGHCIYRGSISRLVPHLASLGLPCPAYHNPADFLNKEILHGISGEFKAGQLTAIMGPSGAGKSTLLNILAGLTYLNFSKC
cccHHHHHHcccccccEEEEEccEEcccHHHHHcccEEEEEcccccccccccHHHHHHHHHHccccccccHHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHcccEEEEEEccccHHHHHHcccEEEccccEEEEEcccccHHHHHHHcccccccccccccHHHHHHcccEEEEEcccccHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccEEEccEEEEEEcccccHHHHHHHHHHHHcccccccc
ccHHHHHHHcccccccEEEEEccccccHHHHHHHcccEEEEEccccccccccHHHHHHHHHHHccccccccccHEEEEEHEHccccEEEcccccccccHHHHHHHHHHHHHHHHcccEEEEEEEcccHHHHHHHHHHEHHHcccEEEEccHHHHHHHHHHccccccccccHHHHHHHHccccccEEcccccccccHHHHHHHHHHHcccHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHEEEEEEEEccccEEEEEccccccHHHHHHHHcccEEEccccc
MSIELNVQSIrltgssgkilvngQERKSACIEQFLKLSCYiqqddalrpklTVTEAMMIASHLKLgfkvstqekKDQVSLELWNNFCKkkkkkkrgldssscSQCVSLLANLAKQGRTVVATIHTPSALLFEKFDSLYALAKghciyrgsisrlvphlaslglpcpayhnpadfpnlakqgRTVVATIHTPSALLFEKFDSLYALAKghciyrgsisrlvphlaslglpcpayhnpadfLNKEILHGIsgefkagqltaimgpsgagkSTLLNILAGLtylnfskc
msielnvqsirltgssgkilvngQERKSACIEQFLKLSCYIQQDDALRPKLTVTEAMMIASHLKLGFKVSTQEKKDQVSLELWNNFCKkkkkkkrgldssscSQCVSLLANLAKQGRTVVATIHTPSALLFEKFDSLYALAKGHCIYRGSISRLVPHLASLGLPCPAYHNPADFPNLAKQGRTVVATIHTPSALLFEKFDSLYALAKGHCIYRGSISRLVPHLASLGLPCPAYHNPADFLNKEILHGISGEFKAGQLTAIMGPSGAGKSTLLNILAGltylnfskc
MSIELNVQSIRLTGSSGKILVNGQERKSACIEQFLKLSCYIQQDDALRPKLTVTEAMMIASHLKLGFKVSTQEKKDQVSLELWNNFCkkkkkkkRGLDSSSCSQCVSLLANLAKQGRTVVATIHTPSALLFEKFDSLYALAKGHCIYRGSISRLVPHLASLGLPCPAYHNPADFPNLAKQGRTVVATIHTPSALLFEKFDSLYALAKGHCIYRGSISRLVPHLASLGLPCPAYHNPADFLNKEILHGISGEFKAGQLTAIMGPSGAGKSTLLNILAGLTYLNFSKC
*****************KILVNGQERKSACIEQFLKLSCYIQQDDALRPKLTVTEAMMIASHLKLGFKVST*******SLELWN*******************QCVSLLANLAKQGRTVVATIHTPSALLFEKFDSLYALAKGHCIYRGSISRLVPHLASLGLPCPAYHNPADFPNLAKQGRTVVATIHTPSALLFEKFDSLYALAKGHCIYRGSISRLVPHLASLGLPCPAYHNPADFLNKEILHGISGEFKAGQLTAIMGPSGAGKSTLLNILAGLTYLNF***
MSIELNVQSIRLTGSSGKILVNGQERKSACIEQFLKLSCYIQQDDALRPKLTVTEAMMIASHL**************VSLELWNNFCKKKKKKKRGLDSSSCSQCVSLLANLAKQGRTVVATIHTPSALLFEKFDSLYALAKGHCIYRGSISRLVPHLASLGLPCPAYHNPADFPNLAKQGRTVVATIHTPSALLFEKFDSLYALAKGHCIYRGSISRLVPHLASLGLPCPAYHNPADFLNKEILHGISGEFKAGQLTAIMGPSGAGKSTLLNILAGLTYLNF***
MSIELNVQSIRLTGSSGKILVNGQERKSACIEQFLKLSCYIQQDDALRPKLTVTEAMMIASHLKLGFKVSTQEKKDQVSLELWNNFCK**************SQCVSLLANLAKQGRTVVATIHTPSALLFEKFDSLYALAKGHCIYRGSISRLVPHLASLGLPCPAYHNPADFPNLAKQGRTVVATIHTPSALLFEKFDSLYALAKGHCIYRGSISRLVPHLASLGLPCPAYHNPADFLNKEILHGISGEFKAGQLTAIMGPSGAGKSTLLNILAGLTYLNFSKC
*SIELNVQSIRLTGSSGKILVNGQERKSACIEQFLKLSCYIQQDDALRPKLTVTEAMMIASHLKLGFKVSTQEKKDQVSLELWNNFCKKKKKKKRGLDSSSCSQCVSLLANLAKQGRTVVATIHTPSALLFEKFDSLYALAKGHCIYRGSISRLVPHLASLGLPCPAYHNPADFPNLAKQGRTVVATIHTPSALLFEKFDSLYALAKGHCIYRGSISRLVPHLASLGLPCPAYHNPADFLNKEILHGISGEFKAGQLTAIMGPSGAGKSTLLNILAGLTYLNFSKC
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSIELNVQSIRLTGSSGKILVNGQERKSACIEQFLKLSCYIQQDDALRPKLTVTEAMMIASHLKLGFKVSTQEKKDQVSLELWNNFCKKKKKKKRGLDSSSCSQCVSLLANLAKQGRTVVATIHTPSALLFEKFDSLYALAKGHCIYRGSISRLVPHLASLGLPCPAYHNPADFPNLAKQGRTVVATIHTPSALLFEKFDSLYALAKGHCIYRGSISRLVPHLASLGLPCPAYHNPADFLNKEILHGISGEFKAGQLTAIMGPSGAGKSTLLNILAGLTYLNFSKC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query286 2.2.26 [Sep-21-2011]
Q9H172 646 ATP-binding cassette sub- yes N/A 0.562 0.249 0.445 6e-38
Q64343 666 ATP-binding cassette sub- no N/A 0.695 0.298 0.371 2e-33
P45844 678 ATP-binding cassette sub- no N/A 0.695 0.293 0.367 7e-33
Q8ST66 1476 ABC transporter G family yes N/A 0.643 0.124 0.306 8e-18
Q9C6W5 648 ABC transporter G family yes N/A 0.538 0.237 0.329 2e-17
Q8MIB3 656 ATP-binding cassette sub- no N/A 0.548 0.239 0.289 2e-17
P45843 666 Protein scarlet OS=Drosop no N/A 0.524 0.225 0.316 4e-17
Q8RWI9 691 ABC transporter G family no N/A 0.534 0.221 0.304 4e-17
Q8RXN0 703 ABC transporter G family no N/A 0.534 0.217 0.304 4e-17
Q9UNQ0 655 ATP-binding cassette sub- no N/A 0.552 0.241 0.287 9e-17
>sp|Q9H172|ABCG4_HUMAN ATP-binding cassette sub-family G member 4 OS=Homo sapiens GN=ABCG4 PE=2 SV=2 Back     alignment and function desciption
 Score =  157 bits (398), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 86/193 (44%), Positives = 114/193 (59%), Gaps = 32/193 (16%)

Query: 11  RLTGSSGKILVNGQERKSACIEQFLKLSCYIQQDDALRPKLTVTEAMMIASHLKLGFKVS 70
           R +G  G+ILVNG+ R+   +  F K+SCYI QDD L P LTV EAMM++++LKL  K  
Sbjct: 119 RESGMKGQILVNGRPRE---LRTFRKMSCYIMQDDMLLPHLTVLEAMMVSANLKLSEKQE 175

Query: 71  T----------------------------QEKKDQVSLELWNNF-CKKKKKKKRGLDSSS 101
                                        Q K+  ++LEL NN       +   GLDS+S
Sbjct: 176 VKKELVTEILTALGLMSCSHTRTALLSGGQRKRLAIALELVNNPPVMFFDEPTSGLDSAS 235

Query: 102 CSQCVSLLANLAKQGRTVVATIHTPSALLFEKFDSLYALAKGHCIYRGSISRLVPHLASL 161
           C Q VSL+ +LA+ GRT++ TIH PSA LFE FD LY L++G CI++G ++ L+P+L  L
Sbjct: 236 CFQVVSLMKSLAQGGRTIICTIHQPSAKLFEMFDKLYILSQGQCIFKGVVTNLIPYLKGL 295

Query: 162 GLPCPAYHNPADF 174
           GL CP YHNPADF
Sbjct: 296 GLHCPTYHNPADF 308




May be involved in macrophage lipid homeostasis.
Homo sapiens (taxid: 9606)
>sp|Q64343|ABCG1_MOUSE ATP-binding cassette sub-family G member 1 OS=Mus musculus GN=Abcg1 PE=2 SV=1 Back     alignment and function description
>sp|P45844|ABCG1_HUMAN ATP-binding cassette sub-family G member 1 OS=Homo sapiens GN=ABCG1 PE=2 SV=3 Back     alignment and function description
>sp|Q8ST66|ABCGI_DICDI ABC transporter G family member 18 OS=Dictyostelium discoideum GN=abcG18 PE=3 SV=1 Back     alignment and function description
>sp|Q9C6W5|AB14G_ARATH ABC transporter G family member 14 OS=Arabidopsis thaliana GN=ABCG14 PE=2 SV=1 Back     alignment and function description
>sp|Q8MIB3|ABCG2_PIG ATP-binding cassette sub-family G member 2 OS=Sus scrofa GN=ABCG2 PE=2 SV=1 Back     alignment and function description
>sp|P45843|SCRT_DROME Protein scarlet OS=Drosophila melanogaster GN=st PE=1 SV=3 Back     alignment and function description
>sp|Q8RWI9|AB15G_ARATH ABC transporter G family member 15 OS=Arabidopsis thaliana GN=ABCG15 PE=2 SV=2 Back     alignment and function description
>sp|Q8RXN0|AB11G_ARATH ABC transporter G family member 11 OS=Arabidopsis thaliana GN=ABCG11 PE=1 SV=1 Back     alignment and function description
>sp|Q9UNQ0|ABCG2_HUMAN ATP-binding cassette sub-family G member 2 OS=Homo sapiens GN=ABCG2 PE=1 SV=3 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query286
157119340 759 abc transporter [Aedes aegypti] gi|10887 0.562 0.212 0.481 7e-42
170054956 710 abc transporter [Culex quinquefasciatus] 0.559 0.225 0.489 2e-41
170069856339 abc transporter [Culex quinquefasciatus] 0.559 0.471 0.489 3e-41
158288370 758 AGAP009464-PA [Anopheles gambiae str. PE 0.562 0.212 0.492 6e-41
432962053 672 PREDICTED: ATP-binding cassette sub-fami 0.562 0.239 0.502 3e-40
432962049 668 PREDICTED: ATP-binding cassette sub-fami 0.562 0.241 0.502 3e-40
432962051 658 PREDICTED: ATP-binding cassette sub-fami 0.562 0.244 0.502 3e-40
312381133 729 hypothetical protein AND_06622 [Anophele 0.562 0.220 0.481 3e-40
432962055 549 PREDICTED: ATP-binding cassette sub-fami 0.562 0.293 0.502 5e-40
242024834 628 ABC transporter, putative [Pediculus hum 0.562 0.256 0.451 2e-39
>gi|157119340|ref|XP_001653363.1| abc transporter [Aedes aegypti] gi|108875358|gb|EAT39583.1| AAEL008631-PA [Aedes aegypti] Back     alignment and taxonomy information
 Score =  176 bits (447), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 93/193 (48%), Positives = 121/193 (62%), Gaps = 32/193 (16%)

Query: 13  TGSSGKILVNGQERKSACIEQFLKLSCYIQQDDALRPKLTVTEAMMIASHLKLGFKVSTQ 72
           +G SG + VNG+ R +   + F KLSCYIQQ DALRP LTV EAM  A+HLKLGF +S +
Sbjct: 158 SGVSGLVQVNGKNRSNNS-QSFRKLSCYIQQHDALRPWLTVNEAMSCATHLKLGFSISPE 216

Query: 73  EKKDQVSLELWNNFCKKKK----------KKKR---------------------GLDSSS 101
           EKK  +   L+    ++K           +KKR                     GLDSSS
Sbjct: 217 EKKKLIEKILFMLGLEQKGNTPTHGLSGGQKKRLAIALEMISNPPILFLDEPTTGLDSSS 276

Query: 102 CSQCVSLLANLAKQGRTVVATIHTPSALLFEKFDSLYALAKGHCIYRGSISRLVPHLASL 161
           C+QC+SLL  LA+ GRT++ T+HTPSALLFE FD LY++ +GHC Y+G +  L+P L++L
Sbjct: 277 CTQCISLLKRLAQDGRTIICTVHTPSALLFEMFDKLYSVTQGHCFYQGPVKELLPFLSNL 336

Query: 162 GLPCPAYHNPADF 174
           G  CP+YHNPADF
Sbjct: 337 GYNCPSYHNPADF 349




Source: Aedes aegypti

Species: Aedes aegypti

Genus: Aedes

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|170054956|ref|XP_001863365.1| abc transporter [Culex quinquefasciatus] gi|167875109|gb|EDS38492.1| abc transporter [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|170069856|ref|XP_001869375.1| abc transporter [Culex quinquefasciatus] gi|167865710|gb|EDS29093.1| abc transporter [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|158288370|ref|XP_310232.4| AGAP009464-PA [Anopheles gambiae str. PEST] gi|157019218|gb|EAA05934.4| AGAP009464-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
>gi|432962053|ref|XP_004086645.1| PREDICTED: ATP-binding cassette sub-family G member 1-like isoform 3 [Oryzias latipes] Back     alignment and taxonomy information
>gi|432962049|ref|XP_004086643.1| PREDICTED: ATP-binding cassette sub-family G member 1-like isoform 1 [Oryzias latipes] Back     alignment and taxonomy information
>gi|432962051|ref|XP_004086644.1| PREDICTED: ATP-binding cassette sub-family G member 1-like isoform 2 [Oryzias latipes] Back     alignment and taxonomy information
>gi|312381133|gb|EFR26949.1| hypothetical protein AND_06622 [Anopheles darlingi] Back     alignment and taxonomy information
>gi|432962055|ref|XP_004086646.1| PREDICTED: ATP-binding cassette sub-family G member 1-like isoform 4 [Oryzias latipes] Back     alignment and taxonomy information
>gi|242024834|ref|XP_002432831.1| ABC transporter, putative [Pediculus humanus corporis] gi|212518340|gb|EEB20093.1| ABC transporter, putative [Pediculus humanus corporis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query286
FB|FBgn0264494 766 CG17646 [Drosophila melanogast 0.451 0.168 0.458 1.6e-38
ZFIN|ZDB-GENE-070424-84 673 abcg1 "ATP-binding cassette, s 0.381 0.161 0.547 1.3e-37
FB|FBgn0020762 832 Atet "ABC transporter expresse 0.360 0.123 0.557 3.9e-37
FB|FBgn0032167 689 CG5853 [Drosophila melanogaste 0.360 0.149 0.490 1.5e-36
FB|FBgn0025683 699 CG3164 [Drosophila melanogaste 0.360 0.147 0.528 4e-34
UNIPROTKB|E1BDU6 665 ABCG1 "Uncharacterized protein 0.503 0.216 0.417 4.1e-25
MGI|MGI:107704 666 Abcg1 "ATP-binding cassette, s 0.503 0.216 0.423 4.1e-25
RGD|620294 666 Abcg1 "ATP-binding cassette, s 0.503 0.216 0.423 4.1e-25
UNIPROTKB|G3V642 666 Abcg1 "ATP-binding cassette, s 0.503 0.216 0.423 4.1e-25
ZFIN|ZDB-GENE-050517-39 656 abcg4a "ATP-binding cassette, 0.360 0.157 0.538 4.8e-24
FB|FBgn0264494 CG17646 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 290 (107.1 bits), Expect = 1.6e-38, Sum P(2) = 1.6e-38
 Identities = 61/133 (45%), Positives = 80/133 (60%)

Query:    72 QEKKDQVSLELWNNF-CXXXXXXXRGLDSSSCSQCVSLLANLAKQGRTVVATIHTPSALL 130
             Q+K+  ++LEL +N           GLDSSSCS CV+LL  LA QG T+V TIH PSAL+
Sbjct:   255 QKKRLAIALELISNPPVLYLDEPTTGLDSSSCSSCVALLKKLASQGHTIVCTIHQPSALI 314

Query:   131 FEKFDSLYALAKGHCIYRGSISRLVPHLASLGLPCPAYHNPADF---PNLAKQGRTVVAT 187
             FE FD LY +  GHC+Y+G +  LVP LA   L CP+YHNPAD+     + +  R +   
Sbjct:   315 FEMFDKLYTVVDGHCMYQGPVRELVPFLADQQLVCPSYHNPADYLLEVAVGEHQRDLNEL 374

Query:   188 IHTPSALLFEKFD 200
             IH  +   +E  D
Sbjct:   375 IHAANKKYYEDVD 387


GO:0005215 "transporter activity" evidence=ISS
GO:0042626 "ATPase activity, coupled to transmembrane movement of substances" evidence=ISS
GO:0043190 "ATP-binding cassette (ABC) transporter complex" evidence=ISS
GO:0016021 "integral to membrane" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0006641 "triglyceride metabolic process" evidence=IMP
ZFIN|ZDB-GENE-070424-84 abcg1 "ATP-binding cassette, sub-family G (WHITE), member 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0020762 Atet "ABC transporter expressed in trachea" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0032167 CG5853 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
FB|FBgn0025683 CG3164 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|E1BDU6 ABCG1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
MGI|MGI:107704 Abcg1 "ATP-binding cassette, sub-family G (WHITE), member 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|620294 Abcg1 "ATP-binding cassette, subfamily G (WHITE), member 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|G3V642 Abcg1 "ATP-binding cassette, sub-family G (WHITE), member 1, isoform CRA_a" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-050517-39 abcg4a "ATP-binding cassette, sub-family G (WHITE), member 4a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query286
TIGR00955 617 TIGR00955, 3a01204, The Eye Pigment Precursor Tran 7e-38
cd03213194 cd03213, ABCG_EPDR, Eye pigment and drug resistanc 1e-31
cd03232192 cd03232, ABCG_PDR_domain2, Second domain of the pl 7e-22
TIGR00955 617 TIGR00955, 3a01204, The Eye Pigment Precursor Tran 2e-20
PLN03211 659 PLN03211, PLN03211, ABC transporter G-25; Provisio 3e-19
TIGR00956 1394 TIGR00956, 3a01205, Pleiotropic Drug Resistance (P 3e-19
cd03234226 cd03234, ABCG_White, White pigment protein homolog 2e-16
cd03213 194 cd03213, ABCG_EPDR, Eye pigment and drug resistanc 5e-15
COG1136 226 COG1136, SalX, ABC-type antimicrobial peptide tran 5e-13
PLN03140 1470 PLN03140, PLN03140, ABC transporter G family membe 1e-12
cd03232 192 cd03232, ABCG_PDR_domain2, Second domain of the pl 2e-12
TIGR00955 617 TIGR00955, 3a01204, The Eye Pigment Precursor Tran 9e-12
cd00267 157 cd00267, ABC_ATPase, ATP-binding cassette transpor 9e-12
cd03255 218 cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding casse 1e-11
COG1131 293 COG1131, CcmA, ABC-type multidrug transport system 1e-11
cd03213194 cd03213, ABCG_EPDR, Eye pigment and drug resistanc 2e-11
cd03228 171 cd03228, ABCC_MRP_Like, ATP-binding cassette domai 2e-11
cd03225 211 cd03225, ABC_cobalt_CbiO_domain1, First domain of 4e-11
cd03214 180 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-bind 5e-11
TIGR03608 206 TIGR03608, L_ocin_972_ABC, putative bacteriocin ex 6e-11
cd03217 200 cd03217, ABC_FeS_Assembly, ABC-type transport syst 7e-11
COG3839 338 COG3839, MalK, ABC-type sugar transport systems, A 7e-11
cd03260 227 cd03260, ABC_PstB_phosphate_transporter, ATP-bindi 1e-10
COG0396 251 COG0396, sufC, Cysteine desulfurase activator ATPa 1e-10
cd03235 213 cd03235, ABC_Metallic_Cations, ATP-binding cassett 2e-10
cd03293 220 cd03293, ABC_NrtD_SsuB_transporters, ATP-binding c 3e-10
COG1116 248 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbon 5e-10
PRK13548 258 PRK13548, hmuV, hemin importer ATP-binding subunit 5e-10
cd03234 226 cd03234, ABCG_White, White pigment protein homolog 8e-10
cd03229 178 cd03229, ABC_Class3, ATP-binding cassette domain o 8e-10
cd03232192 cd03232, ABCG_PDR_domain2, Second domain of the pl 9e-10
cd03230 173 cd03230, ABC_DR_subfamily_A, ATP-binding cassette 1e-09
COG1120 258 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophore 1e-09
cd03261 235 cd03261, ABC_Org_Solvent_Resistant, ATP-binding ca 2e-09
TIGR01978 243 TIGR01978, sufC, FeS assembly ATPase SufC 2e-09
COG1126 240 COG1126, GlnQ, ABC-type polar amino acid transport 2e-09
cd03259 213 cd03259, ABC_Carb_Solutes_like, ATP-binding casset 4e-09
TIGR00956 1394 TIGR00956, 3a01205, Pleiotropic Drug Resistance (P 5e-09
TIGR00956 1394 TIGR00956, 3a01205, Pleiotropic Drug Resistance (P 5e-09
COG1121 254 COG1121, ZnuC, ABC-type Mn/Zn transport systems, A 5e-09
COG1122 235 COG1122, CbiO, ABC-type cobalt transport system, A 6e-09
COG1117 253 COG1117, PstB, ABC-type phosphate transport system 8e-09
cd03224 222 cd03224, ABC_TM1139_LivF_branched, ATP-binding cas 8e-09
COG1131293 COG1131, CcmA, ABC-type multidrug transport system 1e-08
COG4604 252 COG4604, CeuD, ABC-type enterochelin transport sys 1e-08
COG4988 559 COG4988, CydD, ABC-type transport system involved 1e-08
COG4181 228 COG4181, COG4181, Predicted ABC-type transport sys 1e-08
cd03256 241 cd03256, ABC_PhnC_transporter, ATP-binding cassett 1e-08
COG3842 352 COG3842, PotA, ABC-type spermidine/putrescine tran 2e-08
cd03246 173 cd03246, ABCC_Protease_Secretion, ATP-binding cass 3e-08
cd03296 239 cd03296, ABC_CysA_sulfate_importer, ATP-binding ca 3e-08
cd03226 205 cd03226, ABC_cobalt_CbiO_domain2, Second domain of 4e-08
cd03262 213 cd03262, ABC_HisP_GlnQ, ATP-binding cassette domai 4e-08
COG1118 345 COG1118, CysA, ABC-type sulfate/molybdate transpor 4e-08
COG0410 237 COG0410, LivF, ABC-type branched-chain amino acid 5e-08
COG1127 263 COG1127, Ttg2A, ABC-type transport system involved 5e-08
COG3638 258 COG3638, COG3638, ABC-type phosphate/phosphonate t 7e-08
PRK10851 353 PRK10851, PRK10851, sulfate/thiosulfate transporte 7e-08
CHL00131 252 CHL00131, ycf16, sulfate ABC transporter protein; 9e-08
cd03233202 cd03233, ABCG_PDR_domain1, First domain of the ple 9e-08
COG3840 231 COG3840, ThiQ, ABC-type thiamine transport system, 1e-07
PRK11650 356 PRK11650, ugpC, glycerol-3-phosphate transporter A 1e-07
cd03216 163 cd03216, ABC_Carb_Monos_I, First domain of the ATP 2e-07
PRK13539 207 PRK13539, PRK13539, cytochrome c biogenesis protei 2e-07
TIGR02211 221 TIGR02211, LolD_lipo_ex, lipoprotein releasing sys 2e-07
cd03250 204 cd03250, ABCC_MRP_domain1, ATP-binding cassette do 2e-07
PLN03211 659 PLN03211, PLN03211, ABC transporter G-25; Provisio 3e-07
COG2274 709 COG2274, SunT, ABC-type bacteriocin/lantibiotic ex 3e-07
cd03298 211 cd03298, ABC_ThiQ_thiamine_transporter, ATP-bindin 3e-07
PLN03140 1470 PLN03140, PLN03140, ABC transporter G family membe 4e-07
TIGR00972 247 TIGR00972, 3a0107s01c2, phosphate ABC transporter, 4e-07
COG4559 259 COG4559, COG4559, ABC-type hemin transport system, 5e-07
PRK09580 248 PRK09580, sufC, cysteine desulfurase ATPase compon 5e-07
cd03247 178 cd03247, ABCC_cytochrome_bd, ATP-binding cassette 5e-07
cd03254 229 cd03254, ABCC_Glucan_exporter_like, ATP-binding ca 6e-07
TIGR02857 529 TIGR02857, CydD, thiol reductant ABC exporter, Cyd 7e-07
COG1124 252 COG1124, DppF, ABC-type dipeptide/oligopeptide/nic 8e-07
cd03264 211 cd03264, ABC_drug_resistance_like, ABC-type multid 9e-07
TIGR02315 243 TIGR02315, ABC_phnC, phosphonate ABC transporter, 1e-06
COG1123 539 COG1123, COG1123, ATPase components of various ABC 1e-06
cd03268 208 cd03268, ABC_BcrA_bacitracin_resist, ATP-binding c 1e-06
cd03219 236 cd03219, ABC_Mj1267_LivG_branched, ATP-binding cas 1e-06
cd03253 236 cd03253, ABCC_ATM1_transporter, ATP-binding casset 1e-06
cd03220 224 cd03220, ABC_KpsT_Wzt, ATP-binding cassette compon 1e-06
TIGR03410 230 TIGR03410, urea_trans_UrtE, urea ABC transporter, 2e-06
TIGR00968 237 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP 2e-06
PRK10535 648 PRK10535, PRK10535, macrolide transporter ATP-bind 2e-06
PRK11248 255 PRK11248, tauB, taurine transporter ATP-binding su 2e-06
PRK11247 257 PRK11247, ssuB, aliphatic sulfonates transport ATP 2e-06
TIGR00956 1394 TIGR00956, 3a01205, Pleiotropic Drug Resistance (P 3e-06
PRK11264 250 PRK11264, PRK11264, putative amino-acid ABC transp 3e-06
COG0488 530 COG0488, Uup, ATPase components of ABC transporter 3e-06
COG1134 249 COG1134, TagH, ABC-type polysaccharide/polyol phos 3e-06
PRK11231 255 PRK11231, fecE, iron-dicitrate transporter ATP-bin 3e-06
PLN03140 1470 PLN03140, PLN03140, ABC transporter G family membe 4e-06
PRK14251 251 PRK14251, PRK14251, phosphate ABC transporter ATP- 4e-06
TIGR03797 686 TIGR03797, NHLM_micro_ABC2, NHLM bacteriocin syste 4e-06
COG4525 259 COG4525, TauB, ABC-type taurine transport system, 4e-06
PRK13657 588 PRK13657, PRK13657, cyclic beta-1,2-glucan ABC tra 4e-06
PRK10771 232 PRK10771, thiQ, thiamine transporter ATP-binding s 5e-06
TIGR01192 585 TIGR01192, chvA, glucan exporter ATP-binding prote 5e-06
COG1129 500 COG1129, MglA, ABC-type sugar transport system, AT 5e-06
cd03292 214 cd03292, ABC_FtsE_transporter, ATP-binding cassett 5e-06
cd03301 213 cd03301, ABC_MalK_N, The N-terminal ATPase domain 6e-06
TIGR03719 552 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette prot 6e-06
cd03245 220 cd03245, ABCC_bacteriocin_exporters, ATP-binding c 7e-06
PRK11288 501 PRK11288, araG, L-arabinose transporter ATP-bindin 8e-06
COG4987 573 COG4987, CydC, ABC-type transport system involved 9e-06
cd03267 236 cd03267, ABC_NatA_like, ATP-binding cassette domai 9e-06
TIGR03873 256 TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC tra 9e-06
TIGR02868 530 TIGR02868, CydC, thiol reductant ABC exporter, Cyd 1e-05
PRK10247 225 PRK10247, PRK10247, putative ABC transporter ATP-b 1e-05
cd03300 232 cd03300, ABC_PotA_N, ATP-binding cassette domain o 1e-05
COG4133 209 COG4133, CcmA, ABC-type transport system involved 1e-05
cd03257 228 cd03257, ABC_NikE_OppD_transporters, ATP-binding c 1e-05
COG0411 250 COG0411, LivG, ABC-type branched-chain amino acid 1e-05
COG5265 497 COG5265, ATM1, ABC-type transport system involved 1e-05
PRK11819 556 PRK11819, PRK11819, putative ABC transporter ATP-b 1e-05
cd03233 202 cd03233, ABCG_PDR_domain1, First domain of the ple 2e-05
PRK14247 250 PRK14247, PRK14247, phosphate ABC transporter ATP- 2e-05
cd03263 220 cd03263, ABC_subfamily_A, ATP-binding cassette dom 2e-05
cd03297 214 cd03297, ABC_ModC_molybdenum_transporter, ATP-bind 2e-05
pfam03193161 pfam03193, DUF258, Protein of unknown function, DU 2e-05
COG4619 223 COG4619, COG4619, ABC-type uncharacterized transpo 2e-05
PRK11174 588 PRK11174, PRK11174, cysteine/glutathione ABC trans 2e-05
PRK13538 204 PRK13538, PRK13538, cytochrome c biogenesis protei 2e-05
cd03218 232 cd03218, ABC_YhbG, ATP-binding cassette component 2e-05
cd01854211 cd01854, YjeQ_EngC, Ribosomal interacting GTPase Y 2e-05
COG1101 263 COG1101, PhnK, ABC-type uncharacterized transport 2e-05
PRK11831 269 PRK11831, PRK11831, putative ABC transporter ATP-b 2e-05
PRK03695 248 PRK03695, PRK03695, vitamin B12-transporter ATPase 2e-05
TIGR03265 353 TIGR03265, PhnT2, putative 2-aminoethylphosphonate 2e-05
TIGR01277 213 TIGR01277, thiQ, thiamine ABC transporter, ATP-bin 2e-05
PRK11629 233 PRK11629, lolD, lipoprotein transporter ATP-bindin 2e-05
cd03221144 cd03221, ABCF_EF-3, ATP-binding cassette domain of 2e-05
TIGR02982 220 TIGR02982, heterocyst_DevA, ABC exporter ATP-bindi 2e-05
COG4618 580 COG4618, ArpD, ABC-type protease/lipase transport 2e-05
cd03251 234 cd03251, ABCC_MsbA, ATP-binding cassette domain of 2e-05
PRK15439 510 PRK15439, PRK15439, autoinducer 2 ABC transporter 2e-05
PRK10938 490 PRK10938, PRK10938, putative molybdenum transport 3e-05
PRK14236 272 PRK14236, PRK14236, phosphate transporter ATP-bind 3e-05
TIGR01842 544 TIGR01842, type_I_sec_PrtD, type I secretion syste 3e-05
COG1132 567 COG1132, MdlB, ABC-type multidrug transport system 3e-05
PRK14237 267 PRK14237, PRK14237, phosphate transporter ATP-bind 4e-05
COG1119 257 COG1119, ModF, ABC-type molybdenum transport syste 4e-05
TIGR01189 198 TIGR01189, ccmA, heme ABC exporter, ATP-binding pr 4e-05
PRK13409 590 PRK13409, PRK13409, putative ATPase RIL; Provision 4e-05
PRK14250 241 PRK14250, PRK14250, phosphate ABC transporter ATP- 4e-05
COG0488 530 COG0488, Uup, ATPase components of ABC transporter 5e-05
TIGR02673 214 TIGR02673, FtsE, cell division ATP-binding protein 5e-05
COG3845 501 COG3845, COG3845, ABC-type uncharacterized transpo 5e-05
PRK14242 253 PRK14242, PRK14242, phosphate transporter ATP-bind 5e-05
TIGR01166 190 TIGR01166, cbiO, cobalt transport protein ATP-bind 5e-05
PRK10744 260 PRK10744, pstB, phosphate transporter ATP-binding 5e-05
TIGR02324 224 TIGR02324, CP_lyasePhnL, phosphonate C-P lyase sys 7e-05
COG1135 339 COG1135, AbcC, ABC-type metal ion transport system 7e-05
cd03249 238 cd03249, ABC_MTABC3_MDL1_MDL2, ATP-binding cassett 7e-05
cd03248 226 cd03248, ABCC_TAP, ATP-binding cassette domain of 7e-05
PRK14239 252 PRK14239, PRK14239, phosphate transporter ATP-bind 7e-05
cd03269 210 cd03269, ABC_putative_ATPase, ATP-binding cassette 8e-05
COG4148 352 COG4148, ModC, ABC-type molybdate transport system 9e-05
PRK10584 228 PRK10584, PRK10584, putative ABC transporter ATP-b 9e-05
COG1123 539 COG1123, COG1123, ATPase components of various ABC 1e-04
PRK09984 262 PRK09984, PRK09984, phosphonate/organophosphate es 1e-04
COG2884 223 COG2884, FtsE, Predicted ATPase involved in cell d 1e-04
cd03231 201 cd03231, ABC_CcmA_heme_exporter, Cytochrome c biog 1e-04
PLN03140 1470 PLN03140, PLN03140, ABC transporter G family membe 2e-04
PRK09452 375 PRK09452, potA, putrescine/spermidine ABC transpor 2e-04
COG1245 591 COG1245, COG1245, Predicted ATPase, RNase L inhibi 2e-04
cd03266 218 cd03266, ABC_NatA_sodium_exporter, ATP-binding cas 2e-04
PRK09544 251 PRK09544, znuC, high-affinity zinc transporter ATP 2e-04
PRK09493 240 PRK09493, glnQ, glutamine ABC transporter ATP-bind 2e-04
cd03258 233 cd03258, ABC_MetN_methionine_transporter, ATP-bind 2e-04
COG4138 248 COG4138, BtuD, ABC-type cobalamin transport system 2e-04
PRK14240 250 PRK14240, PRK14240, phosphate transporter ATP-bind 2e-04
PRK14255 252 PRK14255, PRK14255, phosphate ABC transporter ATP- 2e-04
COG4555 245 COG4555, NatA, ABC-type Na+ transport system, ATPa 2e-04
cd03265 220 cd03265, ABC_DrrA, Daunorubicin/doxorubicin resist 2e-04
TIGR03269 520 TIGR03269, met_CoM_red_A2, methyl coenzyme M reduc 2e-04
cd03234226 cd03234, ABCG_White, White pigment protein homolog 3e-04
TIGR03864 236 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-bindi 3e-04
COG1162 301 COG1162, COG1162, Predicted GTPases [General funct 3e-04
PRK11160 574 PRK11160, PRK11160, cysteine/glutathione ABC trans 3e-04
TIGR03375 694 TIGR03375, type_I_sec_LssB, type I secretion syste 3e-04
cd03252 237 cd03252, ABCC_Hemolysin, ATP-binding cassette doma 3e-04
TIGR02142 354 TIGR02142, modC_ABC, molybdenum ABC transporter, A 3e-04
COG1137 243 COG1137, YhbG, ABC-type (unclassified) transport s 3e-04
TIGR01193 708 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin t 3e-04
COG4778 235 COG4778, PhnL, ABC-type phosphonate transport syst 3e-04
TIGR00956 1394 TIGR00956, 3a01205, Pleiotropic Drug Resistance (P 4e-04
PRK15064 530 PRK15064, PRK15064, ABC transporter ATP-binding pr 4e-04
PRK00098 298 PRK00098, PRK00098, GTPase RsgA; Reviewed 4e-04
PRK11144 352 PRK11144, modC, molybdate transporter ATP-binding 4e-04
smart00382 148 smart00382, AAA, ATPases associated with a variety 4e-04
PRK13547 272 PRK13547, hmuV, hemin importer ATP-binding subunit 4e-04
PRK01889 356 PRK01889, PRK01889, GTPase RsgA; Reviewed 5e-04
TIGR02203 571 TIGR02203, MsbA_lipidA, lipid A export permease/AT 5e-04
PRK10419 268 PRK10419, nikE, nickel transporter ATP-binding pro 5e-04
cd03223 166 cd03223, ABCD_peroxisomal_ALDP, ATP-binding casset 5e-04
TIGR01184 230 TIGR01184, ntrCD, nitrate transport ATP-binding su 5e-04
TIGR02769 265 TIGR02769, nickel_nikE, nickel import ATP-binding 6e-04
PRK00349 943 PRK00349, uvrA, excinuclease ABC subunit A; Review 6e-04
PRK10789 569 PRK10789, PRK10789, putative multidrug transporter 7e-04
PRK13647 274 PRK13647, cbiO, cobalt transporter ATP-binding sub 8e-04
COG4178 604 COG4178, COG4178, ABC-type uncharacterized transpo 8e-04
PRK14235 267 PRK14235, PRK14235, phosphate transporter ATP-bind 8e-04
PRK11124 242 PRK11124, artP, arginine transporter ATP-binding s 8e-04
PRK14249 251 PRK14249, PRK14249, phosphate ABC transporter ATP- 8e-04
PRK11701 258 PRK11701, phnK, phosphonate C-P lyase system prote 9e-04
TIGR03411 242 TIGR03411, urea_trans_UrtD, urea ABC transporter, 9e-04
TIGR00956 1394 TIGR00956, 3a01205, Pleiotropic Drug Resistance (P 0.001
PRK14258 261 PRK14258, PRK14258, phosphate ABC transporter ATP- 0.001
TIGR02204 576 TIGR02204, MsbA_rel, ABC transporter, permease/ATP 0.001
COG4175 386 COG4175, ProV, ABC-type proline/glycine betaine tr 0.001
PTZ00243 1560 PTZ00243, PTZ00243, ABC transporter; Provisional 0.001
PRK13636 283 PRK13636, cbiO, cobalt transporter ATP-binding sub 0.001
COG4152 300 COG4152, COG4152, ABC-type uncharacterized transpo 0.001
pfam13207114 pfam13207, AAA_17, AAA domain 0.001
PRK00023 225 PRK00023, cmk, cytidylate kinase; Provisional 0.002
cd03244 221 cd03244, ABCC_MRP_domain2, ATP-binding cassette do 0.002
cd03222 177 cd03222, ABC_RNaseL_inhibitor, ATP-binding cassett 0.002
TIGR03005 252 TIGR03005, ectoine_ehuA, ectoine/hydroxyectoine AB 0.002
PRK11153 343 PRK11153, metN, DL-methionine transporter ATP-bind 0.002
TIGR02633 500 TIGR02633, xylG, D-xylose ABC transporter, ATP-bin 0.002
PRK13639 275 PRK13639, cbiO, cobalt transporter ATP-binding sub 0.002
TIGR03522 301 TIGR03522, GldA_ABC_ATP, gliding motility-associat 0.002
PRK14261 253 PRK14261, PRK14261, phosphate ABC transporter ATP- 0.002
TIGR03740 223 TIGR03740, galliderm_ABC, gallidermin-class lantib 0.002
cd03236 255 cd03236, ABC_RNaseL_inhibitor_domain1, The ATP-bin 0.002
TIGR00630 925 TIGR00630, uvra, excinuclease ABC, A subunit 0.002
COG4136 213 COG4136, COG4136, ABC-type uncharacterized transpo 0.002
TIGR03258 362 TIGR03258, PhnT, 2-aminoethylphosphonate ABC trans 0.002
PRK13537 306 PRK13537, PRK13537, nodulation ABC transporter Nod 0.003
COG0444 316 COG0444, DppD, ABC-type dipeptide/oligopeptide/nic 0.003
COG4598 256 COG4598, HisP, ABC-type histidine transport system 0.003
TIGR01188 302 TIGR01188, drrA, daunorubicin resistance ABC trans 0.003
COG4674 249 COG4674, COG4674, Uncharacterized ABC-type transpo 0.003
TIGR01846 694 TIGR01846, type_I_sec_HlyB, type I secretion syste 0.003
COG0283 222 COG0283, Cmk, Cytidylate kinase [Nucleotide transp 0.004
cd03271 261 cd03271, ABC_UvrA_II, ATP-binding cassette domain 0.004
>gnl|CDD|233207 TIGR00955, 3a01204, The Eye Pigment Precursor Transporter (EPP) Family protein Back     alignment and domain information
 Score =  140 bits (355), Expect = 7e-38
 Identities = 67/210 (31%), Positives = 101/210 (48%), Gaps = 43/210 (20%)

Query: 5   LNVQSIRLTGS---SGKILVNGQERKSACIEQFLKLSCYIQQDDALRPKLTVTEAMMIAS 61
           +N  + R       SG +L+NG    +   ++   +S Y+QQDD   P LTV E +M  +
Sbjct: 68  MNALAFRSPKGVKGSGSVLLNGMPIDA---KEMRAISAYVQQDDLFIPTLTVREHLMFQA 124

Query: 62  HLKLGFKVSTQEKK---DQVSLELWNNFCKKKK-------------KKKR---------- 95
           HL++  +V+ +EK+   D+V   L    C   +             ++KR          
Sbjct: 125 HLRMPRRVTKKEKRERVDEVLQALGLRKCANTRIGVPGRVKGLSGGERKRLAFASELLTD 184

Query: 96  -----------GLDSSSCSQCVSLLANLAKQGRTVVATIHTPSALLFEKFDSLYALAKGH 144
                      GLDS      V +L  LA++G+T++ TIH PS+ LFE FD +  +A+G 
Sbjct: 185 PPLLFCDEPTSGLDSFMAYSVVQVLKGLAQKGKTIICTIHQPSSELFELFDKIILMAEGR 244

Query: 145 CIYRGSISRLVPHLASLGLPCPAYHNPADF 174
             Y GS  + VP  + LG PCP  +NPADF
Sbjct: 245 VAYLGSPDQAVPFFSDLGHPCPENYNPADF 274


[Transport and binding proteins, Other]. Length = 617

>gnl|CDD|213180 cd03213, ABCG_EPDR, Eye pigment and drug resistance transporter subfamily G of the ATP-binding cassette superfamily Back     alignment and domain information
>gnl|CDD|213199 cd03232, ABCG_PDR_domain2, Second domain of the pleiotropic drug resistance-like (PDR) subfamily G of ATP-binding cassette transporters Back     alignment and domain information
>gnl|CDD|233207 TIGR00955, 3a01204, The Eye Pigment Precursor Transporter (EPP) Family protein Back     alignment and domain information
>gnl|CDD|215634 PLN03211, PLN03211, ABC transporter G-25; Provisional Back     alignment and domain information
>gnl|CDD|233208 TIGR00956, 3a01205, Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>gnl|CDD|213201 cd03234, ABCG_White, White pigment protein homolog of ABCG transporter subfamily Back     alignment and domain information
>gnl|CDD|213180 cd03213, ABCG_EPDR, Eye pigment and drug resistance transporter subfamily G of the ATP-binding cassette superfamily Back     alignment and domain information
>gnl|CDD|224059 COG1136, SalX, ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|215599 PLN03140, PLN03140, ABC transporter G family member; Provisional Back     alignment and domain information
>gnl|CDD|213199 cd03232, ABCG_PDR_domain2, Second domain of the pleiotropic drug resistance-like (PDR) subfamily G of ATP-binding cassette transporters Back     alignment and domain information
>gnl|CDD|233207 TIGR00955, 3a01204, The Eye Pigment Precursor Transporter (EPP) Family protein Back     alignment and domain information
>gnl|CDD|213179 cd00267, ABC_ATPase, ATP-binding cassette transporter nucleotide-binding domain Back     alignment and domain information
>gnl|CDD|213222 cd03255, ABC_MJ0796_LolCDE_FtsE, ATP-binding cassette domain of the transporters involved in export of lipoprotein and macrolide, and cell division protein Back     alignment and domain information
>gnl|CDD|224054 COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|213180 cd03213, ABCG_EPDR, Eye pigment and drug resistance transporter subfamily G of the ATP-binding cassette superfamily Back     alignment and domain information
>gnl|CDD|213195 cd03228, ABCC_MRP_Like, ATP-binding cassette domain of multidrug resistance protein-like transporters Back     alignment and domain information
>gnl|CDD|213192 cd03225, ABC_cobalt_CbiO_domain1, First domain of the ATP-binding cassette component of cobalt transport system Back     alignment and domain information
>gnl|CDD|213181 cd03214, ABC_Iron-Siderophores_B12_Hemin, ATP-binding component of iron-siderophores, vitamin B12 and hemin transporters and related proteins Back     alignment and domain information
>gnl|CDD|188353 TIGR03608, L_ocin_972_ABC, putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>gnl|CDD|213184 cd03217, ABC_FeS_Assembly, ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>gnl|CDD|226359 COG3839, MalK, ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|213227 cd03260, ABC_PstB_phosphate_transporter, ATP-binding cassette domain of the phosphate transport system Back     alignment and domain information
>gnl|CDD|223473 COG0396, sufC, Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|213202 cd03235, ABC_Metallic_Cations, ATP-binding cassette domain of the metal-type transporters Back     alignment and domain information
>gnl|CDD|213260 cd03293, ABC_NrtD_SsuB_transporters, ATP-binding cassette domain of the nitrate and sulfonate transporters Back     alignment and domain information
>gnl|CDD|224041 COG1116, TauB, ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|237422 PRK13548, hmuV, hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213201 cd03234, ABCG_White, White pigment protein homolog of ABCG transporter subfamily Back     alignment and domain information
>gnl|CDD|213196 cd03229, ABC_Class3, ATP-binding cassette domain of the binding protein-dependent transport systems Back     alignment and domain information
>gnl|CDD|213199 cd03232, ABCG_PDR_domain2, Second domain of the pleiotropic drug resistance-like (PDR) subfamily G of ATP-binding cassette transporters Back     alignment and domain information
>gnl|CDD|213197 cd03230, ABC_DR_subfamily_A, ATP-binding cassette domain of the drug resistance transporter and related proteins, subfamily A Back     alignment and domain information
>gnl|CDD|224045 COG1120, FepC, ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|213228 cd03261, ABC_Org_Solvent_Resistant, ATP-binding cassette transport system involved in resistant to organic solvents Back     alignment and domain information
>gnl|CDD|233665 TIGR01978, sufC, FeS assembly ATPase SufC Back     alignment and domain information
>gnl|CDD|224051 COG1126, GlnQ, ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|213226 cd03259, ABC_Carb_Solutes_like, ATP-binding cassette domain of the carbohydrate and solute transporters-like Back     alignment and domain information
>gnl|CDD|233208 TIGR00956, 3a01205, Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>gnl|CDD|233208 TIGR00956, 3a01205, Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>gnl|CDD|224046 COG1121, ZnuC, ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|224047 COG1122, CbiO, ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|224042 COG1117, PstB, ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213191 cd03224, ABC_TM1139_LivF_branched, ATP-binding cassette domain of branched-chain amino acid transporter Back     alignment and domain information
>gnl|CDD|224054 COG1131, CcmA, ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|226963 COG4604, CeuD, ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|227321 COG4988, CydD, ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|226647 COG4181, COG4181, Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|213223 cd03256, ABC_PhnC_transporter, ATP-binding cassette domain of the binding protein-dependent phosphonate transport system Back     alignment and domain information
>gnl|CDD|226361 COG3842, PotA, ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|213213 cd03246, ABCC_Protease_Secretion, ATP-binding cassette domain of PrtD, subfamily C Back     alignment and domain information
>gnl|CDD|213263 cd03296, ABC_CysA_sulfate_importer, ATP-binding cassette domain of the sulfate transporter Back     alignment and domain information
>gnl|CDD|213193 cd03226, ABC_cobalt_CbiO_domain2, Second domain of the ATP-binding cassette component of cobalt transport system Back     alignment and domain information
>gnl|CDD|213229 cd03262, ABC_HisP_GlnQ, ATP-binding cassette domain of the histidine and glutamine transporters Back     alignment and domain information
>gnl|CDD|224043 COG1118, CysA, ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|223487 COG0410, LivF, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|224052 COG1127, Ttg2A, ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|226164 COG3638, COG3638, ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|182778 PRK10851, PRK10851, sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|214372 CHL00131, ycf16, sulfate ABC transporter protein; Validated Back     alignment and domain information
>gnl|CDD|213200 cd03233, ABCG_PDR_domain1, First domain of the pleiotropic drug resistance-like subfamily G of ATP-binding cassette transporters Back     alignment and domain information
>gnl|CDD|226360 COG3840, ThiQ, ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|236947 PRK11650, ugpC, glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213183 cd03216, ABC_Carb_Monos_I, First domain of the ATP-binding cassette component of monosaccharide transport system Back     alignment and domain information
>gnl|CDD|237421 PRK13539, PRK13539, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|131266 TIGR02211, LolD_lipo_ex, lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>gnl|CDD|213217 cd03250, ABCC_MRP_domain1, ATP-binding cassette domain 1 of multidrug resistance-associated protein, subfamily C Back     alignment and domain information
>gnl|CDD|215634 PLN03211, PLN03211, ABC transporter G-25; Provisional Back     alignment and domain information
>gnl|CDD|225183 COG2274, SunT, ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|213265 cd03298, ABC_ThiQ_thiamine_transporter, ATP-binding cassette domain of the thiamine transport system Back     alignment and domain information
>gnl|CDD|215599 PLN03140, PLN03140, ABC transporter G family member; Provisional Back     alignment and domain information
>gnl|CDD|188099 TIGR00972, 3a0107s01c2, phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|226929 COG4559, COG4559, ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|181965 PRK09580, sufC, cysteine desulfurase ATPase component; Reviewed Back     alignment and domain information
>gnl|CDD|213214 cd03247, ABCC_cytochrome_bd, ATP-binding cassette domain of CydCD, subfamily C Back     alignment and domain information
>gnl|CDD|213221 cd03254, ABCC_Glucan_exporter_like, ATP-binding cassette domain of glucan transporter and related proteins, subfamily C Back     alignment and domain information
>gnl|CDD|234033 TIGR02857, CydD, thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>gnl|CDD|224049 COG1124, DppF, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213231 cd03264, ABC_drug_resistance_like, ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>gnl|CDD|131368 TIGR02315, ABC_phnC, phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|224048 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|213235 cd03268, ABC_BcrA_bacitracin_resist, ATP-binding cassette domain of the bacitracin-resistance transporter Back     alignment and domain information
>gnl|CDD|213186 cd03219, ABC_Mj1267_LivG_branched, ATP-binding cassette component of branched chain amino acids transport system Back     alignment and domain information
>gnl|CDD|213220 cd03253, ABCC_ATM1_transporter, ATP-binding cassette domain of iron-sulfur clusters transporter, subfamily C Back     alignment and domain information
>gnl|CDD|213187 cd03220, ABC_KpsT_Wzt, ATP-binding cassette component of polysaccharide transport system Back     alignment and domain information
>gnl|CDD|234199 TIGR03410, urea_trans_UrtE, urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>gnl|CDD|130041 TIGR00968, 3a0106s01, sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|182528 PRK10535, PRK10535, macrolide transporter ATP-binding /permease protein; Provisional Back     alignment and domain information
>gnl|CDD|183056 PRK11248, tauB, taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|183055 PRK11247, ssuB, aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|233208 TIGR00956, 3a01205, Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>gnl|CDD|183063 PRK11264, PRK11264, putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>gnl|CDD|223562 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>gnl|CDD|224057 COG1134, TagH, ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|183044 PRK11231, fecE, iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|215599 PLN03140, PLN03140, ABC transporter G family member; Provisional Back     alignment and domain information
>gnl|CDD|172739 PRK14251, PRK14251, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|234357 TIGR03797, NHLM_micro_ABC2, NHLM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|226905 COG4525, TauB, ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|184214 PRK13657, PRK13657, cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>gnl|CDD|182716 PRK10771, thiQ, thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|130260 TIGR01192, chvA, glucan exporter ATP-binding protein Back     alignment and domain information
>gnl|CDD|224053 COG1129, MglA, ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|213259 cd03292, ABC_FtsE_transporter, ATP-binding cassette domain of the cell division transporter Back     alignment and domain information
>gnl|CDD|213268 cd03301, ABC_MalK_N, The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>gnl|CDD|163431 TIGR03719, ABC_ABC_ChvD, ATP-binding cassette protein, ChvD family Back     alignment and domain information
>gnl|CDD|213212 cd03245, ABCC_bacteriocin_exporters, ATP-binding cassette domain of bacteriocin exporters, subfamily C Back     alignment and domain information
>gnl|CDD|183077 PRK11288, araG, L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|227320 COG4987, CydC, ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|213234 cd03267, ABC_NatA_like, ATP-binding cassette domain of an uncharacterized transporter similar in sequence to NatA Back     alignment and domain information
>gnl|CDD|163585 TIGR03873, F420-0_ABC_ATP, proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|234041 TIGR02868, CydC, thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>gnl|CDD|182331 PRK10247, PRK10247, putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>gnl|CDD|213267 cd03300, ABC_PotA_N, ATP-binding cassette domain of the polyamine transporter Back     alignment and domain information
>gnl|CDD|226617 COG4133, CcmA, ABC-type transport system involved in cytochrome c biogenesis, ATPase component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|213224 cd03257, ABC_NikE_OppD_transporters, ATP-binding cassette domain of nickel/oligopeptides specific transporters Back     alignment and domain information
>gnl|CDD|223488 COG0411, LivG, ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|227590 COG5265, ATM1, ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|236992 PRK11819, PRK11819, putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>gnl|CDD|213200 cd03233, ABCG_PDR_domain1, First domain of the pleiotropic drug resistance-like subfamily G of ATP-binding cassette transporters Back     alignment and domain information
>gnl|CDD|172735 PRK14247, PRK14247, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213230 cd03263, ABC_subfamily_A, ATP-binding cassette domain of the lipid transporters, subfamily A Back     alignment and domain information
>gnl|CDD|213264 cd03297, ABC_ModC_molybdenum_transporter, ATP-binding cassette domain of the molybdenum transport system Back     alignment and domain information
>gnl|CDD|217416 pfam03193, DUF258, Protein of unknown function, DUF258 Back     alignment and domain information
>gnl|CDD|226970 COG4619, COG4619, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|236870 PRK11174, PRK11174, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>gnl|CDD|184125 PRK13538, PRK13538, cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>gnl|CDD|213185 cd03218, ABC_YhbG, ATP-binding cassette component of YhbG transport system Back     alignment and domain information
>gnl|CDD|206747 cd01854, YjeQ_EngC, Ribosomal interacting GTPase YjeQ/EngC, a circularly permuted subfamily of the Ras GTPases Back     alignment and domain information
>gnl|CDD|224026 COG1101, PhnK, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|236997 PRK11831, PRK11831, putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>gnl|CDD|235150 PRK03695, PRK03695, vitamin B12-transporter ATPase; Provisional Back     alignment and domain information
>gnl|CDD|234152 TIGR03265, PhnT2, putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|130344 TIGR01277, thiQ, thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|183244 PRK11629, lolD, lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|213188 cd03221, ABCF_EF-3, ATP-binding cassette domain of elongation factor 3, subfamily F Back     alignment and domain information
>gnl|CDD|132027 TIGR02982, heterocyst_DevA, ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>gnl|CDD|226969 COG4618, ArpD, ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>gnl|CDD|213218 cd03251, ABCC_MsbA, ATP-binding cassette domain of the bacterial lipid flippase and related proteins, subfamily C Back     alignment and domain information
>gnl|CDD|185336 PRK15439, PRK15439, autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>gnl|CDD|182852 PRK10938, PRK10938, putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>gnl|CDD|184582 PRK14236, PRK14236, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|200134 TIGR01842, type_I_sec_PrtD, type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>gnl|CDD|224055 COG1132, MdlB, ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>gnl|CDD|237646 PRK14237, PRK14237, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|224044 COG1119, ModF, ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|233305 TIGR01189, ccmA, heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>gnl|CDD|184037 PRK13409, PRK13409, putative ATPase RIL; Provisional Back     alignment and domain information
>gnl|CDD|237648 PRK14250, PRK14250, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|223562 COG0488, Uup, ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>gnl|CDD|131721 TIGR02673, FtsE, cell division ATP-binding protein FtsE Back     alignment and domain information
>gnl|CDD|226364 COG3845, COG3845, ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>gnl|CDD|172730 PRK14242, PRK14242, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|130234 TIGR01166, cbiO, cobalt transport protein ATP-binding subunit Back     alignment and domain information
>gnl|CDD|182692 PRK10744, pstB, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|131377 TIGR02324, CP_lyasePhnL, phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>gnl|CDD|224058 COG1135, AbcC, ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213216 cd03249, ABC_MTABC3_MDL1_MDL2, ATP-binding cassette domain of a mitochondrial protein MTABC3 and related proteins Back     alignment and domain information
>gnl|CDD|213215 cd03248, ABCC_TAP, ATP-binding cassette domain of the Transporter Associated with Antigen Processing, subfamily C Back     alignment and domain information
>gnl|CDD|184585 PRK14239, PRK14239, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|213236 cd03269, ABC_putative_ATPase, ATP-binding cassette domain of an uncharacterized transporter Back     alignment and domain information
>gnl|CDD|226628 COG4148, ModC, ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|182569 PRK10584, PRK10584, putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>gnl|CDD|224048 COG1123, COG1123, ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>gnl|CDD|182182 PRK09984, PRK09984, phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>gnl|CDD|225438 COG2884, FtsE, Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|213198 cd03231, ABC_CcmA_heme_exporter, Cytochrome c biogenesis ATP-binding export protein Back     alignment and domain information
>gnl|CDD|215599 PLN03140, PLN03140, ABC transporter G family member; Provisional Back     alignment and domain information
>gnl|CDD|236523 PRK09452, potA, putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>gnl|CDD|224166 COG1245, COG1245, Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>gnl|CDD|213233 cd03266, ABC_NatA_sodium_exporter, ATP-binding cassette domain of the Na+ transporter Back     alignment and domain information
>gnl|CDD|181939 PRK09544, znuC, high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>gnl|CDD|181906 PRK09493, glnQ, glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>gnl|CDD|213225 cd03258, ABC_MetN_methionine_transporter, ATP-binding cassette domain of methionine transporter Back     alignment and domain information
>gnl|CDD|226622 COG4138, BtuD, ABC-type cobalamin transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|184586 PRK14240, PRK14240, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|172743 PRK14255, PRK14255, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|226927 COG4555, NatA, ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|213232 cd03265, ABC_DrrA, Daunorubicin/doxorubicin resistance ATP-binding protein Back     alignment and domain information
>gnl|CDD|132313 TIGR03269, met_CoM_red_A2, methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>gnl|CDD|213201 cd03234, ABCG_White, White pigment protein homolog of ABCG transporter subfamily Back     alignment and domain information
>gnl|CDD|188394 TIGR03864, PQQ_ABC_ATP, ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>gnl|CDD|224084 COG1162, COG1162, Predicted GTPases [General function prediction only] Back     alignment and domain information
>gnl|CDD|236865 PRK11160, PRK11160, cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>gnl|CDD|234189 TIGR03375, type_I_sec_LssB, type I secretion system ATPase, LssB family Back     alignment and domain information
>gnl|CDD|213219 cd03252, ABCC_Hemolysin, ATP-binding cassette domain of hemolysin B, subfamily C Back     alignment and domain information
>gnl|CDD|131197 TIGR02142, modC_ABC, molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|224060 COG1137, YhbG, ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|130261 TIGR01193, bacteriocin_ABC, ABC-type bacteriocin transporter Back     alignment and domain information
>gnl|CDD|227118 COG4778, PhnL, ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|233208 TIGR00956, 3a01205, Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>gnl|CDD|237894 PRK15064, PRK15064, ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|234631 PRK00098, PRK00098, GTPase RsgA; Reviewed Back     alignment and domain information
>gnl|CDD|182993 PRK11144, modC, molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|214640 smart00382, AAA, ATPases associated with a variety of cellular activities Back     alignment and domain information
>gnl|CDD|184132 PRK13547, hmuV, hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|234988 PRK01889, PRK01889, GTPase RsgA; Reviewed Back     alignment and domain information
>gnl|CDD|131258 TIGR02203, MsbA_lipidA, lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>gnl|CDD|236689 PRK10419, nikE, nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>gnl|CDD|213190 cd03223, ABCD_peroxisomal_ALDP, ATP-binding cassette domain of peroxisomal transporter, subfamily D Back     alignment and domain information
>gnl|CDD|130252 TIGR01184, ntrCD, nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>gnl|CDD|131816 TIGR02769, nickel_nikE, nickel import ATP-binding protein NikE Back     alignment and domain information
>gnl|CDD|234734 PRK00349, uvrA, excinuclease ABC subunit A; Reviewed Back     alignment and domain information
>gnl|CDD|182732 PRK10789, PRK10789, putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>gnl|CDD|237457 PRK13647, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226646 COG4178, COG4178, ABC-type uncharacterized transport system, permease and ATPase components [General function prediction only] Back     alignment and domain information
>gnl|CDD|237645 PRK14235, PRK14235, phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|182980 PRK11124, artP, arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|184590 PRK14249, PRK14249, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|183280 PRK11701, phnK, phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>gnl|CDD|234200 TIGR03411, urea_trans_UrtD, urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>gnl|CDD|233208 TIGR00956, 3a01205, Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>gnl|CDD|184593 PRK14258, PRK14258, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|131259 TIGR02204, MsbA_rel, ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>gnl|CDD|226643 COG4175, ProV, ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|240327 PTZ00243, PTZ00243, ABC transporter; Provisional Back     alignment and domain information
>gnl|CDD|184196 PRK13636, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|226631 COG4152, COG4152, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|221983 pfam13207, AAA_17, AAA domain Back     alignment and domain information
>gnl|CDD|234579 PRK00023, cmk, cytidylate kinase; Provisional Back     alignment and domain information
>gnl|CDD|213211 cd03244, ABCC_MRP_domain2, ATP-binding cassette domain 2 of multidrug resistance-associated protein Back     alignment and domain information
>gnl|CDD|213189 cd03222, ABC_RNaseL_inhibitor, ATP-binding cassette domain of RNase L inhibitor Back     alignment and domain information
>gnl|CDD|132050 TIGR03005, ectoine_ehuA, ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|236863 PRK11153, metN, DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|131681 TIGR02633, xylG, D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>gnl|CDD|184199 PRK13639, cbiO, cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>gnl|CDD|132561 TIGR03522, GldA_ABC_ATP, gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>gnl|CDD|172749 PRK14261, PRK14261, phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>gnl|CDD|163452 TIGR03740, galliderm_ABC, gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>gnl|CDD|213203 cd03236, ABC_RNaseL_inhibitor_domain1, The ATP-binding cassette domain 1 of RNase L inhibitor Back     alignment and domain information
>gnl|CDD|233062 TIGR00630, uvra, excinuclease ABC, A subunit Back     alignment and domain information
>gnl|CDD|226620 COG4136, COG4136, ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|132302 TIGR03258, PhnT, 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>gnl|CDD|237420 PRK13537, PRK13537, nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>gnl|CDD|223521 COG0444, DppD, ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>gnl|CDD|226961 COG4598, HisP, ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|130256 TIGR01188, drrA, daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>gnl|CDD|227019 COG4674, COG4674, Uncharacterized ABC-type transport system, ATPase component [General function prediction only] Back     alignment and domain information
>gnl|CDD|233596 TIGR01846, type_I_sec_HlyB, type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>gnl|CDD|223360 COG0283, Cmk, Cytidylate kinase [Nucleotide transport and metabolism] Back     alignment and domain information
>gnl|CDD|213238 cd03271, ABC_UvrA_II, ATP-binding cassette domain II of the excision repair protein UvrA Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 286
KOG0061|consensus 613 100.0
PRK13549 506 xylose transporter ATP-binding subunit; Provisiona 100.0
KOG0065|consensus 1391 100.0
PRK10762 501 D-ribose transporter ATP binding protein; Provisio 100.0
PRK09700 510 D-allose transporter ATP-binding protein; Provisio 100.0
TIGR02633 500 xylG D-xylose ABC transporter, ATP-binding protein 100.0
PRK10982 491 galactose/methyl galaxtoside transporter ATP-bindi 100.0
TIGR03269 520 met_CoM_red_A2 methyl coenzyme M reductase system, 100.0
PRK11288 501 araG L-arabinose transporter ATP-binding protein; 100.0
PRK15439 510 autoinducer 2 ABC transporter ATP-binding protein 100.0
COG1123 539 ATPase components of various ABC-type transport sy 100.0
PRK15134 529 microcin C ABC transporter ATP-binding protein Yej 100.0
PRK10261 623 glutathione transporter ATP-binding protein; Provi 100.0
PRK10938 490 putative molybdenum transport ATP-binding protein 100.0
TIGR00955 617 3a01204 The Eye Pigment Precursor Transporter (EPP 99.98
PLN03211 659 ABC transporter G-25; Provisional 99.97
COG1122235 CbiO ABC-type cobalt transport system, ATPase comp 99.97
PRK15064 530 ABC transporter ATP-binding protein; Provisional 99.97
COG1126240 GlnQ ABC-type polar amino acid transport system, A 99.96
TIGR03719 552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 99.96
PRK11819 556 putative ABC transporter ATP-binding protein; Revi 99.96
COG1135339 AbcC ABC-type metal ion transport system, ATPase c 99.96
PLN03140 1470 ABC transporter G family member; Provisional 99.96
TIGR00956 1394 3a01205 Pleiotropic Drug Resistance (PDR) Family p 99.96
PLN03140 1470 ABC transporter G family member; Provisional 99.96
TIGR00956 1394 3a01205 Pleiotropic Drug Resistance (PDR) Family p 99.96
COG4172 534 ABC-type uncharacterized transport system, duplica 99.96
COG3839338 MalK ABC-type sugar transport systems, ATPase comp 99.95
COG1125309 OpuBA ABC-type proline/glycine betaine transport s 99.95
COG3845 501 ABC-type uncharacterized transport systems, ATPase 99.95
PRK13409 590 putative ATPase RIL; Provisional 99.95
COG3842352 PotA ABC-type spermidine/putrescine transport syst 99.94
COG1118345 CysA ABC-type sulfate/molybdate transport systems, 99.94
COG1127263 Ttg2A ABC-type transport system involved in resist 99.94
COG3840231 ThiQ ABC-type thiamine transport system, ATPase co 99.94
COG1129 500 MglA ABC-type sugar transport system, ATPase compo 99.94
COG1131293 CcmA ABC-type multidrug transport system, ATPase c 99.93
COG2884223 FtsE Predicted ATPase involved in cell division [C 99.93
COG3638258 ABC-type phosphate/phosphonate transport system, A 99.93
PRK11147 635 ABC transporter ATPase component; Reviewed 99.93
COG1136226 SalX ABC-type antimicrobial peptide transport syst 99.93
PRK11650356 ugpC glycerol-3-phosphate transporter ATP-binding 99.93
PRK10636 638 putative ABC transporter ATP-binding protein; Prov 99.93
COG1120258 FepC ABC-type cobalamin/Fe3+-siderophores transpor 99.93
TIGR01186363 proV glycine betaine/L-proline transport ATP bindi 99.93
TIGR03258362 PhnT 2-aminoethylphosphonate ABC transport system, 99.93
TIGR03265353 PhnT2 putative 2-aminoethylphosphonate ABC transpo 99.93
PRK11432351 fbpC ferric transporter ATP-binding subunit; Provi 99.92
TIGR02314343 ABC_MetN D-methionine ABC transporter, ATP-binding 99.92
PRK09452375 potA putrescine/spermidine ABC transporter ATPase 99.92
PRK11607377 potG putrescine transporter ATP-binding subunit; P 99.92
PRK13643288 cbiO cobalt transporter ATP-binding subunit; Provi 99.92
PRK13537306 nodulation ABC transporter NodI; Provisional 99.92
PRK13651305 cobalt transporter ATP-binding subunit; Provisiona 99.92
COG1116248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 99.92
PRK10851353 sulfate/thiosulfate transporter subunit; Provision 99.91
PLN03073 718 ABC transporter F family; Provisional 99.91
TIGR01188302 drrA daunorubicin resistance ABC transporter ATP-b 99.91
KOG0065|consensus 1391 99.91
PRK11000369 maltose/maltodextrin transporter ATP-binding prote 99.91
PRK13647274 cbiO cobalt transporter ATP-binding subunit; Provi 99.91
PRK13631320 cbiO cobalt transporter ATP-binding subunit; Provi 99.91
cd03261235 ABC_Org_Solvent_Resistant ABC (ATP-binding cassett 99.9
PRK13634290 cbiO cobalt transporter ATP-binding subunit; Provi 99.9
PRK13536340 nodulation factor exporter subunit NodI; Provision 99.9
PRK13650279 cbiO cobalt transporter ATP-binding subunit; Provi 99.9
PRK11153343 metN DL-methionine transporter ATP-binding subunit 99.9
TIGR01187325 potA spermidine/putrescine ABC transporter ATP-bin 99.9
PRK13637287 cbiO cobalt transporter ATP-binding subunit; Provi 99.9
TIGR01288303 nodI ATP-binding ABC transporter family nodulation 99.9
cd03265220 ABC_DrrA DrrA is the ATP-binding protein component 99.9
COG4175386 ProV ABC-type proline/glycine betaine transport sy 99.9
cd03219236 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC trans 99.9
PRK10070400 glycine betaine transporter ATP-binding subunit; P 99.89
PRK13635279 cbiO cobalt transporter ATP-binding subunit; Provi 99.89
cd03218232 ABC_YhbG The ABC transporters belonging to the Yhb 99.89
COG1117253 PstB ABC-type phosphate transport system, ATPase c 99.89
COG1124252 DppF ABC-type dipeptide/oligopeptide/nickel transp 99.89
PRK15079331 oligopeptide ABC transporter ATP-binding protein O 99.89
COG4148352 ModC ABC-type molybdate transport system, ATPase c 99.89
PRK13646286 cbiO cobalt transporter ATP-binding subunit; Provi 99.89
PRK09536402 btuD corrinoid ABC transporter ATPase; Reviewed 99.89
TIGR03522301 GldA_ABC_ATP gliding motility-associated ABC trans 99.89
cd03266218 ABC_NatA_sodium_exporter NatA is the ATPase compon 99.89
TIGR03415382 ABC_choXWV_ATP choline ABC transporter, ATP-bindin 99.89
COG0410237 LivF ABC-type branched-chain amino acid transport 99.89
TIGR00960216 3a0501s02 Type II (General) Secretory Pathway (IIS 99.89
PRK13636283 cbiO cobalt transporter ATP-binding subunit; Provi 99.89
cd03296239 ABC_CysA_sulfate_importer Part of the ABC transpor 99.89
cd03295242 ABC_OpuCA_Osmoprotection OpuCA is a the ATP bindin 99.89
cd03258233 ABC_MetN_methionine_transporter MetN (also known a 99.89
cd03234226 ABCG_White The White subfamily represents ABC tran 99.89
cd03224222 ABC_TM1139_LivF_branched LivF (TM1139) is part of 99.89
PRK13652277 cbiO cobalt transporter ATP-binding subunit; Provi 99.89
cd03268208 ABC_BcrA_bacitracin_resist The BcrA subfamily repr 99.89
cd03263220 ABC_subfamily_A The ABCA subfamily mediates the tr 99.89
cd03260227 ABC_PstB_phosphate_transporter Phosphate uptake is 99.88
PRK14247250 phosphate ABC transporter ATP-binding protein; Pro 99.88
PRK13640282 cbiO cobalt transporter ATP-binding subunit; Provi 99.88
cd03294269 ABC_Pro_Gly_Bertaine This family comprises the gly 99.88
PRK13644274 cbiO cobalt transporter ATP-binding subunit; Provi 99.88
cd03264211 ABC_drug_resistance_like ABC-type multidrug transp 99.88
PRK09473330 oppD oligopeptide transporter ATP-binding componen 99.88
cd03256241 ABC_PhnC_transporter ABC-type phosphate/phosphonat 99.88
cd03259213 ABC_Carb_Solutes_like ABC Carbohydrate and Solute 99.88
PRK13642277 cbiO cobalt transporter ATP-binding subunit; Provi 99.88
TIGR02142354 modC_ABC molybdenum ABC transporter, ATP-binding p 99.88
PRK13641287 cbiO cobalt transporter ATP-binding subunit; Provi 99.88
PRK11144352 modC molybdate transporter ATP-binding protein; Pr 99.88
cd03301213 ABC_MalK_N The N-terminal ATPase domain of the mal 99.88
PRK09493240 glnQ glutamine ABC transporter ATP-binding protein 99.88
PRK13648269 cbiO cobalt transporter ATP-binding subunit; Provi 99.88
PRK11614237 livF leucine/isoleucine/valine transporter ATP-bin 99.88
PRK14267253 phosphate ABC transporter ATP-binding protein; Pro 99.88
COG0444316 DppD ABC-type dipeptide/oligopeptide/nickel transp 99.88
PRK13639275 cbiO cobalt transporter ATP-binding subunit; Provi 99.88
PRK13632271 cbiO cobalt transporter ATP-binding subunit; Provi 99.88
PRK11022326 dppD dipeptide transporter ATP-binding subunit; Pr 99.88
PRK13633280 cobalt transporter ATP-binding subunit; Provisiona 99.88
PRK11831269 putative ABC transporter ATP-binding protein YrbF; 99.87
PRK11264250 putative amino-acid ABC transporter ATP-binding pr 99.87
cd03269210 ABC_putative_ATPase This subfamily is involved in 99.87
PRK11629233 lolD lipoprotein transporter ATP-binding subunit; 99.87
PRK10619257 histidine/lysine/arginine/ornithine transporter su 99.87
PRK13649280 cbiO cobalt transporter ATP-binding subunit; Provi 99.87
PRK13638271 cbiO cobalt transporter ATP-binding subunit; Provi 99.87
PRK10895241 lipopolysaccharide ABC transporter ATP-binding pro 99.87
PRK11308327 dppF dipeptide transporter ATP-binding subunit; Pr 99.87
PRK14268258 phosphate ABC transporter ATP-binding protein; Pro 99.87
PRK10908222 cell division protein FtsE; Provisional 99.87
cd03255218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 99.87
cd03293220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 99.87
cd03226205 ABC_cobalt_CbiO_domain2 Domain II of the ABC compo 99.87
PRK11124242 artP arginine transporter ATP-binding subunit; Pro 99.87
PRK11300255 livG leucine/isoleucine/valine transporter ATP-bin 99.87
cd03292214 ABC_FtsE_transporter FtsE is a hydrophilic nucleot 99.87
cd03299235 ABC_ModC_like Archeal protein closely related to M 99.87
PRK10771232 thiQ thiamine transporter ATP-binding subunit; Pro 99.87
TIGR02315243 ABC_phnC phosphonate ABC transporter, ATP-binding 99.87
TIGR00972247 3a0107s01c2 phosphate ABC transporter, ATP-binding 99.87
cd03298211 ABC_ThiQ_thiamine_transporter ABC-type thiamine tr 99.87
TIGR01978243 sufC FeS assembly ATPase SufC. SufC is part of the 99.86
TIGR03873256 F420-0_ABC_ATP proposed F420-0 ABC transporter, AT 99.86
COG1101263 PhnK ABC-type uncharacterized transport system, AT 99.86
cd03213194 ABCG_EPDR ABCG transporters are involved in eye pi 99.86
COG4555245 NatA ABC-type Na+ transport system, ATPase compone 99.86
PRK11231255 fecE iron-dicitrate transporter ATP-binding subuni 99.86
TIGR03740223 galliderm_ABC gallidermin-class lantibiotic protec 99.86
TIGR02673214 FtsE cell division ATP-binding protein FtsE. This 99.86
PRK15093330 antimicrobial peptide ABC transporter ATP-binding 99.86
COG1121254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 99.86
PRK10575265 iron-hydroxamate transporter ATP-binding subunit; 99.86
TIGR03410230 urea_trans_UrtE urea ABC transporter, ATP-binding 99.86
TIGR01277213 thiQ thiamine ABC transporter, ATP-binding protein 99.86
TIGR03005252 ectoine_ehuA ectoine/hydroxyectoine ABC transporte 99.86
PRK14273254 phosphate ABC transporter ATP-binding protein; Pro 99.86
PRK14269246 phosphate ABC transporter ATP-binding protein; Pro 99.86
TIGR01184230 ntrCD nitrate transport ATP-binding subunits C and 99.86
PRK13548258 hmuV hemin importer ATP-binding subunit; Provision 99.86
PRK10253265 iron-enterobactin transporter ATP-binding protein; 99.86
cd03262213 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP- 99.86
cd03257228 ABC_NikE_OppD_transporters The ABC transporter sub 99.86
PRK15112267 antimicrobial peptide ABC system ATP-binding prote 99.86
COG0411250 LivG ABC-type branched-chain amino acid transport 99.86
cd03232192 ABC_PDR_domain2 The pleiotropic drug resistance-li 99.86
PRK14250241 phosphate ABC transporter ATP-binding protein; Pro 99.86
COG4181228 Predicted ABC-type transport system involved in ly 99.86
TIGR03864236 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, 99.86
TIGR02769265 nickel_nikE nickel import ATP-binding protein NikE 99.86
cd03300232 ABC_PotA_N PotA is an ABC-type transporter and the 99.86
PRK09984262 phosphonate/organophosphate ester transporter subu 99.86
COG4525259 TauB ABC-type taurine transport system, ATPase com 99.86
PRK14272252 phosphate ABC transporter ATP-binding protein; Pro 99.86
PRK14235267 phosphate transporter ATP-binding protein; Provisi 99.85
PRK14256252 phosphate ABC transporter ATP-binding protein; Pro 99.85
PRK03695248 vitamin B12-transporter ATPase; Provisional 99.85
cd03225211 ABC_cobalt_CbiO_domain1 Domain I of the ABC compon 99.85
TIGR02211221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 99.85
PRK14274259 phosphate ABC transporter ATP-binding protein; Pro 99.85
cd03297214 ABC_ModC_molybdenum_transporter ModC is an ABC-typ 99.85
cd03233202 ABC_PDR_domain1 The pleiotropic drug resistance (P 99.85
PRK13645289 cbiO cobalt transporter ATP-binding subunit; Provi 99.85
COG4988559 CydD ABC-type transport system involved in cytochr 99.85
PRK11174588 cysteine/glutathione ABC transporter membrane/ATP- 99.85
PRK14242253 phosphate transporter ATP-binding protein; Provisi 99.85
PRK11248255 tauB taurine transporter ATP-binding subunit; Prov 99.85
TIGR03411242 urea_trans_UrtD urea ABC transporter, ATP-binding 99.85
TIGR012572272 rim_protein retinal-specific rim ABC transporter. 99.85
PRK14270251 phosphate ABC transporter ATP-binding protein; Pro 99.85
TIGR00968237 3a0106s01 sulfate ABC transporter, ATP-binding pro 99.85
COG1137243 YhbG ABC-type (unclassified) transport system, ATP 99.85
TIGR02770230 nickel_nikD nickel import ATP-binding protein NikD 99.85
COG2274709 SunT ABC-type bacteriocin/lantibiotic exporters, c 99.85
PRK14241258 phosphate transporter ATP-binding protein; Provisi 99.85
PRK10744260 pstB phosphate transporter ATP-binding protein; Pr 99.85
PRK10584228 putative ABC transporter ATP-binding protein YbbA; 99.85
PRK14240250 phosphate transporter ATP-binding protein; Provisi 99.84
PRK14245250 phosphate ABC transporter ATP-binding protein; Pro 99.84
PRK14253249 phosphate ABC transporter ATP-binding protein; Pro 99.84
PRK10261623 glutathione transporter ATP-binding protein; Provi 99.84
TIGR01257 2272 rim_protein retinal-specific rim ABC transporter. 99.84
PRK15134529 microcin C ABC transporter ATP-binding protein Yej 99.84
PRK14249251 phosphate ABC transporter ATP-binding protein; Pro 99.84
COG0488 530 Uup ATPase components of ABC transporters with dup 99.84
COG4559259 ABC-type hemin transport system, ATPase component 99.84
PRK14259269 phosphate ABC transporter ATP-binding protein; Pro 99.84
TIGR00630 924 uvra excinuclease ABC, A subunit. This family is b 99.84
cd03252237 ABCC_Hemolysin The ABC-transporter hemolysin B is 99.84
PRK14239252 phosphate transporter ATP-binding protein; Provisi 99.84
PRK14262250 phosphate ABC transporter ATP-binding protein; Pro 99.84
PRK11247257 ssuB aliphatic sulfonates transport ATP-binding su 99.84
PRK14244251 phosphate ABC transporter ATP-binding protein; Pro 99.84
COG1123539 ATPase components of various ABC-type transport sy 99.84
PRK14236272 phosphate transporter ATP-binding protein; Provisi 99.84
PRK13547272 hmuV hemin importer ATP-binding subunit; Provision 99.84
PRK14237267 phosphate transporter ATP-binding protein; Provisi 99.84
PRK14257329 phosphate ABC transporter ATP-binding protein; Pro 99.84
TIGR03797686 NHPM_micro_ABC2 NHPM bacteriocin system ABC transp 99.84
PRK14261253 phosphate ABC transporter ATP-binding protein; Pro 99.84
PRK14258261 phosphate ABC transporter ATP-binding protein; Pro 99.84
cd03267236 ABC_NatA_like Similar in sequence to NatA, this is 99.84
PRK14271276 phosphate ABC transporter ATP-binding protein; Pro 99.84
PRK00349 943 uvrA excinuclease ABC subunit A; Reviewed 99.84
TIGR01193708 bacteriocin_ABC ABC-type bacteriocin transporter. 99.83
PRK10790592 putative multidrug transporter membrane\ATP-bindin 99.83
PRK11176582 lipid transporter ATP-binding/permease protein; Pr 99.83
cd03235213 ABC_Metallic_Cations ABC component of the metal-ty 99.83
COG4152300 ABC-type uncharacterized transport system, ATPase 99.83
TIGR03796710 NHPM_micro_ABC1 NHPM bacteriocin system ABC transp 99.83
PRK14238271 phosphate transporter ATP-binding protein; Provisi 99.83
PRK14260259 phosphate ABC transporter ATP-binding protein; Pro 99.83
PRK14263261 phosphate ABC transporter ATP-binding protein; Pro 99.83
PRK14248268 phosphate ABC transporter ATP-binding protein; Pro 99.83
cd03249238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 99.83
cd03289275 ABCC_CFTR2 The CFTR subfamily domain 2. The cystic 99.83
PRK14255252 phosphate ABC transporter ATP-binding protein; Pro 99.83
TIGR03375694 type_I_sec_LssB type I secretion system ATPase, Ls 99.83
PRK14251251 phosphate ABC transporter ATP-binding protein; Pro 99.83
cd03369207 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-ty 99.83
TIGR03771223 anch_rpt_ABC anchored repeat-type ABC transporter, 99.83
PRK14275286 phosphate ABC transporter ATP-binding protein; Pro 99.83
TIGR02982220 heterocyst_DevA ABC exporter ATP-binding subunit, 99.82
cd03230173 ABC_DR_subfamily_A This family of ATP-binding prot 99.82
PRK14254285 phosphate ABC transporter ATP-binding protein; Pro 99.82
TIGR01842544 type_I_sec_PrtD type I secretion system ABC transp 99.82
COG1132567 MdlB ABC-type multidrug transport system, ATPase a 99.82
PRK13549506 xylose transporter ATP-binding subunit; Provisiona 99.82
cd03251234 ABCC_MsbA MsbA is an essential ABC transporter, cl 99.82
cd03215182 ABC_Carb_Monos_II This family represents domain II 99.82
PRK14243264 phosphate transporter ATP-binding protein; Provisi 99.82
PRK10418254 nikD nickel transporter ATP-binding protein NikD; 99.82
PRK14246257 phosphate ABC transporter ATP-binding protein; Pro 99.82
COG4604252 CeuD ABC-type enterochelin transport system, ATPas 99.82
PRK14266250 phosphate ABC transporter ATP-binding protein; Pro 99.82
PRK13657588 cyclic beta-1,2-glucan ABC transporter; Provisiona 99.81
cd03253236 ABCC_ATM1_transporter ATM1 is an ABC transporter t 99.81
cd03217200 ABC_FeS_Assembly ABC-type transport system involve 99.81
PRK11160574 cysteine/glutathione ABC transporter membrane/ATP- 99.81
PRK11701258 phnK phosphonate C-P lyase system protein PhnK; Pr 99.81
COG4598256 HisP ABC-type histidine transport system, ATPase c 99.81
CHL00131252 ycf16 sulfate ABC transporter protein; Validated 99.81
cd03254229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 99.81
PRK10762501 D-ribose transporter ATP binding protein; Provisio 99.81
PRK10419268 nikE nickel transporter ATP-binding protein NikE; 99.81
TIGR01846694 type_I_sec_HlyB type I secretion system ABC transp 99.81
KOG0057|consensus591 99.81
PRK14265274 phosphate ABC transporter ATP-binding protein; Pro 99.81
PRK10789569 putative multidrug transporter membrane\ATP-bindin 99.81
TIGR03269520 met_CoM_red_A2 methyl coenzyme M reductase system, 99.81
TIGR00958711 3a01208 Conjugate Transporter-2 (CT2) Family prote 99.8
TIGR02633500 xylG D-xylose ABC transporter, ATP-binding protein 99.8
cd03245220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 99.8
PRK14252265 phosphate ABC transporter ATP-binding protein; Pro 99.8
cd03246173 ABCC_Protease_Secretion This family represents the 99.8
TIGR03608206 L_ocin_972_ABC putative bacteriocin export ABC tra 99.8
cd03229178 ABC_Class3 This class is comprised of all BPD (Bin 99.8
PRK11288501 araG L-arabinose transporter ATP-binding protein; 99.8
TIGR01192585 chvA glucan exporter ATP-binding protein. This mod 99.8
TIGR02203571 MsbA_lipidA lipid A export permease/ATP-binding pr 99.79
PRK14264305 phosphate ABC transporter ATP-binding protein; Pro 99.79
TIGR02323253 CP_lyasePhnK phosphonate C-P lyase system protein 99.79
PRK09700510 D-allose transporter ATP-binding protein; Provisio 99.79
PRK15439510 autoinducer 2 ABC transporter ATP-binding protein 99.79
COG4618580 ArpD ABC-type protease/lipase transport system, AT 99.79
PRK10535 648 macrolide transporter ATP-binding /permease protei 99.79
cd03244221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. 99.79
TIGR02204576 MsbA_rel ABC transporter, permease/ATP-binding pro 99.79
PRK09580248 sufC cysteine desulfurase ATPase component; Review 99.79
PRK10247225 putative ABC transporter ATP-binding protein YbbL; 99.78
cd03288257 ABCC_SUR2 The SUR domain 2. The sulfonylurea recep 99.78
COG4172534 ABC-type uncharacterized transport system, duplica 99.78
PRK00635 1809 excinuclease ABC subunit A; Provisional 99.78
cd03247178 ABCC_cytochrome_bd The CYD subfamily implicated in 99.78
KOG0055|consensus 1228 99.78
PRK13543214 cytochrome c biogenesis protein CcmA; Provisional 99.78
PRK15056272 manganese/iron transporter ATP-binding protein; Pr 99.78
PTZ002651466 multidrug resistance protein (mdr1); Provisional 99.77
TIGR01166190 cbiO cobalt transport protein ATP-binding subunit. 99.77
PLN032321495 ABC transporter C family member; Provisional 99.77
cd03231201 ABC_CcmA_heme_exporter CcmA, the ATP-binding compo 99.76
PLN031301622 ABC transporter C family member; Provisional 99.76
PRK13546264 teichoic acids export protein ATP-binding subunit; 99.76
PTZ002431560 ABC transporter; Provisional 99.76
PRK13538204 cytochrome c biogenesis protein CcmA; Provisional 99.76
KOG0058|consensus716 99.76
cd03248226 ABCC_TAP TAP, the Transporter Associated with Anti 99.76
COG4987573 CydC ABC-type transport system involved in cytochr 99.75
TIGR02324224 CP_lyasePhnL phosphonate C-P lyase system protein 99.75
TIGR01189198 ccmA heme ABC exporter, ATP-binding protein CcmA. 99.75
COG4161242 ArtP ABC-type arginine transport system, ATPase co 99.75
KOG0059|consensus885 99.75
TIGR009571522 MRP_assoc_pro multi drug resistance-associated pro 99.75
TIGR012711490 CFTR_protein cystic fibrosis transmembrane conduct 99.74
PRK00635 1809 excinuclease ABC subunit A; Provisional 99.74
PRK13540200 cytochrome c biogenesis protein CcmA; Provisional 99.74
cd03220224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo 99.74
PRK13545 549 tagH teichoic acids export protein ATP-binding sub 99.74
cd03237246 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 o 99.74
PRK09544251 znuC high-affinity zinc transporter ATPase; Review 99.73
cd03228171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 99.73
PRK13539207 cytochrome c biogenesis protein CcmA; Provisional 99.73
TIGR02857529 CydD thiol reductant ABC exporter, CydD subunit. U 99.72
PRK10982491 galactose/methyl galaxtoside transporter ATP-bindi 99.72
COG4619223 ABC-type uncharacterized transport system, ATPase 99.72
cd03214180 ABC_Iron-Siderophores_B12_Hemin ABC transporters, 99.7
COG4674249 Uncharacterized ABC-type transport system, ATPase 99.7
PTZ00265 1466 multidrug resistance protein (mdr1); Provisional 99.7
cd03290218 ABCC_SUR1_N The SUR domain 1. The sulfonylurea rec 99.7
cd03216163 ABC_Carb_Monos_I This family represents the domain 99.69
cd03250204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. 99.69
PRK10522547 multidrug transporter membrane component/ATP-bindi 99.69
COG0396251 sufC Cysteine desulfurase activator ATPase [Posttr 99.69
cd03291282 ABCC_CFTR1 The CFTR subfamily domain 1. The cystic 99.69
TIGR02868529 CydC thiol reductant ABC exporter, CydC subunit. T 99.69
TIGR01194555 cyc_pep_trnsptr cyclic peptide transporter. This m 99.68
PRK10938490 putative molybdenum transport ATP-binding protein 99.67
KOG0055|consensus1228 99.65
PRK13541195 cytochrome c biogenesis protein CcmA; Provisional 99.65
cd03236255 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 o 99.64
PRK15064530 ABC transporter ATP-binding protein; Provisional 99.64
cd03223166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 99.64
PRK13409590 putative ATPase RIL; Provisional 99.64
PRK15177213 Vi polysaccharide export ATP-binding protein VexC; 99.64
COG4136213 ABC-type uncharacterized transport system, ATPase 99.63
PRK11819556 putative ABC transporter ATP-binding protein; Revi 99.61
COG4586325 ABC-type uncharacterized transport system, ATPase 99.6
COG0178 935 UvrA Excinuclease ATPase subunit [DNA replication, 99.6
COG4138248 BtuD ABC-type cobalamin transport system, ATPase c 99.6
COG4167267 SapF ABC-type antimicrobial peptide transport syst 99.59
TIGR03719552 ABC_ABC_ChvD ATP-binding cassette protein, ChvD fa 99.59
TIGR00957 1522 MRP_assoc_pro multi drug resistance-associated pro 99.58
TIGR01271 1490 CFTR_protein cystic fibrosis transmembrane conduct 99.58
COG4608268 AppF ABC-type oligopeptide transport system, ATPas 99.56
COG1245 591 Predicted ATPase, RNase L inhibitor (RLI) homolog 99.55
PLN03130 1622 ABC transporter C family member; Provisional 99.55
PLN03232 1495 ABC transporter C family member; Provisional 99.55
cd03222177 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibi 99.53
KOG0927|consensus 614 99.53
COG1121 254 ZnuC ABC-type Mn/Zn transport systems, ATPase comp 99.52
PRK10636638 putative ABC transporter ATP-binding protein; Prov 99.52
TIGR00954659 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FA 99.51
COG1119257 ModF ABC-type molybdenum transport system, ATPase 99.51
KOG0056|consensus790 99.5
PTZ00243 1560 ABC transporter; Provisional 99.49
cd00267157 ABC_ATPase ABC (ATP-binding cassette) transporter 99.49
PRK11147635 ABC transporter ATPase component; Reviewed 99.49
PLN03073718 ABC transporter F family; Provisional 99.49
COG5265497 ATM1 ABC-type transport system involved in Fe-S cl 99.48
COG1134249 TagH ABC-type polysaccharide/polyol phosphate tran 99.47
COG1129500 MglA ABC-type sugar transport system, ATPase compo 99.47
COG1116 248 TauB ABC-type nitrate/sulfonate/bicarbonate transp 99.46
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 99.44
COG1134 249 TagH ABC-type polysaccharide/polyol phosphate tran 99.44
COG0410 237 LivF ABC-type branched-chain amino acid transport 99.43
COG3845501 ABC-type uncharacterized transport systems, ATPase 99.42
KOG0054|consensus 1381 99.42
COG1119 257 ModF ABC-type molybdenum transport system, ATPase 99.42
cd03216 163 ABC_Carb_Monos_I This family represents the domain 99.4
COG3638 258 ABC-type phosphate/phosphonate transport system, A 99.39
cd03255 218 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of 99.39
COG1131 293 CcmA ABC-type multidrug transport system, ATPase c 99.38
TIGR00960 216 3a0501s02 Type II (General) Secretory Pathway (IIS 99.37
cd03221144 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is 99.37
COG1136 226 SalX ABC-type antimicrobial peptide transport syst 99.37
PRK10247 225 putative ABC transporter ATP-binding protein YbbL; 99.37
cd03267 236 ABC_NatA_like Similar in sequence to NatA, this is 99.37
PRK13536 340 nodulation factor exporter subunit NodI; Provision 99.37
PRK09544 251 znuC high-affinity zinc transporter ATPase; Review 99.36
COG0411 250 LivG ABC-type branched-chain amino acid transport 99.36
cd03293 220 ABC_NrtD_SsuB_transporters NrtD and SsuB are the A 99.36
PRK11247 257 ssuB aliphatic sulfonates transport ATP-binding su 99.36
PRK13537 306 nodulation ABC transporter NodI; Provisional 99.36
cd03220 224 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transpo 99.36
PRK13637 287 cbiO cobalt transporter ATP-binding subunit; Provi 99.36
PRK11629 233 lolD lipoprotein transporter ATP-binding subunit; 99.36
PRK11831 269 putative ABC transporter ATP-binding protein YrbF; 99.35
cd03223 166 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cass 99.35
PRK13646 286 cbiO cobalt transporter ATP-binding subunit; Provi 99.35
PRK10895 241 lipopolysaccharide ABC transporter ATP-binding pro 99.35
TIGR01288 303 nodI ATP-binding ABC transporter family nodulation 99.35
COG3842 352 PotA ABC-type spermidine/putrescine transport syst 99.35
PRK14250 241 phosphate ABC transporter ATP-binding protein; Pro 99.35
cd03258 233 ABC_MetN_methionine_transporter MetN (also known a 99.35
cd03228 171 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein 99.35
COG3839 338 MalK ABC-type sugar transport systems, ATPase comp 99.35
PRK10584 228 putative ABC transporter ATP-binding protein YbbA; 99.35
PRK13543 214 cytochrome c biogenesis protein CcmA; Provisional 99.34
PRK13641 287 cbiO cobalt transporter ATP-binding subunit; Provi 99.34
KOG0054|consensus1381 99.34
TIGR02211 221 LolD_lipo_ex lipoprotein releasing system, ATP-bin 99.34
cd03238176 ABC_UvrA The excision repair protein UvrA; Nucleot 99.34
cd03294 269 ABC_Pro_Gly_Bertaine This family comprises the gly 99.34
cd03266 218 ABC_NatA_sodium_exporter NatA is the ATPase compon 99.34
PRK14241 258 phosphate transporter ATP-binding protein; Provisi 99.34
cd03257 228 ABC_NikE_OppD_transporters The ABC transporter sub 99.34
PRK11264 250 putative amino-acid ABC transporter ATP-binding pr 99.34
PRK11614 237 livF leucine/isoleucine/valine transporter ATP-bin 99.34
PRK11701 258 phnK phosphonate C-P lyase system protein PhnK; Pr 99.34
PRK10575 265 iron-hydroxamate transporter ATP-binding subunit; 99.33
PRK13651 305 cobalt transporter ATP-binding subunit; Provisiona 99.33
PRK13634 290 cbiO cobalt transporter ATP-binding subunit; Provi 99.33
COG0396 251 sufC Cysteine desulfurase activator ATPase [Posttr 99.33
PRK14267 253 phosphate ABC transporter ATP-binding protein; Pro 99.33
PRK14273 254 phosphate ABC transporter ATP-binding protein; Pro 99.33
TIGR02324 224 CP_lyasePhnL phosphonate C-P lyase system protein 99.33
PRK15056 272 manganese/iron transporter ATP-binding protein; Pr 99.33
PRK13647 274 cbiO cobalt transporter ATP-binding subunit; Provi 99.32
PRK13643 288 cbiO cobalt transporter ATP-binding subunit; Provi 99.32
PRK11300 255 livG leucine/isoleucine/valine transporter ATP-bin 99.32
TIGR02323 253 CP_lyasePhnK phosphonate C-P lyase system protein 99.32
PRK09536 402 btuD corrinoid ABC transporter ATPase; Reviewed 99.32
PRK13650 279 cbiO cobalt transporter ATP-binding subunit; Provi 99.32
cd03271261 ABC_UvrA_II The excision repair protein UvrA domai 99.32
PRK14235 267 phosphate transporter ATP-binding protein; Provisi 99.32
cd03246 173 ABCC_Protease_Secretion This family represents the 99.32
PRK14268 258 phosphate ABC transporter ATP-binding protein; Pro 99.32
PRK13649 280 cbiO cobalt transporter ATP-binding subunit; Provi 99.32
PRK14237 267 phosphate transporter ATP-binding protein; Provisi 99.32
PRK13652 277 cbiO cobalt transporter ATP-binding subunit; Provi 99.32
PRK11153 343 metN DL-methionine transporter ATP-binding subunit 99.31
cd03249 238 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) 99.31
PRK15112 267 antimicrobial peptide ABC system ATP-binding prote 99.31
PRK14247 250 phosphate ABC transporter ATP-binding protein; Pro 99.31
TIGR02769 265 nickel_nikE nickel import ATP-binding protein NikE 99.31
COG1127 263 Ttg2A ABC-type transport system involved in resist 99.31
PRK10253 265 iron-enterobactin transporter ATP-binding protein; 99.31
PRK14272 252 phosphate ABC transporter ATP-binding protein; Pro 99.31
PRK09984 262 phosphonate/organophosphate ester transporter subu 99.31
cd03233 202 ABC_PDR_domain1 The pleiotropic drug resistance (P 99.31
PRK13640 282 cbiO cobalt transporter ATP-binding subunit; Provi 99.31
PRK14240 250 phosphate transporter ATP-binding protein; Provisi 99.31
COG1124 252 DppF ABC-type dipeptide/oligopeptide/nickel transp 99.31
PRK13635 279 cbiO cobalt transporter ATP-binding subunit; Provi 99.3
PRK13633 280 cobalt transporter ATP-binding subunit; Provisiona 99.3
PRK13645 289 cbiO cobalt transporter ATP-binding subunit; Provi 99.3
PRK14274 259 phosphate ABC transporter ATP-binding protein; Pro 99.3
PRK10744 260 pstB phosphate transporter ATP-binding protein; Pr 99.3
PRK14270 251 phosphate ABC transporter ATP-binding protein; Pro 99.3
PRK14259 269 phosphate ABC transporter ATP-binding protein; Pro 99.3
PRK14253 249 phosphate ABC transporter ATP-binding protein; Pro 99.3
cd03250 204 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C. 99.3
PRK11000 369 maltose/maltodextrin transporter ATP-binding prote 99.3
PRK10619 257 histidine/lysine/arginine/ornithine transporter su 99.3
PRK14249 251 phosphate ABC transporter ATP-binding protein; Pro 99.3
TIGR02314 343 ABC_MetN D-methionine ABC transporter, ATP-binding 99.3
PRK14256 252 phosphate ABC transporter ATP-binding protein; Pro 99.3
PRK13631 320 cbiO cobalt transporter ATP-binding subunit; Provi 99.3
PRK14261 253 phosphate ABC transporter ATP-binding protein; Pro 99.29
PRK13546 264 teichoic acids export protein ATP-binding subunit; 99.29
PRK13648 269 cbiO cobalt transporter ATP-binding subunit; Provi 99.29
PRK14242 253 phosphate transporter ATP-binding protein; Provisi 99.29
cd03254 229 ABCC_Glucan_exporter_like Glucan exporter ATP-bind 99.29
PRK14262 250 phosphate ABC transporter ATP-binding protein; Pro 99.29
PRK13636 283 cbiO cobalt transporter ATP-binding subunit; Provi 99.29
cd03244 221 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C. 99.29
PRK14260 259 phosphate ABC transporter ATP-binding protein; Pro 99.29
PRK14239 252 phosphate transporter ATP-binding protein; Provisi 99.29
PRK14265 274 phosphate ABC transporter ATP-binding protein; Pro 99.29
COG1122 235 CbiO ABC-type cobalt transport system, ATPase comp 99.29
cd03245 220 ABCC_bacteriocin_exporters ABC-type bacteriocin ex 99.29
PRK14251 251 phosphate ABC transporter ATP-binding protein; Pro 99.29
cd03248 226 ABCC_TAP TAP, the Transporter Associated with Anti 99.28
cd03232 192 ABC_PDR_domain2 The pleiotropic drug resistance-li 99.28
PRK14271 276 phosphate ABC transporter ATP-binding protein; Pro 99.28
PRK14243 264 phosphate transporter ATP-binding protein; Provisi 99.28
PRK11650 356 ugpC glycerol-3-phosphate transporter ATP-binding 99.28
PRK14246 257 phosphate ABC transporter ATP-binding protein; Pro 99.28
cd03234 226 ABCG_White The White subfamily represents ABC tran 99.28
PRK10418 254 nikD nickel transporter ATP-binding protein NikD; 99.28
TIGR03265 353 PhnT2 putative 2-aminoethylphosphonate ABC transpo 99.28
PRK11432 351 fbpC ferric transporter ATP-binding subunit; Provi 99.28
cd00267 157 ABC_ATPase ABC (ATP-binding cassette) transporter 99.28
PRK13632 271 cbiO cobalt transporter ATP-binding subunit; Provi 99.28
PRK14248 268 phosphate ABC transporter ATP-binding protein; Pro 99.27
cd03213 194 ABCG_EPDR ABCG transporters are involved in eye pi 99.27
PRK14238 271 phosphate transporter ATP-binding protein; Provisi 99.27
TIGR02982 220 heterocyst_DevA ABC exporter ATP-binding subunit, 99.27
PRK14252 265 phosphate ABC transporter ATP-binding protein; Pro 99.27
TIGR03258 362 PhnT 2-aminoethylphosphonate ABC transport system, 99.27
COG4107258 PhnK ABC-type phosphonate transport system, ATPase 99.27
>KOG0061|consensus Back     alignment and domain information
Probab=100.00  E-value=1.1e-39  Score=308.11  Aligned_cols=177  Identities=43%  Similarity=0.632  Sum_probs=166.5

Q ss_pred             Cchhhhh-cCCCCC--CceeEEEECCeecCchhhhcccceeeEEecCcccCCCCCHHHHHHHHHhcCCCCCCCHHHHHHH
Q psy8953           1 MSIELNV-QSIRLT--GSSGKILVNGQERKSACIEQFLKLSCYIQQDDALRPKLTVTEAMMIASHLKLGFKVSTQEKKDQ   77 (286)
Q Consensus         1 ~stll~~-~g~~~~--~~~G~i~~~g~~~~~~~~~~~~~~~g~v~Q~~~~~~~~tV~e~l~f~~~~~~~~~~~~~~~~~~   77 (286)
                      ||||||+ ||+.++  .++|+|++||++...   +.+++.+|||+|||.+++++||+|++.|+|++|+|...+.+|+++|
T Consensus        69 KtTLL~~Lagr~~~~~~~~G~ilvNG~~~~~---~~~~~~s~yV~QdD~l~~~LTV~EtL~f~A~lrlp~~~~~~~k~~~  145 (613)
T KOG0061|consen   69 KTTLLNALAGRLNGGLKLSGEILLNGRPRDS---RSFRKISGYVQQDDVLLPTLTVRETLRFSALLRLPSSLSKEEKRER  145 (613)
T ss_pred             HHHHHHHHhccccCCCcceEEEEECCccCch---hhhhheeEEEcccccccccccHHHHHHHHHHhcCCCCCCHHHHHHH
Confidence            8999999 999875  599999999988776   7899999999999999999999999999999999998999999999


Q ss_pred             Hh-------hh-hhhccc---------CCccc-------------------cCCCcchHHHHHHHHHHHHHHhCCCEEEE
Q psy8953          78 VS-------LE-LWNNFC---------KKKKK-------------------KKRGLDSSSCSQCVSLLANLAKQGRTVVA  121 (286)
Q Consensus        78 v~-------l~-~~~~~~---------gG~kq-------------------ptsgLD~~~~~~~~~~l~~l~~~g~tii~  121 (286)
                      |+       |. |+|+++         |||||                   ||||||+.++.+++++|++++++|+|||+
T Consensus       146 V~~vi~~LgL~~~~~t~ig~~~~rgiSGGErkRvsia~Ell~~P~iLflDEPTSGLDS~sA~~vv~~Lk~lA~~grtVi~  225 (613)
T KOG0061|consen  146 VEEVISELGLEKCADTLIGNPGIRGLSGGERKRVSIALELLTDPSILFLDEPTSGLDSFSALQVVQLLKRLARSGRTVIC  225 (613)
T ss_pred             HHHHHHHcCChhhccceecCCCCCccccchhhHHHHHHHHHcCCCEEEecCCCCCcchhhHHHHHHHHHHHHhCCCEEEE
Confidence            99       44 777765         68999                   99999999999999999999999999999


Q ss_pred             EEcCCCHHHHHHhhhHhhhcCCeeecccChhcHHHHHHhCCCCCCCCCCCCCccccccC
Q psy8953         122 TIHTPSALLFEKFDSLYALAKGHCIYRGSISRLVPHLASLGLPCPAYHNPADFPNLAKQ  180 (286)
Q Consensus       122 ~~h~~~~~~~~~~d~v~~l~~G~i~~~g~~~~~~~~~~~~g~~~p~~~~~~~~~~~~~~  180 (286)
                      ++|||+..++++||++++|.+|+++|.|++.++.++|...|++||.+.||+|+..+...
T Consensus       226 tIHQPss~lf~lFD~l~lLs~G~~vy~G~~~~~~~ff~~~G~~~P~~~Npadf~l~l~s  284 (613)
T KOG0061|consen  226 TIHQPSSELFELFDKLLLLSEGEVVYSGSPRELLEFFSSLGFPCPELENPADFLLDLLS  284 (613)
T ss_pred             EEeCCcHHHHHHHhHhhhhcCCcEEEecCHHHHHHHHHhCCCCCCCcCChHHHHHHHHc
Confidence            99999999999999999999999999999999999999999999999999999877544



>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>KOG0065|consensus Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>TIGR00955 3a01204 The Eye Pigment Precursor Transporter (EPP) Family protein Back     alignment and domain information
>PLN03211 ABC transporter G-25; Provisional Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1126 GlnQ ABC-type polar amino acid transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>COG1135 AbcC ABC-type metal ion transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PLN03140 ABC transporter G family member; Provisional Back     alignment and domain information
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>PLN03140 ABC transporter G family member; Provisional Back     alignment and domain information
>TIGR00956 3a01205 Pleiotropic Drug Resistance (PDR) Family protein Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG1125 OpuBA ABC-type proline/glycine betaine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>COG1118 CysA ABC-type sulfate/molybdate transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG3840 ThiQ ABC-type thiamine transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>COG2884 FtsE Predicted ATPase involved in cell division [Cell division and chromosome partitioning] Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1120 FepC ABC-type cobalamin/Fe3+-siderophores transport systems, ATPase components [Inorganic ion transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>TIGR01186 proV glycine betaine/L-proline transport ATP binding subunit Back     alignment and domain information
>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK09452 potA putrescine/spermidine ABC transporter ATPase protein; Reviewed Back     alignment and domain information
>PRK11607 potG putrescine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13537 nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>PRK13651 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10851 sulfate/thiosulfate transporter subunit; Provisional Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>TIGR01188 drrA daunorubicin resistance ABC transporter ATP-binding subunit Back     alignment and domain information
>KOG0065|consensus Back     alignment and domain information
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03261 ABC_Org_Solvent_Resistant ABC (ATP-binding cassette) transport system involved in resistant to organic solvents; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13536 nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01187 potA spermidine/putrescine ABC transporter ATP-binding subunit Back     alignment and domain information
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>cd03265 ABC_DrrA DrrA is the ATP-binding protein component of a bacterial exporter complex that confers resistance to the antibiotics daunorubicin and doxorubicin Back     alignment and domain information
>COG4175 ProV ABC-type proline/glycine betaine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd03219 ABC_Mj1267_LivG_branched The Mj1267/LivG ABC transporter subfamily is involved in the transport of the hydrophobic amino acids leucine, isoleucine and valine Back     alignment and domain information
>PRK10070 glycine betaine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03218 ABC_YhbG The ABC transporters belonging to the YhbG family are similar to members of the Mj1267_LivG family, which is involved in the transport of branched-chain amino acids Back     alignment and domain information
>COG1117 PstB ABC-type phosphate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK15079 oligopeptide ABC transporter ATP-binding protein OppF; Provisional Back     alignment and domain information
>COG4148 ModC ABC-type molybdate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>TIGR03522 GldA_ABC_ATP gliding motility-associated ABC transporter ATP-binding subunit GldA Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>TIGR03415 ABC_choXWV_ATP choline ABC transporter, ATP-binding protein Back     alignment and domain information
>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03296 ABC_CysA_sulfate_importer Part of the ABC transporter complex cysAWTP involved in sulfate import Back     alignment and domain information
>cd03295 ABC_OpuCA_Osmoprotection OpuCA is a the ATP binding component of a bacterial solute transporter that serves a protective role to cells growing in a hyperosmolar environment Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>cd03224 ABC_TM1139_LivF_branched LivF (TM1139) is part of the LIV-I bacterial ABC-type two-component transport system that imports neutral, branched-chain amino acids Back     alignment and domain information
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03268 ABC_BcrA_bacitracin_resist The BcrA subfamily represents ABC transporters involved in peptide antibiotic resistance Back     alignment and domain information
>cd03263 ABC_subfamily_A The ABCA subfamily mediates the transport of a variety of lipid compounds Back     alignment and domain information
>cd03260 ABC_PstB_phosphate_transporter Phosphate uptake is of fundamental importance in the cell physiology of bacteria because phosphate is required as a nutrient Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>PRK13644 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03264 ABC_drug_resistance_like ABC-type multidrug transport system, ATPase component Back     alignment and domain information
>PRK09473 oppD oligopeptide transporter ATP-binding component; Provisional Back     alignment and domain information
>cd03256 ABC_PhnC_transporter ABC-type phosphate/phosphonate transport system Back     alignment and domain information
>cd03259 ABC_Carb_Solutes_like ABC Carbohydrate and Solute Transporters-like subgroup Back     alignment and domain information
>PRK13642 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02142 modC_ABC molybdenum ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11144 modC molybdate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03301 ABC_MalK_N The N-terminal ATPase domain of the maltose transporter, MalK Back     alignment and domain information
>PRK09493 glnQ glutamine ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG0444 DppD ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13639 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11022 dppD dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13633 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>cd03269 ABC_putative_ATPase This subfamily is involved in drug resistance, nodulation, lipid transport, and bacteriocin and lantibiotic immunity Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13638 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11308 dppF dipeptide transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10908 cell division protein FtsE; Provisional Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>cd03226 ABC_cobalt_CbiO_domain2 Domain II of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>PRK11124 artP arginine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03292 ABC_FtsE_transporter FtsE is a hydrophilic nucleotide-binding protein that binds FtsX to form a heterodimeric ATP-binding cassette (ABC)-type transporter that associates with the bacterial inner membrane Back     alignment and domain information
>cd03299 ABC_ModC_like Archeal protein closely related to ModC Back     alignment and domain information
>PRK10771 thiQ thiamine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02315 ABC_phnC phosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR00972 3a0107s01c2 phosphate ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03298 ABC_ThiQ_thiamine_transporter ABC-type thiamine tranport system; part of the binding-protein-dependent transport system tbpA-thiPQ for thiamine and TPP Back     alignment and domain information
>TIGR01978 sufC FeS assembly ATPase SufC Back     alignment and domain information
>TIGR03873 F420-0_ABC_ATP proposed F420-0 ABC transporter, ATP-binding protein Back     alignment and domain information
>COG1101 PhnK ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>COG4555 NatA ABC-type Na+ transport system, ATPase component [Energy production and conversion / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK11231 fecE iron-dicitrate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03740 galliderm_ABC gallidermin-class lantibiotic protection ABC transporter, ATP-binding subunit Back     alignment and domain information
>TIGR02673 FtsE cell division ATP-binding protein FtsE Back     alignment and domain information
>PRK15093 antimicrobial peptide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03410 urea_trans_UrtE urea ABC transporter, ATP-binding protein UrtE Back     alignment and domain information
>TIGR01277 thiQ thiamine ABC transporter, ATP-binding protein Back     alignment and domain information
>TIGR03005 ectoine_ehuA ectoine/hydroxyectoine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14269 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01184 ntrCD nitrate transport ATP-binding subunits C and D Back     alignment and domain information
>PRK13548 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03262 ABC_HisP_GlnQ_permeases HisP and GlnQ are the ATP-binding components of the bacterial periplasmic histidine and glutamine permeases, repectively Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4181 Predicted ABC-type transport system involved in lysophospholipase L1 biosynthesis, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR03864 PQQ_ABC_ATP ABC transporter, ATP-binding subunit, PQQ-dependent alcohol dehydrogenase system Back     alignment and domain information
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE Back     alignment and domain information
>cd03300 ABC_PotA_N PotA is an ABC-type transporter and the ATPase component of the spermidine/putrescine-preferential uptake system consisting of PotA, -B, -C, and -D Back     alignment and domain information
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>COG4525 TauB ABC-type taurine transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14235 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK03695 vitamin B12-transporter ATPase; Provisional Back     alignment and domain information
>cd03225 ABC_cobalt_CbiO_domain1 Domain I of the ABC component of a cobalt transport family found in bacteria, archaea, and eukaryota Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03297 ABC_ModC_molybdenum_transporter ModC is an ABC-type transporter and the ATPase component of a molybdate transport system that also includes the periplasmic binding protein ModA and the membrane protein ModB Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG4988 CydD ABC-type transport system involved in cytochrome bd biosynthesis, ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11174 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11248 tauB taurine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR03411 urea_trans_UrtD urea ABC transporter, ATP-binding protein UrtD Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR00968 3a0106s01 sulfate ABC transporter, ATP-binding protein Back     alignment and domain information
>COG1137 YhbG ABC-type (unclassified) transport system, ATPase component [General function prediction only] Back     alignment and domain information
>TIGR02770 nickel_nikD nickel import ATP-binding protein NikD Back     alignment and domain information
>COG2274 SunT ABC-type bacteriocin/lantibiotic exporters, contain an N-terminal double-glycine peptidase domain [Defense mechanisms] Back     alignment and domain information
>PRK14241 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>PRK14240 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14245 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10261 glutathione transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01257 rim_protein retinal-specific rim ABC transporter Back     alignment and domain information
>PRK15134 microcin C ABC transporter ATP-binding protein YejF; Provisional Back     alignment and domain information
>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG0488 Uup ATPase components of ABC transporters with duplicated ATPase domains [General function prediction only] Back     alignment and domain information
>COG4559 ABC-type hemin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR00630 uvra excinuclease ABC, A subunit Back     alignment and domain information
>cd03252 ABCC_Hemolysin The ABC-transporter hemolysin B is a central component of the secretion machinery that translocates the toxin, hemolysin A, in a Sec-independent fashion across both membranes of E Back     alignment and domain information
>PRK14239 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14244 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1123 ATPase components of various ABC-type transport systems, contain duplicated ATPase [General function prediction only] Back     alignment and domain information
>PRK14236 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13547 hmuV hemin importer ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14237 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14257 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03797 NHPM_micro_ABC2 NHPM bacteriocin system ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14258 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK00349 uvrA excinuclease ABC subunit A; Reviewed Back     alignment and domain information
>TIGR01193 bacteriocin_ABC ABC-type bacteriocin transporter Back     alignment and domain information
>PRK10790 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>PRK11176 lipid transporter ATP-binding/permease protein; Provisional Back     alignment and domain information
>cd03235 ABC_Metallic_Cations ABC component of the metal-type transporters Back     alignment and domain information
>COG4152 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>TIGR03796 NHPM_micro_ABC1 NHPM bacteriocin system ABC transporter, peptidase/ATP-binding protein Back     alignment and domain information
>PRK14238 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14263 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>cd03289 ABCC_CFTR2 The CFTR subfamily domain 2 Back     alignment and domain information
>PRK14255 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03375 type_I_sec_LssB type I secretion system ATPase, LssB family Back     alignment and domain information
>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03369 ABCC_NFT1 Domain 2 of NFT1 (New full-length MRP-type transporter 1) Back     alignment and domain information
>TIGR03771 anch_rpt_ABC anchored repeat-type ABC transporter, ATP-binding subunit Back     alignment and domain information
>PRK14275 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>cd03230 ABC_DR_subfamily_A This family of ATP-binding proteins belongs to a multisubunit transporter involved in drug resistance (BcrA and DrrA), nodulation, lipid transport, and lantibiotic immunity Back     alignment and domain information
>PRK14254 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01842 type_I_sec_PrtD type I secretion system ABC transporter, PrtD family Back     alignment and domain information
>COG1132 MdlB ABC-type multidrug transport system, ATPase and permease components [Defense mechanisms] Back     alignment and domain information
>PRK13549 xylose transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03251 ABCC_MsbA MsbA is an essential ABC transporter, closely related to eukaryotic MDR proteins Back     alignment and domain information
>cd03215 ABC_Carb_Monos_II This family represents domain II of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>PRK14243 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>PRK14246 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4604 CeuD ABC-type enterochelin transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK14266 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13657 cyclic beta-1,2-glucan ABC transporter; Provisional Back     alignment and domain information
>cd03253 ABCC_ATM1_transporter ATM1 is an ABC transporter that is expressed in the mitochondria Back     alignment and domain information
>cd03217 ABC_FeS_Assembly ABC-type transport system involved in Fe-S cluster assembly, ATPase component Back     alignment and domain information
>PRK11160 cysteine/glutathione ABC transporter membrane/ATP-binding component; Reviewed Back     alignment and domain information
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>COG4598 HisP ABC-type histidine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>CHL00131 ycf16 sulfate ABC transporter protein; Validated Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>PRK10762 D-ribose transporter ATP binding protein; Provisional Back     alignment and domain information
>PRK10419 nikE nickel transporter ATP-binding protein NikE; Provisional Back     alignment and domain information
>TIGR01846 type_I_sec_HlyB type I secretion system ABC transporter, HlyB family Back     alignment and domain information
>KOG0057|consensus Back     alignment and domain information
>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10789 putative multidrug transporter membrane\ATP-binding components; Provisional Back     alignment and domain information
>TIGR03269 met_CoM_red_A2 methyl coenzyme M reductase system, component A2 Back     alignment and domain information
>TIGR00958 3a01208 Conjugate Transporter-2 (CT2) Family protein Back     alignment and domain information
>TIGR02633 xylG D-xylose ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>PRK14252 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>TIGR03608 L_ocin_972_ABC putative bacteriocin export ABC transporter, lactococcin 972 group Back     alignment and domain information
>cd03229 ABC_Class3 This class is comprised of all BPD (Binding Protein Dependent) systems that are largely represented in archaea and eubacteria and are primarily involved in scavenging solutes from the environment Back     alignment and domain information
>PRK11288 araG L-arabinose transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01192 chvA glucan exporter ATP-binding protein Back     alignment and domain information
>TIGR02203 MsbA_lipidA lipid A export permease/ATP-binding protein MsbA Back     alignment and domain information
>PRK14264 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>PRK09700 D-allose transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK15439 autoinducer 2 ABC transporter ATP-binding protein LsrA; Provisional Back     alignment and domain information
>COG4618 ArpD ABC-type protease/lipase transport system, ATPase and permease components [General function prediction only] Back     alignment and domain information
>PRK10535 macrolide transporter ATP-binding /permease protein; Provisional Back     alignment and domain information
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C Back     alignment and domain information
>TIGR02204 MsbA_rel ABC transporter, permease/ATP-binding protein Back     alignment and domain information
>PRK09580 sufC cysteine desulfurase ATPase component; Reviewed Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>cd03288 ABCC_SUR2 The SUR domain 2 Back     alignment and domain information
>COG4172 ABC-type uncharacterized transport system, duplicated ATPase component [General function prediction only] Back     alignment and domain information
>PRK00635 excinuclease ABC subunit A; Provisional Back     alignment and domain information
>cd03247 ABCC_cytochrome_bd The CYD subfamily implicated in cytochrome bd biogenesis Back     alignment and domain information
>KOG0055|consensus Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>TIGR01166 cbiO cobalt transport protein ATP-binding subunit Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>cd03231 ABC_CcmA_heme_exporter CcmA, the ATP-binding component of the bacterial CcmAB transporter Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>PRK13538 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>KOG0058|consensus Back     alignment and domain information
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>COG4987 CydC ABC-type transport system involved in cytochrome bd biosynthesis, fused ATPase and permease components [Energy production and conversion / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>TIGR01189 ccmA heme ABC exporter, ATP-binding protein CcmA Back     alignment and domain information
>COG4161 ArtP ABC-type arginine transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0059|consensus Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>PRK00635 excinuclease ABC subunit A; Provisional Back     alignment and domain information
>PRK13540 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>PRK13545 tagH teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>cd03237 ABC_RNaseL_inhibitor_domain2 The ATPase domain 2 of RNase L inhibitor Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>PRK13539 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>TIGR02857 CydD thiol reductant ABC exporter, CydD subunit Back     alignment and domain information
>PRK10982 galactose/methyl galaxtoside transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG4619 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>cd03214 ABC_Iron-Siderophores_B12_Hemin ABC transporters, involved in the uptake of siderophores, heme, and vitamin B12, are widely conserved in bacteria and archaea Back     alignment and domain information
>COG4674 Uncharacterized ABC-type transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PTZ00265 multidrug resistance protein (mdr1); Provisional Back     alignment and domain information
>cd03290 ABCC_SUR1_N The SUR domain 1 Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C Back     alignment and domain information
>PRK10522 multidrug transporter membrane component/ATP-binding component; Provisional Back     alignment and domain information
>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03291 ABCC_CFTR1 The CFTR subfamily domain 1 Back     alignment and domain information
>TIGR02868 CydC thiol reductant ABC exporter, CydC subunit Back     alignment and domain information
>TIGR01194 cyc_pep_trnsptr cyclic peptide transporter Back     alignment and domain information
>PRK10938 putative molybdenum transport ATP-binding protein ModF; Provisional Back     alignment and domain information
>KOG0055|consensus Back     alignment and domain information
>PRK13541 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>cd03236 ABC_RNaseL_inhibitor_domain1 The ATPase domain 1 of RNase L inhibitor Back     alignment and domain information
>PRK15064 ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>PRK13409 putative ATPase RIL; Provisional Back     alignment and domain information
>PRK15177 Vi polysaccharide export ATP-binding protein VexC; Provisional Back     alignment and domain information
>COG4136 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>PRK11819 putative ABC transporter ATP-binding protein; Reviewed Back     alignment and domain information
>COG4586 ABC-type uncharacterized transport system, ATPase component [General function prediction only] Back     alignment and domain information
>COG0178 UvrA Excinuclease ATPase subunit [DNA replication, recombination, and repair] Back     alignment and domain information
>COG4138 BtuD ABC-type cobalamin transport system, ATPase component [Coenzyme metabolism] Back     alignment and domain information
>COG4167 SapF ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>TIGR03719 ABC_ABC_ChvD ATP-binding cassette protein, ChvD family Back     alignment and domain information
>TIGR00957 MRP_assoc_pro multi drug resistance-associated protein (MRP) Back     alignment and domain information
>TIGR01271 CFTR_protein cystic fibrosis transmembrane conductor regulator (CFTR) Back     alignment and domain information
>COG4608 AppF ABC-type oligopeptide transport system, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only] Back     alignment and domain information
>PLN03130 ABC transporter C family member; Provisional Back     alignment and domain information
>PLN03232 ABC transporter C family member; Provisional Back     alignment and domain information
>cd03222 ABC_RNaseL_inhibitor The ABC ATPase RNase L inhibitor (RLI) is a key enzyme in ribosomal biogenesis, formation of translation preinitiation complexes, and assembly of HIV capsids Back     alignment and domain information
>KOG0927|consensus Back     alignment and domain information
>COG1121 ZnuC ABC-type Mn/Zn transport systems, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK10636 putative ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR00954 3a01203 Peroxysomal Fatty Acyl CoA Transporter (FAT) Family protei Back     alignment and domain information
>COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG0056|consensus Back     alignment and domain information
>PTZ00243 ABC transporter; Provisional Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PRK11147 ABC transporter ATPase component; Reviewed Back     alignment and domain information
>PLN03073 ABC transporter F family; Provisional Back     alignment and domain information
>COG5265 ATM1 ABC-type transport system involved in Fe-S cluster assembly, permease and ATPase components [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG1129 MglA ABC-type sugar transport system, ATPase component [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG1116 TauB ABC-type nitrate/sulfonate/bicarbonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>COG1134 TagH ABC-type polysaccharide/polyol phosphate transport system, ATPase component [Carbohydrate transport and metabolism / Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG0410 LivF ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>COG3845 ABC-type uncharacterized transport systems, ATPase components [General function prediction only] Back     alignment and domain information
>KOG0054|consensus Back     alignment and domain information
>COG1119 ModF ABC-type molybdenum transport system, ATPase component/photorepair protein PhrA [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03216 ABC_Carb_Monos_I This family represents the domain I of the carbohydrate uptake proteins that transport only monosaccharides (Monos) Back     alignment and domain information
>COG3638 ABC-type phosphate/phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03255 ABC_MJ0796_Lo1CDE_FtsE This family is comprised of MJ0796 ATP-binding cassette, macrolide-specific ABC-type efflux carrier (MacAB), and proteins involved in cell division (FtsE), and release of liporoteins from the cytoplasmic membrane (LolCDE) Back     alignment and domain information
>COG1131 CcmA ABC-type multidrug transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>TIGR00960 3a0501s02 Type II (General) Secretory Pathway (IISP) Family protein Back     alignment and domain information
>cd03221 ABCF_EF-3 ABCF_EF-3 Elongation factor 3 (EF-3) is a cytosolic protein required by fungal ribosomes for in vitro protein synthesis and for in vivo growth Back     alignment and domain information
>COG1136 SalX ABC-type antimicrobial peptide transport system, ATPase component [Defense mechanisms] Back     alignment and domain information
>PRK10247 putative ABC transporter ATP-binding protein YbbL; Provisional Back     alignment and domain information
>cd03267 ABC_NatA_like Similar in sequence to NatA, this is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled to proton or K+ uptake Back     alignment and domain information
>PRK13536 nodulation factor exporter subunit NodI; Provisional Back     alignment and domain information
>PRK09544 znuC high-affinity zinc transporter ATPase; Reviewed Back     alignment and domain information
>COG0411 LivG ABC-type branched-chain amino acid transport systems, ATPase component [Amino acid transport and metabolism] Back     alignment and domain information
>cd03293 ABC_NrtD_SsuB_transporters NrtD and SsuB are the ATP-binding subunits of the bacterial ABC-type nitrate and sulfonate transport systems, respectively Back     alignment and domain information
>PRK11247 ssuB aliphatic sulfonates transport ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13537 nodulation ABC transporter NodI; Provisional Back     alignment and domain information
>cd03220 ABC_KpsT_Wzt ABC_KpsT_Wzt The KpsT/Wzt ABC transporter subfamily is involved in extracellular polysaccharide export Back     alignment and domain information
>PRK13637 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11629 lolD lipoprotein transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11831 putative ABC transporter ATP-binding protein YrbF; Provisional Back     alignment and domain information
>cd03223 ABCD_peroxisomal_ALDP Peroxisomal ATP-binding cassette transporter (Pat) is involved in the import of very long-chain fatty acids (VLCFA) into the peroxisome Back     alignment and domain information
>PRK13646 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK10895 lipopolysaccharide ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR01288 nodI ATP-binding ABC transporter family nodulation protein NodI Back     alignment and domain information
>COG3842 PotA ABC-type spermidine/putrescine transport systems, ATPase components [Amino acid transport and metabolism] Back     alignment and domain information
>PRK14250 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03258 ABC_MetN_methionine_transporter MetN (also known as YusC) is an ABC-type transporter encoded by metN of the metNPQ operon in Bacillus subtilis that is involved in methionine transport Back     alignment and domain information
>cd03228 ABCC_MRP_Like The MRP (Mutidrug Resistance Protein)-like transporters are involved in drug, peptide, and lipid export Back     alignment and domain information
>COG3839 MalK ABC-type sugar transport systems, ATPase components [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK10584 putative ABC transporter ATP-binding protein YbbA; Provisional Back     alignment and domain information
>PRK13543 cytochrome c biogenesis protein CcmA; Provisional Back     alignment and domain information
>PRK13641 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>KOG0054|consensus Back     alignment and domain information
>TIGR02211 LolD_lipo_ex lipoprotein releasing system, ATP-binding protein Back     alignment and domain information
>cd03238 ABC_UvrA The excision repair protein UvrA; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>cd03294 ABC_Pro_Gly_Bertaine This family comprises the glycine betaine/L-proline ATP binding subunit in bacteria and its equivalents in archaea Back     alignment and domain information
>cd03266 ABC_NatA_sodium_exporter NatA is the ATPase component of a bacterial ABC-type Na+ transport system called NatAB, which catalyzes ATP-dependent electrogenic Na+ extrusion without mechanically coupled proton or K+ uptake Back     alignment and domain information
>PRK14241 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03257 ABC_NikE_OppD_transporters The ABC transporter subfamily specific for the transport of dipeptides, oligopeptides (OppD), and nickel (NikDE) Back     alignment and domain information
>PRK11264 putative amino-acid ABC transporter ATP-binding protein YecC; Provisional Back     alignment and domain information
>PRK11614 livF leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11701 phnK phosphonate C-P lyase system protein PhnK; Provisional Back     alignment and domain information
>PRK10575 iron-hydroxamate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13651 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13634 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>COG0396 sufC Cysteine desulfurase activator ATPase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14267 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14273 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02324 CP_lyasePhnL phosphonate C-P lyase system protein PhnL Back     alignment and domain information
>PRK15056 manganese/iron transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13647 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13643 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11300 livG leucine/isoleucine/valine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>TIGR02323 CP_lyasePhnK phosphonate C-P lyase system protein PhnK Back     alignment and domain information
>PRK09536 btuD corrinoid ABC transporter ATPase; Reviewed Back     alignment and domain information
>PRK13650 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03271 ABC_UvrA_II The excision repair protein UvrA domain II; Nucleotide excision repair in eubacteria is a process that repairs DNA damage by the removal of a 12-13-mer oligonucleotide containing the lesion Back     alignment and domain information
>PRK14235 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03246 ABCC_Protease_Secretion This family represents the ABC component of the protease secretion system PrtD, a 60-kDa integral membrane protein sharing 37% identity with HlyB, the ABC component of the alpha-hemolysin secretion pathway, in the C-terminal domain Back     alignment and domain information
>PRK14268 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13649 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14237 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13652 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK11153 metN DL-methionine transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03249 ABC_MTABC3_MDL1_MDL2 MTABC3 (also known as ABCB6) is a mitochondrial ATP-binding cassette protein involved in iron homeostasis and one of four ABC transporters expressed in the mitochondrial inner membrane, the other three being MDL1(ABC7), MDL2, and ATM1 Back     alignment and domain information
>PRK15112 antimicrobial peptide ABC system ATP-binding protein SapF; Provisional Back     alignment and domain information
>PRK14247 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02769 nickel_nikE nickel import ATP-binding protein NikE Back     alignment and domain information
>COG1127 Ttg2A ABC-type transport system involved in resistance to organic solvents, ATPase component [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK10253 iron-enterobactin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14272 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK09984 phosphonate/organophosphate ester transporter subunit; Provisional Back     alignment and domain information
>cd03233 ABC_PDR_domain1 The pleiotropic drug resistance (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK13640 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14240 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1124 DppF ABC-type dipeptide/oligopeptide/nickel transport system, ATPase component [Amino acid transport and metabolism / Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK13635 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13633 cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13645 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14274 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10744 pstB phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14270 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14259 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14253 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03250 ABCC_MRP_domain1 Domain 1 of the ABC subfamily C Back     alignment and domain information
>PRK11000 maltose/maltodextrin transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK10619 histidine/lysine/arginine/ornithine transporter subunit; Provisional Back     alignment and domain information
>PRK14249 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02314 ABC_MetN D-methionine ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK14256 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13631 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14261 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13546 teichoic acids export protein ATP-binding subunit; Provisional Back     alignment and domain information
>PRK13648 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14242 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03254 ABCC_Glucan_exporter_like Glucan exporter ATP-binding protein Back     alignment and domain information
>PRK14262 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK13636 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd03244 ABCC_MRP_domain2 Domain 2 of the ABC subfamily C Back     alignment and domain information
>PRK14260 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14239 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14265 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>COG1122 CbiO ABC-type cobalt transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information
>cd03245 ABCC_bacteriocin_exporters ABC-type bacteriocin exporters Back     alignment and domain information
>PRK14251 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03248 ABCC_TAP TAP, the Transporter Associated with Antigen Processing; TAP is essential for peptide delivery from the cytosol into the lumen of the endoplasmic reticulum (ER), where these peptides are loaded on major histocompatibility complex (MHC) I molecules Back     alignment and domain information
>cd03232 ABC_PDR_domain2 The pleiotropic drug resistance-like (PDR) family of ATP-binding cassette (ABC) transporters Back     alignment and domain information
>PRK14271 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK14243 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>PRK11650 ugpC glycerol-3-phosphate transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14246 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03234 ABCG_White The White subfamily represents ABC transporters homologous to the Drosophila white gene, which acts as a dimeric importer for eye pigment precursors Back     alignment and domain information
>PRK10418 nikD nickel transporter ATP-binding protein NikD; Provisional Back     alignment and domain information
>TIGR03265 PhnT2 putative 2-aminoethylphosphonate ABC transporter, ATP-binding protein Back     alignment and domain information
>PRK11432 fbpC ferric transporter ATP-binding subunit; Provisional Back     alignment and domain information
>cd00267 ABC_ATPase ABC (ATP-binding cassette) transporter nucleotide-binding domain; ABC transporters are a large family of proteins involved in the transport of a wide variety of different compounds, like sugars, ions, peptides, and more complex organic molecules Back     alignment and domain information
>PRK13632 cbiO cobalt transporter ATP-binding subunit; Provisional Back     alignment and domain information
>PRK14248 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>cd03213 ABCG_EPDR ABCG transporters are involved in eye pigment (EP) precursor transport, regulation of lipid-trafficking mechanisms, and pleiotropic drug resistance (DR) Back     alignment and domain information
>PRK14238 phosphate transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR02982 heterocyst_DevA ABC exporter ATP-binding subunit, DevA family Back     alignment and domain information
>PRK14252 phosphate ABC transporter ATP-binding protein; Provisional Back     alignment and domain information
>TIGR03258 PhnT 2-aminoethylphosphonate ABC transport system, ATP-binding component PhnT Back     alignment and domain information
>COG4107 PhnK ABC-type phosphonate transport system, ATPase component [Inorganic ion transport and metabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query286
1vpl_A 256 Crystal Structure Of Abc Transporter Atp-binding Pr 3e-04
4dbl_C 249 Crystal Structure Of E159q Mutant Of Btucdf Length 3e-04
4fi3_C 249 Structure Of Vitamin B12 Transporter Btucd-F In A N 4e-04
4hlu_D 268 Structure Of The Ecfa-a' Heterodimer Bound To Adp L 8e-04
1z47_A 355 Structure Of The Atpase Subunit Cysa Of The Putativ 9e-04
>pdb|1VPL|A Chain A, Crystal Structure Of Abc Transporter Atp-binding Protein (tm0544) From Thermotoga Maritima At 2.10 A Resolution Length = 256 Back     alignment and structure

Iteration: 1

Score = 42.7 bits (99), Expect = 3e-04, Method: Compositional matrix adjust. Identities = 19/37 (51%), Positives = 28/37 (75%) Query: 242 KEILHGISGEFKAGQLTAIMGPSGAGKSTLLNILAGL 278 KEIL GIS E + G++ ++GP+GAGK+T L I++ L Sbjct: 28 KEILKGISFEIEEGEIFGLIGPNGAGKTTTLRIISTL 64
>pdb|4DBL|C Chain C, Crystal Structure Of E159q Mutant Of Btucdf Length = 249 Back     alignment and structure
>pdb|4FI3|C Chain C, Structure Of Vitamin B12 Transporter Btucd-F In A Nucleotide-Bound State Length = 249 Back     alignment and structure
>pdb|4HLU|D Chain D, Structure Of The Ecfa-a' Heterodimer Bound To Adp Length = 268 Back     alignment and structure
>pdb|1Z47|A Chain A, Structure Of The Atpase Subunit Cysa Of The Putative Sulfate Atp-Binding Cassette (Abc) Transporter From Alicyclobacillus Acidocaldarius Length = 355 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query286
2pcj_A 224 ABC transporter, lipoprotein-releasing system ATP- 1e-11
2qi9_C 249 Vitamin B12 import ATP-binding protein BTUD; inner 4e-11
2d2e_A 250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 5e-11
2zu0_C 267 Probable ATP-dependent transporter SUFC; iron-sulf 6e-11
3tif_A 235 Uncharacterized ABC transporter ATP-binding prote; 2e-10
2ihy_A 279 ABC transporter, ATP-binding protein; ATPase, ABC 5e-10
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 5e-10
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 5e-07
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 1e-09
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 1e-06
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 5e-09
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 3e-05
3nh6_A 306 ATP-binding cassette SUB-family B member 6, mitoc; 1e-08
2nq2_C 253 Hypothetical ABC transporter ATP-binding protein H 3e-08
1mv5_A 243 LMRA, multidrug resistance ABC transporter ATP-bin 4e-08
2ghi_A 260 Transport protein; multidrug resistance protein, M 4e-08
3b5x_A 582 Lipid A export ATP-binding/permease protein MSBA; 4e-08
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 4e-08
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 6e-06
3b60_A 582 Lipid A export ATP-binding/permease protein MSBA; 6e-08
3qf4_B 598 Uncharacterized ABC transporter ATP-binding prote 1e-07
4a82_A 578 Cystic fibrosis transmembrane conductance regulat; 1e-07
1ji0_A 240 ABC transporter; ATP binding protein, structural g 1e-07
2pjz_A 263 Hypothetical protein ST1066; ATP binding protein, 2e-07
1z47_A 355 CYSA, putative ABC-transporter ATP-binding protein 4e-07
2ff7_A 247 Alpha-hemolysin translocation ATP-binding protein 5e-07
2yz2_A 266 Putative ABC transporter ATP-binding protein TM_0; 7e-07
1b0u_A 262 Histidine permease; ABC transporter, transport pro 7e-07
3fvq_A 359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 1e-06
3gfo_A 275 Cobalt import ATP-binding protein CBIO 1; structur 1e-06
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 1e-06
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 5e-06
2it1_A 362 362AA long hypothetical maltose/maltodextrin trans 1e-06
3rlf_A 381 Maltose/maltodextrin import ATP-binding protein M; 1e-06
2yl4_A 595 ATP-binding cassette SUB-family B member 10, mitoc 1e-06
1oxx_K 353 GLCV, glucose, ABC transporter, ATP binding protei 2e-06
2yyz_A 359 Sugar ABC transporter, ATP-binding protein; sugar 2e-06
2ixe_A 271 Antigen peptide transporter 1; ABC ATPase, hydrola 2e-06
1g29_1 372 MALK, maltose transport protein MALK; ATPase, acti 2e-06
1v43_A 372 Sugar-binding transport ATP-binding protein; ATPas 5e-06
1g6h_A 257 High-affinity branched-chain amino acid transport 5e-06
2bbs_A 290 Cystic fibrosis transmembrane conductance regulato 6e-06
2olj_A 263 Amino acid ABC transporter; ABC domain, ATPase, hy 7e-06
2pze_A 229 Cystic fibrosis transmembrane conductance regulat; 8e-06
2cbz_A 237 Multidrug resistance-associated protein 1; ABC pro 1e-05
3qf4_A 587 ABC transporter, ATP-binding protein; multidrug tr 1e-05
1sgw_A 214 Putative ABC transporter; structural genomics, P p 2e-05
3gd7_A 390 Fusion complex of cystic fibrosis transmembrane co 3e-05
2rcn_A 358 Probable GTPase ENGC; YJEQ, circularly permuted, G 3e-05
2yv5_A 302 YJEQ protein; hydrolase, GTPase, permutation, stru 3e-05
3d31_A 348 Sulfate/molybdate ABC transporter, ATP-binding pro 3e-05
1u0l_A 301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 4e-05
1t9h_A 307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 4e-05
1vpl_A 256 ABC transporter, ATP-binding protein; TM0544, stru 6e-05
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 2e-04
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 4e-04
3tui_C 366 Methionine import ATP-binding protein METN; ABC-tr 2e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-04
2vf7_A 842 UVRA2, excinuclease ABC, subunit A.; DNA-binding p 4e-04
2onk_A 240 Molybdate/tungstate ABC transporter, ATP-binding p 4e-04
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Length = 224 Back     alignment and structure
 Score = 61.7 bits (151), Expect = 1e-11
 Identities = 21/36 (58%), Positives = 25/36 (69%)

Query: 243 EILHGISGEFKAGQLTAIMGPSGAGKSTLLNILAGL 278
           EIL GIS   K G+  +I+G SG+GKSTLL IL  L
Sbjct: 18  EILKGISLSVKKGEFVSIIGASGSGKSTLLYILGLL 53


>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Length = 249 Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Length = 250 Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Length = 267 Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Length = 235 Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Length = 279 Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Length = 607 Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Length = 607 Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; NMR {Saccharomyces cerevisiae} Length = 608 Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; NMR {Saccharomyces cerevisiae} Length = 608 Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Length = 538 Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Length = 538 Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Length = 306 Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Length = 253 Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Length = 243 Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Length = 260 Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Length = 582 Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Length = 538 Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Length = 538 Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Length = 582 Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Length = 598 Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Length = 578 Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Length = 240 Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Length = 263 Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Length = 355 Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Length = 247 Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Length = 266 Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Length = 262 Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron transport, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Length = 359 Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Length = 275 Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Length = 1284 Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Length = 1284 Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Length = 362 Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Length = 381 Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Length = 353 Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Length = 359 Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Length = 271 Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Length = 372 Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Length = 372 Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Length = 257 Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Length = 290 Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Length = 263 Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Length = 229 Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Length = 237 Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Length = 587 Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Length = 214 Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Length = 390 Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Length = 358 Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Length = 302 Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Length = 348 Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Length = 301 Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Length = 307 Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Length = 256 Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Length = 986 Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Length = 986 Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Length = 366 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* Length = 842 Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Length = 240 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query286
3g5u_A 1284 MCG1178, multidrug resistance protein 1A; P-glycop 99.95
3tui_C366 Methionine import ATP-binding protein METN; ABC-tr 99.95
3rlf_A381 Maltose/maltodextrin import ATP-binding protein M; 99.95
2iw3_A 986 Elongation factor 3A; acetylation, ATP-binding, pr 99.95
3gfo_A275 Cobalt import ATP-binding protein CBIO 1; structur 99.95
3fvq_A359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 99.95
3ux8_A 670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 99.94
1z47_A355 CYSA, putative ABC-transporter ATP-binding protein 99.94
2it1_A362 362AA long hypothetical maltose/maltodextrin trans 99.94
3bk7_A 607 ABC transporter ATP-binding protein; ABC ATPase, i 99.94
3tif_A235 Uncharacterized ABC transporter ATP-binding prote; 99.94
1v43_A372 Sugar-binding transport ATP-binding protein; ATPas 99.94
1g29_1372 MALK, maltose transport protein MALK; ATPase, acti 99.94
1oxx_K353 GLCV, glucose, ABC transporter, ATP binding protei 99.94
2yyz_A359 Sugar ABC transporter, ATP-binding protein; sugar 99.94
2olj_A263 Amino acid ABC transporter; ABC domain, ATPase, hy 99.94
1yqt_A 538 RNAse L inhibitor; ATP-binding cassette, ribosome 99.94
1b0u_A262 Histidine permease; ABC transporter, transport pro 99.93
1vpl_A256 ABC transporter, ATP-binding protein; TM0544, stru 99.93
3d31_A348 Sulfate/molybdate ABC transporter, ATP-binding pro 99.93
2pcj_A224 ABC transporter, lipoprotein-releasing system ATP- 99.93
3ozx_A 538 RNAse L inhibitor; ATP binding cassette protein, h 99.92
1ji0_A240 ABC transporter; ATP binding protein, structural g 99.92
2onk_A240 Molybdate/tungstate ABC transporter, ATP-binding p 99.92
4g1u_C266 Hemin import ATP-binding protein HMUV; membrane tr 99.92
1g6h_A257 High-affinity branched-chain amino acid transport 99.92
2qi9_C249 Vitamin B12 import ATP-binding protein BTUD; inner 99.91
2yz2_A266 Putative ABC transporter ATP-binding protein TM_0; 99.91
2r6f_A 972 Excinuclease ABC subunit A; UVRA, nucleotide excis 99.91
3j16_B 608 RLI1P; ribosome recycling, translation, eukarya, r 99.91
3nh6_A306 ATP-binding cassette SUB-family B member 6, mitoc; 99.9
2d2e_A250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 99.9
2ygr_A 993 Uvrabc system protein A; hydrolase, nucleotide exc 99.9
2ff7_A247 Alpha-hemolysin translocation ATP-binding protein 99.89
2ihy_A279 ABC transporter, ATP-binding protein; ATPase, ABC 99.89
2vf7_A 842 UVRA2, excinuclease ABC, subunit A.; DNA-binding p 99.89
1mv5_A243 LMRA, multidrug resistance ABC transporter ATP-bin 99.89
2zu0_C267 Probable ATP-dependent transporter SUFC; iron-sulf 99.88
2ixe_A271 Antigen peptide transporter 1; ABC ATPase, hydrola 99.88
2ghi_A260 Transport protein; multidrug resistance protein, M 99.88
3pih_A 916 Uvrabc system protein A; hydrolase, ABC ATPase, DN 99.88
3b5x_A582 Lipid A export ATP-binding/permease protein MSBA; 99.87
3gd7_A390 Fusion complex of cystic fibrosis transmembrane co 99.87
2yl4_A595 ATP-binding cassette SUB-family B member 10, mitoc 99.87
2nq2_C253 Hypothetical ABC transporter ATP-binding protein H 99.87
3qf4_B598 Uncharacterized ABC transporter ATP-binding prote 99.87
3b60_A582 Lipid A export ATP-binding/permease protein MSBA; 99.87
2pjz_A263 Hypothetical protein ST1066; ATP binding protein, 99.86
3qf4_A587 ABC transporter, ATP-binding protein; multidrug tr 99.86
4a82_A578 Cystic fibrosis transmembrane conductance regulat; 99.86
1sgw_A214 Putative ABC transporter; structural genomics, P p 99.86
4f4c_A1321 Multidrug resistance protein PGP-1; ABC transporte 99.83
2pze_A229 Cystic fibrosis transmembrane conductance regulat; 99.81
2cbz_A237 Multidrug resistance-associated protein 1; ABC pro 99.81
4f4c_A 1321 Multidrug resistance protein PGP-1; ABC transporte 99.79
3g5u_A1284 MCG1178, multidrug resistance protein 1A; P-glycop 99.79
2bbs_A290 Cystic fibrosis transmembrane conductance regulato 99.76
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 99.71
3bk7_A607 ABC transporter ATP-binding protein; ABC ATPase, i 99.67
1yqt_A538 RNAse L inhibitor; ATP-binding cassette, ribosome 99.67
3ozx_A538 RNAse L inhibitor; ATP binding cassette protein, h 99.64
3j16_B608 RLI1P; ribosome recycling, translation, eukarya, r 99.63
3ux8_A670 Excinuclease ABC, A subunit; UVRA, nucleotide exci 99.5
2pcj_A 224 ABC transporter, lipoprotein-releasing system ATP- 99.48
4g1u_C 266 Hemin import ATP-binding protein HMUV; membrane tr 99.48
1ji0_A 240 ABC transporter; ATP binding protein, structural g 99.47
1b0u_A 262 Histidine permease; ABC transporter, transport pro 99.47
3tif_A 235 Uncharacterized ABC transporter ATP-binding prote; 99.47
2olj_A 263 Amino acid ABC transporter; ABC domain, ATPase, hy 99.47
1g6h_A 257 High-affinity branched-chain amino acid transport 99.46
1vpl_A 256 ABC transporter, ATP-binding protein; TM0544, stru 99.46
3gfo_A 275 Cobalt import ATP-binding protein CBIO 1; structur 99.45
1sgw_A 214 Putative ABC transporter; structural genomics, P p 99.45
2ihy_A 279 ABC transporter, ATP-binding protein; ATPase, ABC 99.45
2ff7_A 247 Alpha-hemolysin translocation ATP-binding protein 99.44
2pze_A 229 Cystic fibrosis transmembrane conductance regulat; 99.44
2nq2_C 253 Hypothetical ABC transporter ATP-binding protein H 99.43
3fvq_A 359 Fe(3+) IONS import ATP-binding protein FBPC; nucle 99.42
2ixe_A 271 Antigen peptide transporter 1; ABC ATPase, hydrola 99.42
2cbz_A 237 Multidrug resistance-associated protein 1; ABC pro 99.42
3rlf_A 381 Maltose/maltodextrin import ATP-binding protein M; 99.41
2d2e_A 250 SUFC protein; ABC-ATPase, SUF protein, 310-helix, 99.41
2yz2_A 266 Putative ABC transporter ATP-binding protein TM_0; 99.4
3tui_C 366 Methionine import ATP-binding protein METN; ABC-tr 99.39
1z47_A 355 CYSA, putative ABC-transporter ATP-binding protein 99.39
2yyz_A 359 Sugar ABC transporter, ATP-binding protein; sugar 99.38
2zu0_C 267 Probable ATP-dependent transporter SUFC; iron-sulf 99.38
2it1_A 362 362AA long hypothetical maltose/maltodextrin trans 99.38
1g29_1 372 MALK, maltose transport protein MALK; ATPase, acti 99.37
1v43_A 372 Sugar-binding transport ATP-binding protein; ATPas 99.37
2ghi_A 260 Transport protein; multidrug resistance protein, M 99.36
2r6f_A972 Excinuclease ABC subunit A; UVRA, nucleotide excis 99.36
1oxx_K 353 GLCV, glucose, ABC transporter, ATP binding protei 99.36
2iw3_A986 Elongation factor 3A; acetylation, ATP-binding, pr 99.35
2bbs_A 290 Cystic fibrosis transmembrane conductance regulato 99.35
3nh6_A 306 ATP-binding cassette SUB-family B member 6, mitoc; 99.35
3pih_A916 Uvrabc system protein A; hydrolase, ABC ATPase, DN 99.32
2vf7_A842 UVRA2, excinuclease ABC, subunit A.; DNA-binding p 99.32
2pjz_A 263 Hypothetical protein ST1066; ATP binding protein, 99.31
3gd7_A 390 Fusion complex of cystic fibrosis transmembrane co 99.28
2ygr_A993 Uvrabc system protein A; hydrolase, nucleotide exc 99.28
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 99.28
2dpy_A438 FLII, flagellum-specific ATP synthase; beta barrel 99.26
3sop_A270 Neuronal-specific septin-3; hydrolase; HET: GDP; 2 99.21
4aby_A415 DNA repair protein RECN; hydrolase, double strand 99.2
2npi_A460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 99.18
3b60_A 582 Lipid A export ATP-binding/permease protein MSBA; 99.15
3b5x_A 582 Lipid A export ATP-binding/permease protein MSBA; 99.15
2yl4_A 595 ATP-binding cassette SUB-family B member 10, mitoc 99.14
4a82_A 578 Cystic fibrosis transmembrane conductance regulat; 99.12
3qf4_B 598 Uncharacterized ABC transporter ATP-binding prote 99.11
3qf4_A 587 ABC transporter, ATP-binding protein; multidrug tr 99.1
2v9p_A 305 Replication protein E1; AAA+ molecular motor, DNA 99.06
3euj_A 483 Chromosome partition protein MUKB, linker; MUKB, M 99.01
1tq4_A 413 IIGP1, interferon-inducible GTPase; interferon gam 98.93
1znw_A207 Guanylate kinase, GMP kinase; ATP:GMP-phosphotrans 98.92
2obl_A 347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 98.9
2gza_A 361 Type IV secretion system protein VIRB11; ATPase, h 98.87
2pt7_A 330 CAG-ALFA; ATPase, protein-protein complex, type IV 98.86
2npi_A 460 Protein CLP1; CLP1-PCF11 complex, ATP binding, ter 98.86
2qag_B 427 Septin-6, protein NEDD5; cell cycle, cell division 98.86
3b9q_A 302 Chloroplast SRP receptor homolog, alpha subunit CP 98.85
2dpy_A 438 FLII, flagellum-specific ATP synthase; beta barrel 98.81
3qf7_A365 RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1. 98.8
2obl_A347 ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O 98.79
3aez_A 312 Pantothenate kinase; transferase, homodimer, COA b 98.79
3szr_A 608 Interferon-induced GTP-binding protein MX1; interf 98.78
2og2_A 359 Putative signal recognition particle receptor; nuc 98.77
2yhs_A 503 FTSY, cell division protein FTSY; cell cycle, prot 98.77
1tf7_A 525 KAIC; homohexamer, hexamer, circadian clock protei 98.76
2qm8_A 337 GTPase/ATPase; G protein, G3E, metallochaperone, c 98.74
1tq4_A413 IIGP1, interferon-inducible GTPase; interferon gam 98.71
1lw7_A 365 Transcriptional regulator NADR; NMN, NMN adenylyl 98.71
1sq5_A 308 Pantothenate kinase; P-loop, transferase; HET: PAU 98.71
1cr0_A 296 DNA primase/helicase; RECA-type protein fold, tran 98.7
2ehv_A 251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 98.68
4aby_A 415 DNA repair protein RECN; hydrolase, double strand 98.66
1e69_A322 Chromosome segregation SMC protein; structural mai 98.65
1f2t_B148 RAD50 ABC-ATPase; DNA double-strand break repair, 98.61
2oap_1 511 GSPE-2, type II secretion system protein; hexameri 98.59
3thx_B 918 DNA mismatch repair protein MSH3; ABC family ATPas 98.59
1wb9_A 800 DNA mismatch repair protein MUTS; DNA-binding, ATP 98.58
1ls1_A 295 Signal recognition particle protein; FFH, SRP54, S 98.57
1rj9_A 304 FTSY, signal recognition protein; SRP-GTPase domai 98.54
1ewq_A 765 DNA mismatch repair protein MUTS; multiple domains 98.52
3nwj_A 250 ATSK2; P loop, shikimate, nucleoside monophosphate 98.52
3thx_A 934 DNA mismatch repair protein MSH2; ABC family ATPas 98.5
2x8a_A 274 Nuclear valosin-containing protein-like; nuclear p 98.49
2o8b_B 1022 DNA mismatch repair protein MSH6; DNA damage respo 98.48
3e70_C 328 DPA, signal recognition particle receptor; FTSY, S 98.48
1p9r_A 418 General secretion pathway protein E; bacterial typ 98.47
4eun_A 200 Thermoresistant glucokinase; putative sugar kinase 98.46
2ewv_A 372 Twitching motility protein PILT; pilus retraction 98.45
1u0l_A 301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 98.43
3b85_A208 Phosphate starvation-inducible protein; PHOH2, ATP 98.43
2v9p_A305 Replication protein E1; AAA+ molecular motor, DNA 98.42
2qag_C 418 Septin-7; cell cycle, cell division, GTP-binding, 98.39
1t9h_A 307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 98.38
1svm_A 377 Large T antigen; AAA+ fold, viral protein; HET: AT 98.38
2rcn_A 358 Probable GTPase ENGC; YJEQ, circularly permuted, G 98.37
3jvv_A 356 Twitching mobility protein; hexameric P-loop ATPas 98.35
3ec2_A 180 DNA replication protein DNAC; helicase loader, rep 98.35
1udx_A 416 The GTP-binding protein OBG; TGS domain, riken str 98.33
3tqc_A 321 Pantothenate kinase; biosynthesis of cofactors, pr 98.29
1s96_A219 Guanylate kinase, GMP kinase; E.coli, dimer, SAD, 98.28
1ixz_A 254 ATP-dependent metalloprotease FTSH; AAA domain fol 98.27
1iy2_A 278 ATP-dependent metalloprotease FTSH; AAA domain fol 98.26
2kjq_A149 DNAA-related protein; solution structure, NESG, st 98.24
4gp7_A171 Metallophosphoesterase; polynucleotide kinase phos 98.23
1f2t_A149 RAD50 ABC-ATPase; DNA double-strand break repair, 98.23
2yv5_A 302 YJEQ protein; hydrolase, GTPase, permutation, stru 98.23
2bdt_A189 BH3686; alpha-beta protein, structural genomics, P 98.23
1ye8_A178 Protein THEP1, hypothetical UPF0334 kinase-like pr 98.22
2pt7_A330 CAG-ALFA; ATPase, protein-protein complex, type IV 98.2
1nlf_A 279 Regulatory protein REPA; replicative DNA helicase 98.19
1pzn_A 349 RAD51, DNA repair and recombination protein RAD51, 98.19
1pzn_A349 RAD51, DNA repair and recombination protein RAD51, 98.16
1in4_A 334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 98.16
2ehv_A251 Hypothetical protein PH0186; KAIC, RECA ATPase, un 98.16
1zu4_A 320 FTSY; GTPase, signal recognition particle, SRP, re 98.15
3szr_A 608 Interferon-induced GTP-binding protein MX1; interf 98.11
1vma_A 306 Cell division protein FTSY; TM0570, structural gen 98.1
3qkt_A339 DNA double-strand break repair RAD50 ATPase; RECA- 98.09
3cr8_A 552 Sulfate adenylyltranferase, adenylylsulfate kinase 98.08
3b9q_A302 Chloroplast SRP receptor homolog, alpha subunit CP 98.06
4ad8_A517 DNA repair protein RECN; DNA binding protein, ATPa 98.06
2qnr_A301 Septin-2, protein NEDD5; structural genomics conso 98.05
2o5v_A359 DNA replication and repair protein RECF; ABC ATPas 98.03
4a74_A231 DNA repair and recombination protein RADA; hydrola 97.98
4ad8_A 517 DNA repair protein RECN; DNA binding protein, ATPa 97.96
1oix_A 191 RAS-related protein RAB-11A; small G protein, intr 97.93
2px0_A 296 Flagellar biosynthesis protein FLHF; SRP GTPase, f 97.93
3kta_B173 Chromosome segregation protein SMC; structural mai 97.91
3k1j_A 604 LON protease, ATP-dependent protease LON; ATP-bind 97.91
2p67_A 341 LAO/AO transport system kinase; ARGK, structural G 97.85
3lda_A 400 DNA repair protein RAD51; DNA binding protein, ATP 97.84
1z6g_A218 Guanylate kinase; structural genomics, SGC, struct 97.84
3m6a_A 543 ATP-dependent protease LA 1; alpha, beta, ATP-bind 97.83
1odf_A 290 YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser 97.78
2gza_A361 Type IV secretion system protein VIRB11; ATPase, h 97.78
2og2_A359 Putative signal recognition particle receptor; nuc 97.77
2dhr_A 499 FTSH; AAA+ protein, hexameric Zn metalloprotease, 97.7
1rj9_A304 FTSY, signal recognition protein; SRP-GTPase domai 97.61
2ffh_A 425 Protein (FFH); SRP54, signal recognition particle, 97.58
2www_A 349 Methylmalonic aciduria type A protein, mitochondri 97.57
1lv7_A 257 FTSH; alpha/beta domain, four helix bundle, hydrol 97.52
3hr8_A 356 Protein RECA; alpha and beta proteins (A/B, A+B), 97.52
3t34_A 360 Dynamin-related protein 1A, linker, dynamin-relat 97.51
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 97.5
1j8m_F 297 SRP54, signal recognition 54 kDa protein; signalin 97.48
2eyu_A261 Twitching motility protein PILT; pilus retraction 97.47
3ice_A 422 Transcription termination factor RHO; transcriptio 97.46
1sxj_C 340 Activator 1 40 kDa subunit; clamp loader, processi 97.44
2zr9_A 349 Protein RECA, recombinase A; recombination, RECA m 97.4
3aez_A312 Pantothenate kinase; transferase, homodimer, COA b 97.39
1w1w_A430 Structural maintenance of chromosome 1; cohesin, c 97.38
3e70_C328 DPA, signal recognition particle receptor; FTSY, S 97.35
1sxj_E 354 Activator 1 40 kDa subunit; clamp loader, processi 97.34
2p5t_B 253 PEZT; postsegregational killing system, phosphoryl 97.33
3jvv_A356 Twitching mobility protein; hexameric P-loop ATPas 97.33
1u0l_A301 Probable GTPase ENGC; permutation, OB-fold, zinc-f 97.3
3asz_A211 Uridine kinase; cytidine phosphorylation, transfer 97.25
2r6a_A 454 DNAB helicase, replicative helicase; replication, 97.19
3cf0_A 301 Transitional endoplasmic reticulum ATPase; AAA, P9 97.18
3auy_A371 DNA double-strand break repair RAD50 ATPase; DNA r 97.12
1mky_A 439 Probable GTP-binding protein ENGA; GTPase, DER, KH 97.11
1htw_A158 HI0065; nucleotide-binding fold, structural genomi 97.1
2rcn_A358 Probable GTPase ENGC; YJEQ, circularly permuted, G 97.09
2qtf_A 364 Protein HFLX, GTP-binding protein; beta-alpha-barr 97.07
1ni3_A392 YCHF GTPase, YCHF GTP-binding protein; structural 97.07
1gvn_B 287 Zeta; postsegregational killing system, plasmid; 1 97.07
3lxx_A 239 GTPase IMAP family member 4; structural genomics c 97.06
2qag_A 361 Septin-2, protein NEDD5; cell cycle, cell division 97.06
2ce7_A 476 Cell division protein FTSH; metalloprotease; HET: 97.0
2yv5_A302 YJEQ protein; hydrolase, GTPase, permutation, stru 96.99
2ius_A 512 DNA translocase FTSK; nucleotide-binding, chromoso 96.99
2jeo_A245 Uridine-cytidine kinase 1; UCK, transferase, ATP-b 96.96
1v5w_A 343 DMC1, meiotic recombination protein DMC1/LIM15 hom 96.95
1nij_A318 Hypothetical protein YJIA; structural genomics, P- 96.93
3llm_A 235 ATP-dependent RNA helicase A; alpha-beta-alpha, st 96.92
3kl4_A 433 SRP54, signal recognition 54 kDa protein; signal r 96.9
1ypw_A 806 Transitional endoplasmic reticulum ATPase; AAA, P9 96.88
2i3b_A189 HCR-ntpase, human cancer-related ntpase; AAA, ross 96.87
2z43_A 324 DNA repair and recombination protein RADA; archaea 96.85
4ag6_A 392 VIRB4 ATPase, type IV secretory pathway VIRB4 comp 96.76
2ged_A 193 SR-beta, signal recognition particle receptor beta 96.7
3bos_A 242 Putative DNA replication factor; P-loop containing 96.69
3b9p_A 297 CG5977-PA, isoform A; AAA ATPase, ATP-binding, nuc 96.67
1wb9_A800 DNA mismatch repair protein MUTS; DNA-binding, ATP 96.66
2qby_A 386 CDC6 homolog 1, cell division control protein 6 ho 96.64
2qmh_A 205 HPR kinase/phosphorylase; V267F mutation, ATP-bind 96.63
1ko7_A 314 HPR kinase/phosphatase; protein kinase, phosphotra 96.63
1fnn_A 389 CDC6P, cell division control protein 6; ORC1, AAA 96.61
4fcw_A 311 Chaperone protein CLPB; AAA domain; HET: ADP; 2.35 96.61
2e87_A 357 Hypothetical protein PH1320; GTP-binding, GTPase, 96.6
2i1q_A 322 DNA repair and recombination protein RADA; ATPase, 96.56
2w58_A 202 DNAI, primosome component (helicase loader); ATP-b 96.55
1t9h_A307 YLOQ, probable GTPase ENGC; N-terminal beta-barrel 96.53
3thx_A934 DNA mismatch repair protein MSH2; ABC family ATPas 96.52
1u94_A 356 RECA protein, recombinase A; homologous recombinat 96.51
3a8t_A 339 Adenylate isopentenyltransferase; rossmann fold pr 96.49
2f6r_A 281 COA synthase, bifunctional coenzyme A synthase; 18 96.48
3bh0_A 315 DNAB-like replicative helicase; ATPase, replicatio 96.45
2yhs_A503 FTSY, cell division protein FTSY; cell cycle, prot 96.42
2zts_A 251 Putative uncharacterized protein PH0186; KAIC like 96.38
4a1f_A 338 DNAB helicase, replicative DNA helicase; hydrolase 96.34
1jbk_A 195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 96.34
1n0w_A243 DNA repair protein RAD51 homolog 1; DNA repair, ho 96.31
3tlx_A 243 Adenylate kinase 2; structural genomics, structura 96.31
3h4m_A 285 Proteasome-activating nucleotidase; ATPase, PAN, A 96.29
3zvl_A 416 Bifunctional polynucleotide phosphatase/kinase; hy 96.27
2wsm_A 221 Hydrogenase expression/formation protein (HYPB); m 96.25
3lda_A400 DNA repair protein RAD51; DNA binding protein, ATP 96.2
3n70_A145 Transport activator; sigma-54, ntpase, PSI, MCSG, 96.18
1l8q_A 324 Chromosomal replication initiator protein DNAA; AA 96.15
1njg_A 250 DNA polymerase III subunit gamma; rossman-like fol 96.11
3umf_A 217 Adenylate kinase; rossmann fold, transferase; 2.05 96.1
2p65_A 187 Hypothetical protein PF08_0063; CLPB, malaria, str 96.09
2v3c_C 432 SRP54, signal recognition 54 kDa protein; nucleoti 96.05
2ewv_A372 Twitching motility protein PILT; pilus retraction 96.04
2bbw_A246 Adenylate kinase 4, AK4; nucleotide kinase, nucleo 96.03
4dhe_A 223 Probable GTP-binding protein ENGB; melioidosis, RA 96.03
1sxj_D 353 Activator 1 41 kDa subunit; clamp loader, processi 96.03
2q6t_A 444 DNAB replication FORK helicase; hydrolase; 2.90A { 96.01
2j1l_A 214 RHO-related GTP-binding protein RHOD; GTPase, memb 95.98
2g3y_A 211 GTP-binding protein GEM; small GTPase, GDP, inacti 95.97
2qu8_A 228 Putative nucleolar GTP-binding protein 1; GTPase, 95.97
1sky_E 473 F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alp 95.95
2hf9_A 226 Probable hydrogenase nickel incorporation protein 95.9
2z4s_A 440 Chromosomal replication initiator protein DNAA; AA 95.9
2b6h_A 192 ADP-ribosylation factor 5; membrane trafficking, G 95.85
1xp8_A 366 RECA protein, recombinase A; recombination, radior 95.85
2qz4_A 262 Paraplegin; AAA+, SPG7, protease, ADP, structural 95.84
3dm5_A 443 SRP54, signal recognition 54 kDa protein; protein- 95.82
3def_A 262 T7I23.11 protein; chloroplast, TOC33, GTPase, hydr 95.8
3cnl_A 262 YLQF, putative uncharacterized protein; circular p 95.8
2r62_A 268 Cell division protease FTSH homolog; ATPase domain 95.79
1h65_A 270 Chloroplast outer envelope protein OEP34; GTPase, 95.75
2hup_A 201 RAS-related protein RAB-43; G-protein, GDP, struct 95.67
1g41_A 444 Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dep 95.61
4gzl_A 204 RAS-related C3 botulinum toxin substrate 1; rossma 95.61
2vhj_A 331 Ntpase P4, P4; non- hydrolysable ATP analogue, hyd 95.59
3hws_A 363 ATP-dependent CLP protease ATP-binding subunit CL; 95.55
2qag_C418 Septin-7; cell cycle, cell division, GTP-binding, 95.55
1ewq_A765 DNA mismatch repair protein MUTS; multiple domains 95.44
2xau_A 773 PRE-mRNA-splicing factor ATP-dependent RNA helica; 95.43
3p32_A 355 Probable GTPase RV1496/MT1543; structural genomics 95.42
1cr0_A296 DNA primase/helicase; RECA-type protein fold, tran 95.42
3syl_A 309 Protein CBBX; photosynthesis, rubisco activase, AA 95.4
2w0m_A235 SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus 95.33
2chg_A 226 Replication factor C small subunit; DNA-binding pr 95.31
2v1u_A 387 Cell division control protein 6 homolog; DNA repli 95.22
3co5_A143 Putative two-component system transcriptional RES 95.19
3d8b_A 357 Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, s 95.18
1sxj_E354 Activator 1 40 kDa subunit; clamp loader, processi 95.15
3bgw_A 444 DNAB-like replicative helicase; ATPase, replicatio 95.14
1knx_A 312 Probable HPR(Ser) kinase/phosphatase; HPR kinase, 95.13
1xwi_A 322 SKD1 protein; VPS4B, AAA ATPase, protein transport 95.11
1d2n_A 272 N-ethylmaleimide-sensitive fusion protein; hexamer 95.06
3t15_A 293 Ribulose bisphosphate carboxylase/oxygenase activ 95.02
2r44_A 331 Uncharacterized protein; putative ATPase, structur 95.01
2j37_W 504 Signal recognition particle 54 kDa protein (SRP54) 95.0
2qgz_A 308 Helicase loader, putative primosome component; str 95.0
1ofh_A 310 ATP-dependent HSL protease ATP-binding subunit HSL 94.99
3pvs_A 447 Replication-associated recombination protein A; ma 94.98
1g8f_A511 Sulfate adenylyltransferase; alpha-beta protein, b 94.94
1x6v_B 630 Bifunctional 3'-phosphoadenosine 5'- phosphosulfat 94.91
3eie_A 322 Vacuolar protein sorting-associated protein 4; AAA 94.91
3pfi_A 338 Holliday junction ATP-dependent DNA helicase RUVB; 94.89
3uk6_A 368 RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding 94.88
1um8_A 376 ATP-dependent CLP protease ATP-binding subunit CL; 94.86
2qpt_A 550 EH domain-containing protein-2; protein-nucleotide 94.81
3th5_A 204 RAS-related C3 botulinum toxin substrate 1; rossma 93.81
2qby_B 384 CDC6 homolog 3, cell division control protein 6 ho 94.78
1zcb_A 362 G alpha I/13; GTP-binding, lipoprotein, membrane, 94.76
1puj_A 282 YLQF, conserved hypothetical protein YLQF; structu 94.73
1m8p_A 573 Sulfate adenylyltransferase; rossmann fold, phosph 94.73
2qen_A 350 Walker-type ATPase; unknown function; HET: ADP; 2. 94.7
3geh_A 462 MNME, tRNA modification GTPase MNME; G protein, U3 94.69
1q57_A 503 DNA primase/helicase; dntpase, DNA replication, tr 94.68
2bjv_A 265 PSP operon transcriptional activator; AAA, transcr 94.65
2oap_1511 GSPE-2, type II secretion system protein; hexameri 94.64
1tue_A 212 Replication protein E1; helicase, replication, E1E 94.59
2qag_B427 Septin-6, protein NEDD5; cell cycle, cell division 94.53
2axn_A 520 6-phosphofructo-2-kinase/fructose-2,6- biphosphata 94.53
2qp9_X 355 Vacuolar protein sorting-associated protein 4; ATP 94.5
3l0i_B 199 RAS-related protein RAB-1A; GEF-GDF-RAB complex, G 94.49
2x2e_A 353 Dynamin-1; nitration, hydrolase, membrane fission, 94.46
1lnz_A 342 SPO0B-associated GTP-binding protein; GTPase, OBG, 94.44
2xxa_A 433 Signal recognition particle protein; protein trans 94.34
1bif_A 469 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; 94.28
2iut_A 574 DNA translocase FTSK; nucleotide-binding, chromoso 94.27
2gks_A 546 Bifunctional SAT/APS kinase; transferase, sulfuryl 94.26
3ec1_A 369 YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase 94.25
2o8b_B1022 DNA mismatch repair protein MSH6; DNA damage respo 94.19
4b4t_K 428 26S protease regulatory subunit 6B homolog; hydrol 94.15
3nbx_X 500 ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structu 94.14
3pxg_A 468 Negative regulator of genetic competence CLPC/MEC; 94.1
1hqc_A 324 RUVB; extended AAA-ATPase domain, complex with nuc 94.08
1in4_A334 RUVB, holliday junction DNA helicase RUVB; AAA+-cl 94.06
3vfd_A 389 Spastin; ATPase, microtubule severing, hydrolase; 94.06
4b4t_J 405 26S protease regulatory subunit 8 homolog; hydrola 94.05
2zan_A 444 Vacuolar protein sorting-associating protein 4B; S 94.0
2hjg_A 436 GTP-binding protein ENGA; GTPase ENGA KH-domain, h 93.99
3l0o_A 427 Transcription termination factor RHO; helicase, RH 93.95
3h2y_A 368 GTPase family protein; GTP-binding protein YQEH, p 93.94
4b4t_L 437 26S protease subunit RPT4; hydrolase, AAA-atpases, 93.93
1p9r_A418 General secretion pathway protein E; bacterial typ 93.92
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 93.88
2j69_A 695 Bacterial dynamin-like protein; FZO, FZL, GTPase, 93.86
3o47_A 329 ADP-ribosylation factor GTPase-activating protein 93.85
4b4t_M 434 26S protease regulatory subunit 6A; hydrolase, AAA 93.85
3dpu_A 535 RAB family protein; roccor, G-domain, COR, GTP-bin 93.82
1f5n_A 592 Interferon-induced guanylate-binding protein 1; GB 93.82
3gee_A 476 MNME, tRNA modification GTPase MNME; G protein, cy 93.81
1jr3_A 373 DNA polymerase III subunit gamma; processivity, pr 93.79
2fna_A 357 Conserved hypothetical protein; structural genomic 93.67
1w5s_A 412 Origin recognition complex subunit 2 ORC2; replica 93.65
3hu3_A 489 Transitional endoplasmic reticulum ATPase; VCP, tr 93.62
1zp6_A191 Hypothetical protein ATU3015; alpha-beta protein., 93.61
1sxj_A 516 Activator 1 95 kDa subunit; clamp loader, processi 93.52
2c9o_A 456 RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP- 93.49
1iqp_A 327 RFCS; clamp loader, extended AAA-ATPase domain, co 93.46
2wkq_A 332 NPH1-1, RAS-related C3 botulinum toxin substrate 1 93.38
4b4t_I 437 26S protease regulatory subunit 4 homolog; hydrola 93.36
3e1s_A 574 Exodeoxyribonuclease V, subunit RECD; alpha and be 93.32
3q5d_A 447 Atlastin-1; G protein, GTPase, GDP/GTP binding, hy 93.28
4b4t_H 467 26S protease regulatory subunit 7 homolog; hydrola 93.25
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 93.19
2a5y_B 549 CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis 93.09
1g8p_A 350 Magnesium-chelatase 38 kDa subunit; parallel beta 93.07
2chq_A 319 Replication factor C small subunit; DNA-binding pr 92.86
1sxj_B 323 Activator 1 37 kDa subunit; clamp loader, processi 92.82
1sq5_A308 Pantothenate kinase; P-loop, transferase; HET: PAU 92.82
1z6t_A 591 APAF-1, apoptotic protease activating factor 1; ca 92.8
1e9r_A 437 Conjugal transfer protein TRWB; coupling protein, 92.76
1of1_A 376 Thymidine kinase; transferase, antiviral drug, enz 92.73
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 92.58
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 92.51
4a9a_A 376 Ribosome-interacting GTPase 1; DRG-DFRP complex, r 92.48
2ck3_D 482 ATP synthase subunit beta\, mitochondrial; hydrola 92.47
2x8a_A274 Nuclear valosin-containing protein-like; nuclear p 92.35
1xzp_A 482 Probable tRNA modification GTPase TRME; GTP-bindin 92.33
3cmw_A 1706 Protein RECA, recombinase A; homologous recombinat 92.27
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 92.11
3lvq_E 497 ARF-GAP with SH3 domain, ANK repeat and PH domain 92.08
3izq_1 611 HBS1P, elongation factor 1 alpha-like protein; NO- 92.04
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 92.01
3thx_B918 DNA mismatch repair protein MSH3; ABC family ATPas 91.92
4dcu_A 456 GTP-binding protein ENGA; GTPase, GDP, protein bin 91.75
1j3b_A 529 ATP-dependent phosphoenolpyruvate carboxykinase; a 91.71
3tr0_A205 Guanylate kinase, GMP kinase; purines, pyrimidines 91.71
3upu_A 459 ATP-dependent DNA helicase DDA; RECA-like domain, 91.55
3cmu_A 2050 Protein RECA, recombinase A; homologous recombinat 91.55
1ii2_A 524 Phosphoenolpyruvate carboxykinase; phosphate bindi 91.47
2olr_A 540 Phosphoenolpyruvate carboxykinase; carbon dioxide, 91.45
3te6_A 318 Regulatory protein SIR3; heterochromatin, gene sil 91.22
2cvh_A220 DNA repair and recombination protein RADB; filamen 91.21
1qvr_A 854 CLPB protein; coiled coil, AAA ATPase, chaperone; 91.06
3f9v_A 595 Minichromosome maintenance protein MCM; replicativ 91.04
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 90.91
1ytm_A 532 Phosphoenolpyruvate carboxykinase [ATP], phosphoen 90.85
3p26_A 483 Elongation factor 1 alpha-like protein; GTP/GDP bi 90.69
2c61_A 469 A-type ATP synthase non-catalytic subunit B; hydro 90.53
3end_A 307 Light-independent protochlorophyllide reductase ir 90.51
3gqb_A 578 V-type ATP synthase alpha chain; A3B3, V-ATPase, A 90.42
3u61_B 324 DNA polymerase accessory protein 44; AAA+, ATP hyd 90.37
3vr4_A 600 V-type sodium ATPase catalytic subunit A; V-ATPase 90.27
1fx0_B 498 ATP synthase beta chain; latent ATPase, thermal st 90.22
1qhl_A227 Protein (cell division protein MUKB); SMC, chromos 90.06
3pxi_A 758 Negative regulator of genetic competence CLPC/MEC; 90.01
3qq5_A 423 Small GTP-binding protein; hydrogenase, H-cluster, 89.98
1w36_D 608 RECD, exodeoxyribonuclease V alpha chain; recombin 89.87
3mfy_A 588 V-type ATP synthase alpha chain; A-type ATP syntha 89.78
1r6b_X 758 CLPA protein; AAA+, N-terminal domain, CLPS, cryst 89.61
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 89.2
3mca_A 592 HBS1, elongation factor 1 alpha-like protein; prot 89.18
1iy2_A278 ATP-dependent metalloprotease FTSH; AAA domain fol 89.09
4ido_A 457 Atlastin-1; GTPase, GTP/GDP binding, hydrolase; HE 89.02
2f1r_A171 Molybdopterin-guanine dinucleotide biosynthesis pr 89.0
1udx_A416 The GTP-binding protein OBG; TGS domain, riken str 88.98
3vr4_D 465 V-type sodium ATPase subunit D; V-ATPase, rotary m 88.61
3gqb_B 464 V-type ATP synthase beta chain; A3B3, V-ATPase, AT 88.51
1u0j_A 267 DNA replication protein; AAA+ protein, P-loop atpa 88.49
2r9v_A 515 ATP synthase subunit alpha; TM1612, structural gen 88.4
3zvr_A 772 Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mito 88.07
3cf2_A 806 TER ATPase, transitional endoplasmic reticulum ATP 87.94
2qm8_A337 GTPase/ATPase; G protein, G3E, metallochaperone, c 87.87
1r5b_A 467 Eukaryotic peptide chain release factor GTP-bindi 86.99
2qe7_A 502 ATP synthase subunit alpha; blockage of ATP hydrol 86.77
3vkw_A 446 Replicase large subunit; alpha/beta domain, helica 86.4
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 86.03
2ck3_A 510 ATP synthase subunit alpha\, mitochondrial; hydrol 85.97
1fx0_A 507 ATP synthase alpha chain; latent ATPase, thermal s 85.74
1ixz_A254 ATP-dependent metalloprotease FTSH; AAA domain fol 85.67
1cip_A 353 Protein (guanine nucleotide-binding protein alpha- 85.64
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 85.49
3fwy_A 314 Light-independent protochlorophyllide reductase I 85.45
3vqt_A 548 RF-3, peptide chain release factor 3; translation, 84.71
3oaa_A 513 ATP synthase subunit alpha; rossmann fold, hydrola 84.3
3avx_A 1289 Elongation factor TS, elongation factor TU, linke 83.87
4eun_A200 Thermoresistant glucokinase; putative sugar kinase 83.23
4akg_A 2695 Glutathione S-transferase class-MU 26 kDa isozyme 83.13
3fkq_A 373 NTRC-like two-domain protein; RER070207001320, str 83.05
2oze_A 298 ORF delta'; para, walker type atpases, DNA segrega 82.67
1lkx_A 697 Myosin IE heavy chain; myosin motor domain, lever 81.41
2gk6_A 624 Regulator of nonsense transcripts 1; UPF1, helicas 80.82
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 80.72
1azs_C 402 GS-alpha; complex (lyase/hydrolase), hydrolase, si 80.24
2kjq_A149 DNAA-related protein; solution structure, NESG, st 80.02
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
Probab=99.95  E-value=1.9e-28  Score=248.93  Aligned_cols=145  Identities=19%  Similarity=0.281  Sum_probs=120.5

Q ss_pred             Cchhhhh-cCCCCCCceeEEEECCeecCchhhhcccceeeEEecCcccCCCCCHHHHHHHHHhcCCCCCCCHHHHHHHHh
Q psy8953           1 MSIELNV-QSIRLTGSSGKILVNGQERKSACIEQFLKLSCYIQQDDALRPKLTVTEAMMIASHLKLGFKVSTQEKKDQVS   79 (286)
Q Consensus         1 ~stll~~-~g~~~~~~~G~i~~~g~~~~~~~~~~~~~~~g~v~Q~~~~~~~~tV~e~l~f~~~~~~~~~~~~~~~~~~v~   79 (286)
                      ||||+++ +|..+. .+|+|++||+++...+...+++.+|||+|+|.+|.. ||+|+|.|+.+     ..+.+++.+.++
T Consensus       429 KSTl~~ll~g~~~~-~~G~i~i~g~~i~~~~~~~~r~~i~~v~Q~~~l~~~-ti~eNi~~g~~-----~~~~~~~~~~~~  501 (1284)
T 3g5u_A          429 KSTTVQLMQRLYDP-LDGMVSIDGQDIRTINVRYLREIIGVVSQEPVLFAT-TIAENIRYGRE-----DVTMDEIEKAVK  501 (1284)
T ss_dssp             HHHHHHHTTTSSCC-SEEEEEETTEEGGGSCHHHHHHHEEEECSSCCCCSS-CHHHHHHHHCS-----SCCHHHHHHHHH
T ss_pred             HHHHHHHHhCCCCC-CCeEEEECCEEHHhCCHHHHHhheEEEcCCCccCCc-cHHHHHhcCCC-----CCCHHHHHHHHH
Confidence            8999999 996544 799999999999877777888899999999988865 99999999864     234566554433


Q ss_pred             -------hh-h-----------hhcccCCccc-------------------cCCCcchHHHHHHHHHHHHHHhCCCEEEE
Q psy8953          80 -------LE-L-----------WNNFCKKKKK-------------------KKRGLDSSSCSQCVSLLANLAKQGRTVVA  121 (286)
Q Consensus        80 -------l~-~-----------~~~~~gG~kq-------------------ptsgLD~~~~~~~~~~l~~l~~~g~tii~  121 (286)
                             +. .           ...+||||||                   |||+||+.+...+.+.|+.+.+ |+|+|+
T Consensus       502 ~~~~~~~i~~l~~g~~t~~~~~g~~LSgGq~QriaiARal~~~p~iliLDEpts~LD~~~~~~i~~~l~~~~~-~~t~i~  580 (1284)
T 3g5u_A          502 EANAYDFIMKLPHQFDTLVGERGAQLSGGQKQRIAIARALVRNPKILLLDEATSALDTESEAVVQAALDKARE-GRTTIV  580 (1284)
T ss_dssp             HTTCHHHHHHSTTGGGCCCSSSSCSSCHHHHHHHHHHHHHHHCCSEEEEESTTCSSCHHHHHHHHHHHHHHHT-TSEEEE
T ss_pred             HhCcHHHHHhccccccccccCCCCccCHHHHHHHHHHHHHhcCCCEEEEECCCCCCCHHHHHHHHHHHHHHcC-CCEEEE
Confidence                   11 1           1258899999                   9999999999999999988754 899999


Q ss_pred             EEcCCCHHHHHHhhhHhhhcCCeeecccChhcHH
Q psy8953         122 TIHTPSALLFEKFDSLYALAKGHCIYRGSISRLV  155 (286)
Q Consensus       122 ~~h~~~~~~~~~~d~v~~l~~G~i~~~g~~~~~~  155 (286)
                      ++|+++. + ..+|+|++|++|++++.|+++++.
T Consensus       581 itH~l~~-i-~~~d~i~vl~~G~i~~~g~~~~l~  612 (1284)
T 3g5u_A          581 IAHRLST-V-RNADVIAGFDGGVIVEQGNHDELM  612 (1284)
T ss_dssp             ECSCHHH-H-TTCSEEEECSSSCCCCEECHHHHH
T ss_pred             EecCHHH-H-HcCCEEEEEECCEEEEECCHHHHH
Confidence            9999864 4 459999999999999999998875



>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>3d31_A Sulfate/molybdate ABC transporter, ATP-binding protein; ATP-binding, nucleotide-binding, membrane, transmembrane, transport protein; 3.00A {Methanosarcina acetivorans} SCOP: b.40.6.3 c.37.1.12 Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>2onk_A Molybdate/tungstate ABC transporter, ATP-binding protein; membrane protein; 3.10A {Archaeoglobus fulgidus} SCOP: c.37.1.12 Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>2qi9_C Vitamin B12 import ATP-binding protein BTUD; inner membrane, membrane, transmembrane, transport, ATP- binding, hydrolase, nucleotide-binding, periplasm; HET: 1PE; 2.60A {Escherichia coli} PDB: 1l7v_C* 4dbl_C Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* Back     alignment and structure
>1mv5_A LMRA, multidrug resistance ABC transporter ATP-binding and permease protein; asymmetric dimer, tetramer, P-glycoprotein; HET: ATP ADP; 3.10A {Lactococcus lactis} SCOP: c.37.1.12 Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>4f4c_A Multidrug resistance protein PGP-1; ABC transporter, ATPase, multi-drug transporter, exporter, A binding, hydrolase,protein transport; HET: NDG NAG BMA MAN 0SA; 3.40A {Caenorhabditis elegans} Back     alignment and structure
>3g5u_A MCG1178, multidrug resistance protein 1A; P-glycoprotein, PGP, cyclic peptide, membrane protein; 3.80A {Mus musculus} PDB: 3g61_A* 3g60_A* Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>3bk7_A ABC transporter ATP-binding protein; ABC ATPase, iron-sulfur cluster, adenosine diphosphate, nucleotide-binding; HET: ADP; 2.80A {Pyrococcus abyssi} PDB: 3j15_B* Back     alignment and structure
>1yqt_A RNAse L inhibitor; ATP-binding cassette, ribosome biogenesis, hydrolyase/translation complex; HET: ADP; 1.90A {Pyrococcus furiosus} Back     alignment and structure
>3ozx_A RNAse L inhibitor; ATP binding cassette protein, hydrolase, translation; HET: ADP; 2.05A {Sulfolobus solfataricus} Back     alignment and structure
>3j16_B RLI1P; ribosome recycling, translation, eukarya, ribosome; HET: ATP; 7.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3ux8_A Excinuclease ABC, A subunit; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, DN binding protein; HET: ADP; 2.10A {Geobacillus} Back     alignment and structure
>2pcj_A ABC transporter, lipoprotein-releasing system ATP-binding protein; structural genomics; 1.70A {Aquifex aeolicus} PDB: 2pcl_A Back     alignment and structure
>4g1u_C Hemin import ATP-binding protein HMUV; membrane transporter, type II ABC importer, HMUT, plasma MEM transport protein-hydrolase complex; 3.01A {Yersinia pestis} Back     alignment and structure
>1ji0_A ABC transporter; ATP binding protein, structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: ATP; 2.00A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1b0u_A Histidine permease; ABC transporter, transport protein; HET: ATP; 1.50A {Salmonella typhimurium} SCOP: c.37.1.12 Back     alignment and structure
>3tif_A Uncharacterized ABC transporter ATP-binding prote; nucleotide-binding domain, ABC transporter ATPase; HET: ADP; 1.80A {Methanocaldococcus jannaschii dsm 2661ORGANISM_TAXID} PDB: 1l2t_A* 1f3o_A* Back     alignment and structure
>2olj_A Amino acid ABC transporter; ABC domain, ATPase, hydrolase; HET: ADP; 2.05A {Geobacillus stearothermophilus} PDB: 2olk_A* 2ouk_A 2q0h_A* 3c4j_A* 3c41_J* Back     alignment and structure
>1g6h_A High-affinity branched-chain amino acid transport ATP-binding protein; beta-core domain; HET: ADP; 1.60A {Methanocaldococcus jannaschii} SCOP: c.37.1.12 PDB: 1gaj_A 1g9x_A* Back     alignment and structure
>1vpl_A ABC transporter, ATP-binding protein; TM0544, structural GENO joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.10A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>3gfo_A Cobalt import ATP-binding protein CBIO 1; structural genomics, cell membrane, cobalt transport, hydrolase, ION transport; 2.30A {Clostridium perfringens atcc 13124} Back     alignment and structure
>1sgw_A Putative ABC transporter; structural genomics, P protein structure initiative, southeast collaboratory for S genomics, secsg; 1.70A {Pyrococcus furiosus} SCOP: c.37.1.12 Back     alignment and structure
>2ihy_A ABC transporter, ATP-binding protein; ATPase, ABC cassette, hydrolase; HET: MSE; 1.90A {Staphylococcus aureus} Back     alignment and structure
>2ff7_A Alpha-hemolysin translocation ATP-binding protein HLYB; ABC-transporter, transport protein; HET: ADP; 1.60A {Escherichia coli} SCOP: c.37.1.12 PDB: 2ffb_A* 2fgk_A* 2ffa_A* 2fgj_A* 2pmk_A* 3b5j_A* 1mt0_A 1xef_A* Back     alignment and structure
>2pze_A Cystic fibrosis transmembrane conductance regulat; NBD, ABC transporter, CFTR, hydrolase; HET: ATP; 1.70A {Homo sapiens} PDB: 2pzg_A* 2pzf_A* 1ckx_A 1cky_A 1ckw_A 1ckz_A Back     alignment and structure
>2nq2_C Hypothetical ABC transporter ATP-binding protein HI1470; putative iron chelatin ABC transporter, nucleotide binding domain; 2.40A {Haemophilus influenzae} Back     alignment and structure
>3fvq_A Fe(3+) IONS import ATP-binding protein FBPC; nucleotide binding domain, ABC motor domain, ferric iron TRA ATP-binding, cell inner membrane; HET: ATP; 1.90A {Neisseria gonorrhoeae} Back     alignment and structure
>2ixe_A Antigen peptide transporter 1; ABC ATPase, hydrolase; HET: ATP; 2.0A {Rattus norvegicus} PDB: 2ixg_A* 2ixf_A* 1jj7_A* Back     alignment and structure
>2cbz_A Multidrug resistance-associated protein 1; ABC proteins, MRP1/ABCC1, nucleotide-binding domain, ATP- binding, hydrolysis, transport; HET: ATP; 1.5A {Homo sapiens} Back     alignment and structure
>3rlf_A Maltose/maltodextrin import ATP-binding protein M; integral membrane protein, ATPase, ABC transporter, membrane transmembrane; HET: UMQ MAL PGV ANP; 2.20A {Escherichia coli} PDB: 1q1e_A 1q12_A* 2awo_A* 3fh6_A 3puv_A* 3puw_A* 3pux_A* 3puy_A* 3puz_A* 3pv0_A* 2awn_A* 2r6g_A* 1q1b_A Back     alignment and structure
>2d2e_A SUFC protein; ABC-ATPase, SUF protein, 310-helix, riken structural genomics/proteomics initiative, RSGI, structural genomics, binding; 1.70A {Thermus thermophilus} PDB: 2d2f_A* Back     alignment and structure
>2yz2_A Putative ABC transporter ATP-binding protein TM_0; cobalt transport, TM02 hydrolase, inner membrane, membrane, nucleotide-binding; 2.30A {Thermotoga maritima} Back     alignment and structure
>3tui_C Methionine import ATP-binding protein METN; ABC-transporter, type I ABC type importer, methionine uptake transporter, membrane protein; HET: ADP; 2.90A {Escherichia coli} PDB: 3tuj_C 3tuz_C* 3dhw_C Back     alignment and structure
>1z47_A CYSA, putative ABC-transporter ATP-binding protein; alpha/beta motif, beta sandwich, ligand binding protein; 1.90A {Alicyclobacillus acidocaldarius} Back     alignment and structure
>2yyz_A Sugar ABC transporter, ATP-binding protein; sugar transport, alpha and beta proteins (A/B) TM0421, structural genomics, NPPSFA; 2.11A {Thermotoga maritima} Back     alignment and structure
>2zu0_C Probable ATP-dependent transporter SUFC; iron-sulfur cluster, ABC-ATPase, ATP-binding, cytoplasm, nucleotide-binding; HET: MES; 2.20A {Escherichia coli} PDB: 2d3w_A Back     alignment and structure
>2it1_A 362AA long hypothetical maltose/maltodextrin transport ATP-binding protein; structural genomics, NPPSFA; 1.94A {Pyrococcus horikoshii} Back     alignment and structure
>1g29_1 MALK, maltose transport protein MALK; ATPase, active transport, maltose uptake and regulation, sugar binding protein; 1.90A {Thermococcus litoralis} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 2d62_A Back     alignment and structure
>1v43_A Sugar-binding transport ATP-binding protein; ATPase, active transport, sugar uptake and regulation, transport protein; 2.20A {Pyrococcus horikoshii} SCOP: b.40.6.3 b.40.6.3 c.37.1.12 PDB: 1vci_A* Back     alignment and structure
>2ghi_A Transport protein; multidrug resistance protein, MDR, structural genomics, structural genomics consortium, SGC; 2.20A {Plasmodium yoelii yoelii str} Back     alignment and structure
>2r6f_A Excinuclease ABC subunit A; UVRA, nucleotide excision repair, DNA repair, ABC ATPase, at cassette, DNA damage, DNA excision; HET: ADP; 3.20A {Geobacillus stearothermophilus} PDB: 3uwx_A Back     alignment and structure
>1oxx_K GLCV, glucose, ABC transporter, ATP binding protein; ABC-ATPase, ATP-binding cassette, ATPase, transport protein; 1.45A {Sulfolobus solfataricus} SCOP: b.40.6.3 c.37.1.12 PDB: 1oxs_C 1oxt_A 1oxu_A* 1oxv_A* Back     alignment and structure
>2iw3_A Elongation factor 3A; acetylation, ATP-binding, protein biosynthesis, nucleotide-binding, phosphorylation, RNA- binding, rRNA-binding; HET: ADP; 2.4A {Saccharomyces cerevisiae} PDB: 2iwh_A* 2ix3_A 2ix8_A Back     alignment and structure
>2bbs_A Cystic fibrosis transmembrane conductance regulator; ATP binding cassette, transport protein; HET: ATP; 2.05A {Homo sapiens} PDB: 2bbt_A* 1xmi_A* 1xmj_A* 2bbo_A* 3si7_A* 1r0w_A 1q3h_A 1r0x_A* 1r0y_A* 1r0z_A* 1r10_A* 1xf9_A* 1xfa_A* Back     alignment and structure
>3nh6_A ATP-binding cassette SUB-family B member 6, mitoc; ABC-transporter, ABCB6, nucleotide binding domain, heme BIOS transport protein; 2.00A {Homo sapiens} PDB: 3nh9_A* 3nha_A* 3nhb_A* Back     alignment and structure
>3pih_A Uvrabc system protein A; hydrolase, ABC ATPase, DNA repair, nucleotide excision repai hydrolase-DNA complex; HET: DNA; 2.90A {Thermotoga maritima} Back     alignment and structure
>2vf7_A UVRA2, excinuclease ABC, subunit A.; DNA-binding protein, nucleotide-binding, zinc-binding domain, SOS response, metal-binding; HET: ADP; 2.30A {Deinococcus radiodurans} PDB: 2vf8_A* Back     alignment and structure
>2pjz_A Hypothetical protein ST1066; ATP binding protein, structural genomics, NPPSFA; 1.90A {Sulfolobus tokodaii} Back     alignment and structure
>3gd7_A Fusion complex of cystic fibrosis transmembrane conductance regulator, residues 1193-1427...; CFTR, ABC transporter, nucleotide binding domain, NBD; HET: B44; 2.70A {Homo sapiens} Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>3sop_A Neuronal-specific septin-3; hydrolase; HET: GDP; 2.88A {Homo sapiens} Back     alignment and structure
>4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>3b60_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; HET: ANP; 3.70A {Salmonella typhimurium} SCOP: c.37.1.12 f.37.1.1 PDB: 3b5y_A* 3b5z_A* 3b5w_A Back     alignment and structure
>3b5x_A Lipid A export ATP-binding/permease protein MSBA; ABC transporter, lipid flippase, hydrolase, inner membrane, lipid transport, membrane; 5.50A {Vibrio cholerae} Back     alignment and structure
>4a82_A Cystic fibrosis transmembrane conductance regulat; CFTR, ION channel, transport protein, casse protein; 2.00A {Homo sapiens} PDB: 2onj_A* 2hyd_A Back     alignment and structure
>3qf4_B Uncharacterized ABC transporter ATP-binding prote TM_0288; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>3qf4_A ABC transporter, ATP-binding protein; multidrug transporter, transport protein; HET: ANP; 2.90A {Thermotoga maritima} Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>3euj_A Chromosome partition protein MUKB, linker; MUKB, MUKE, chromosome condensation, condensin, SMC, N subunit, ABC-type ATPase, WHD, ATP-binding; HET: AGS; 3.10A {Haemophilus ducreyi} PDB: 3euk_A* Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>1znw_A Guanylate kinase, GMP kinase; ATP:GMP-phosphotransferase, TR; 2.10A {Mycobacterium tuberculosis} SCOP: c.37.1.1 PDB: 1znx_A* 1zny_A* 1znz_A* 1s4q_A 1z8f_A Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>2npi_A Protein CLP1; CLP1-PCF11 complex, ATP binding, ternary complex, transcript; HET: ATP; 2.95A {Saccharomyces cerevisiae} Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>2dpy_A FLII, flagellum-specific ATP synthase; beta barrel, alpha-beta structure, hydrolase; HET: ADP; 2.40A {Salmonella typhimurium} Back     alignment and structure
>3qf7_A RAD50; ABC-ATPase, ATPase, hydrolase; HET: ANP; 1.90A {Thermotoga maritima} PDB: 3qg5_A 3tho_A* Back     alignment and structure
>2obl_A ESCN; ATPase, hydrolase; 1.80A {Escherichia coli O127} PDB: 2obm_A* Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>1tf7_A KAIC; homohexamer, hexamer, circadian clock protein; HET: ATP; 2.80A {Synechococcus SP} SCOP: c.37.1.11 c.37.1.11 PDB: 3s1a_A* 1u9i_A* 2gbl_A* 3dvl_A* 3k0a_A* 3k09_A* 3jzm_A* 3k0e_A* 4dug_A* 3ua2_A* 3k0c_A* 3k0f_A* Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>1tq4_A IIGP1, interferon-inducible GTPase; interferon gamma, dimer, immunology, signaling protein; HET: GDP; 1.95A {Mus musculus} SCOP: c.37.1.8 PDB: 1tqd_A* 1tq6_A* 1tpz_A* 1tq2_A* Back     alignment and structure
>1lw7_A Transcriptional regulator NADR; NMN, NMN adenylyl transferase, ribosylnicotinamide KINA transferase; HET: NAD; 2.90A {Haemophilus influenzae} SCOP: c.26.1.3 c.37.1.1 Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>4aby_A DNA repair protein RECN; hydrolase, double strand break repair, ATPase, nucleotide binding domain; HET: DNA; 3.00A {Deinococcus radiodurans} Back     alignment and structure
>1e69_A Chromosome segregation SMC protein; structural maintenance of chromosomes, coiled coil; 3.1A {Thermotoga maritima} SCOP: c.37.1.12 Back     alignment and structure
>1f2t_B RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_B* 1us8_B* Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* Back     alignment and structure
>1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* Back     alignment and structure
>1ls1_A Signal recognition particle protein; FFH, SRP54, SRP, GTPase, ultrahigh resolution, protein transport; 1.10A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 1jpn_B* 1jpj_A* 1ry1_U* 2j45_A* 1o87_A* 2c04_A* 2j46_A* 1rj9_B* 2c03_A* 2j7p_A* 1okk_A* 2cnw_A* 1ng1_A* 2xkv_A 3ng1_A 1ffh_A 2ng1_A* Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* Back     alignment and structure
>3nwj_A ATSK2; P loop, shikimate, nucleoside monophosphate kinase, shikimat ATP binding, chloroplast, transferase; 2.35A {Arabidopsis thaliana} Back     alignment and structure
>3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B* Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>3b85_A Phosphate starvation-inducible protein; PHOH2, ATPase, PFAM: PF02562, ST genomics, PSI-2, protein structure initiative; 2.35A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2v9p_A Replication protein E1; AAA+ molecular motor, DNA replication, DNA translocation, nucleotide-binding, DNA-binding; 3.00A {Bovine papillomavirus type 1} PDB: 2gxa_A* Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>1svm_A Large T antigen; AAA+ fold, viral protein; HET: ATP; 1.94A {Simian virus 40} SCOP: c.37.1.20 PDB: 1svl_A* 1svo_A 1n25_A 2h1l_A Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>3tqc_A Pantothenate kinase; biosynthesis of cofactors, prosthetic groups, carriers, TRAN; HET: ADP; 2.30A {Coxiella burnetii} Back     alignment and structure
>1s96_A Guanylate kinase, GMP kinase; E.coli, dimer, SAD, transferase; 2.00A {Escherichia coli} SCOP: c.37.1.1 PDB: 2an9_A* 2anb_A* 2anc_A 2f3r_A* 2f3t_A* Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>4gp7_A Metallophosphoesterase; polynucleotide kinase phosphatase, RNA repair, transferase; HET: ATP CIT; 2.00A {Clostridium thermocellum} PDB: 4gp6_A* Back     alignment and structure
>1f2t_A RAD50 ABC-ATPase; DNA double-strand break repair, replication; 1.60A {Pyrococcus furiosus} SCOP: c.37.1.12 PDB: 1f2u_A* 1us8_A* Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>2bdt_A BH3686; alpha-beta protein, structural genomics, PSI, protein struct initiative, northeast structural genomics consortium, NESG, function; 2.40A {Bacillus halodurans} SCOP: c.37.1.25 Back     alignment and structure
>1ye8_A Protein THEP1, hypothetical UPF0334 kinase-like protein AQ_1292; mixed alpha-beta protein, rossman fold, signaling protein, transferase; 1.40A {Aquifex aeolicus} SCOP: c.37.1.11 Back     alignment and structure
>2pt7_A CAG-ALFA; ATPase, protein-protein complex, type IV secretion, hydrolas binding complex; 2.40A {Helicobacter pylori} SCOP: c.37.1.11 PDB: 1nly_A* 1nlz_A 1opx_A* 1g6o_A Back     alignment and structure
>1nlf_A Regulatory protein REPA; replicative DNA helicase structural changes, replication; 1.95A {Escherichia coli} SCOP: c.37.1.11 PDB: 1g8y_A 1olo_A Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>1pzn_A RAD51, DNA repair and recombination protein RAD51, RADA; heptameric ring, heptamer, ring, oligomer, RAD51 polymerizat motif; HET: DNA; 2.85A {Pyrococcus furiosus} SCOP: a.60.4.1 c.37.1.11 Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>1zu4_A FTSY; GTPase, signal recognition particle, SRP, receptor, protein transport; 1.95A {Mycoplasma mycoides} PDB: 1zu5_A Back     alignment and structure
>3szr_A Interferon-induced GTP-binding protein MX1; interferon-induced antiviral GTPase, membrane associated, PR binding; 3.50A {Homo sapiens} PDB: 3zys_B Back     alignment and structure
>1vma_A Cell division protein FTSY; TM0570, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics; HET: CIT; 1.60A {Thermotoga maritima} SCOP: a.24.13.1 c.37.1.10 Back     alignment and structure
>3qkt_A DNA double-strand break repair RAD50 ATPase; RECA-like fold, coiled-coils, ATP binding, DNA bindi MRE11, replication; HET: DNA ANP; 1.90A {Pyrococcus furiosus} PDB: 3qku_A* 1ii8_A 3qks_B* 3qkr_B* 1ii8_B Back     alignment and structure
>3cr8_A Sulfate adenylyltranferase, adenylylsulfate kinase; APS kinase, transferase, sulfate metabolism, nucleotide 2 kinase; 2.95A {Thiobacillus denitrificans} Back     alignment and structure
>3b9q_A Chloroplast SRP receptor homolog, alpha subunit CPFTSY; protein translocation, GTP-binding, nucleotide-binding, protein transport; 1.75A {Arabidopsis thaliana} Back     alignment and structure
>4ad8_A DNA repair protein RECN; DNA binding protein, ATPase domain; HET: DNA; 4.00A {Deinococcus radiodurans} Back     alignment and structure
>2qnr_A Septin-2, protein NEDD5; structural genomics consortium, SGC, mitosis, GDP, C cycle, cell division, GTP-binding, nucleotide-binding; HET: GDP; 2.60A {Homo sapiens} PDB: 2qa5_A* 3ftq_A* Back     alignment and structure
>2o5v_A DNA replication and repair protein RECF; ABC ATPase, walker A motif, P-loop, signature motif, replication/recombination complex; HET: DNA; 1.61A {Deinococcus radiodurans} Back     alignment and structure
>4a74_A DNA repair and recombination protein RADA; hydrolase, recombinase; HET: DNA ANP; 1.48A {Pyrococcus furiosus} PDB: 4a6x_A* 4a6p_A* 4a7o_A* Back     alignment and structure
>4ad8_A DNA repair protein RECN; DNA binding protein, ATPase domain; HET: DNA; 4.00A {Deinococcus radiodurans} Back     alignment and structure
>1oix_A RAS-related protein RAB-11A; small G protein, intracellular trafficking, GTP-binding, lipoprotein, prenylation, protein transport; HET: GDP; 1.7A {Homo sapiens} SCOP: c.37.1.8 PDB: 1oiw_A* 1oiv_A* 3rwo_B* 3rwm_B* Back     alignment and structure
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A* 3syn_A* Back     alignment and structure
>3kta_B Chromosome segregation protein SMC; structural maintenance of chromosomes, ABC ATPase, CFTR adenylate kinase, AP5A, transferase; HET: AP5; 1.63A {Pyrococcus furiosus} PDB: 1xew_Y 1xex_B* Back     alignment and structure
>3k1j_A LON protease, ATP-dependent protease LON; ATP-binding, nucleotide-binding, Pro hydrolase; HET: ADP PE8; 2.00A {Thermococcus onnurineus} Back     alignment and structure
>2p67_A LAO/AO transport system kinase; ARGK, structural GEN PSI-2, protein structure initiative, NEW YORK SGX research for structural genomics; 1.80A {Escherichia coli} SCOP: c.37.1.10 Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>1z6g_A Guanylate kinase; structural genomics, SGC, structural genom consortium, transferase; HET: EPE; 2.18A {Plasmodium falciparum} Back     alignment and structure
>3m6a_A ATP-dependent protease LA 1; alpha, beta, ATP-binding, hydrolase, nucleotide-binding, Pro serine protease, stress response; HET: ADP; 3.40A {Bacillus subtilis} PDB: 1x37_A Back     alignment and structure
>1odf_A YGR205W, hypothetical 33.3 kDa protein in ADE3-Ser2 intergenic region; yeast protein, ATP binding protein; 2.25A {Saccharomyces cerevisiae} SCOP: c.37.1.6 Back     alignment and structure
>2gza_A Type IV secretion system protein VIRB11; ATPase, hydrolase; 2.60A {Brucella suis} Back     alignment and structure
>2og2_A Putative signal recognition particle receptor; nucleotide-binding, protein transport; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>2dhr_A FTSH; AAA+ protein, hexameric Zn metalloprotease, hydrolase; HET: ADP; 3.90A {Thermus thermophilus} Back     alignment and structure
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2xkv_D 2iyl_D* 2cnw_D* 2j7p_D* Back     alignment and structure
>2ffh_A Protein (FFH); SRP54, signal recognition particle, GTPase, M domain, RNA-binding, signal sequence-binding, helix-turn-helix, protein targeting; 3.20A {Thermus aquaticus} SCOP: a.24.13.1 a.36.1.1 c.37.1.10 PDB: 2iy3_A Back     alignment and structure
>2www_A Methylmalonic aciduria type A protein, mitochondrial; transport protein, nucleotide-binding; HET: GDP 2PE; 2.64A {Homo sapiens} Back     alignment and structure
>1lv7_A FTSH; alpha/beta domain, four helix bundle, hydrolase; 1.50A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>3hr8_A Protein RECA; alpha and beta proteins (A/B, A+B), ATP-binding, cytoplasm, damage, DNA recombination, DNA repair, DNA-binding; 1.95A {Thermotoga maritima} Back     alignment and structure
>3t34_A Dynamin-related protein 1A, linker, dynamin-relat 1A; dynamin-like protein 1A, GTPase, membrane fission, motor Pro; HET: GDP; 2.40A {Arabidopsis thaliana} PDB: 3t35_A* Back     alignment and structure
>1j8m_F SRP54, signal recognition 54 kDa protein; signaling protein; 2.00A {Acidianus ambivalens} SCOP: a.24.13.1 c.37.1.10 PDB: 1j8y_F Back     alignment and structure
>2eyu_A Twitching motility protein PILT; pilus retraction motor, C-terminal domain PILT, protein transport; 1.87A {Aquifex aeolicus} Back     alignment and structure
>3ice_A Transcription termination factor RHO; transcription, ATPase, hexamer, helicase, RNA, RECA, OB fold ATP-binding, hydrolase; HET: MSE ADP SPD; 2.80A {Escherichia coli k-12} PDB: 1pv4_A 1pvo_A* 1xpo_A* 1xpr_A* 1xpu_A* 2ht1_A Back     alignment and structure
>1sxj_C Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2zr9_A Protein RECA, recombinase A; recombination, RECA mutants, DNA-repair, ATP-binding, DNA DA recombination, DNA repair, DNA-binding; HET: DTP; 2.50A {Mycobacterium smegmatis str} PDB: 2zr0_A* 2zra_A* 2zrb_A 2zrm_A* 1ubc_A* 1ubf_A* 1ubg_A* 1ube_A* 2g88_A* 2odw_A* 2oe2_A 2oep_A* 2oes_A 2ofo_A 2zr7_A 2odn_A* 2zrn_A 2zro_A* 2zrp_A* 2zre_A* ... Back     alignment and structure
>3aez_A Pantothenate kinase; transferase, homodimer, COA biosynthesis, nucleotide binding binding, cytoplasm, nucleotide-binding; HET: GDP PAZ; 2.20A {Mycobacterium tuberculosis} PDB: 2ges_A* 2geu_A* 2gev_A* 2zs7_A* 2zs8_A* 2zs9_A* 2zsa_A* 2zsb_A* 2zsd_A* 2zse_A* 2zsf_A* 2get_A* 3af0_A* 3af1_A* 3af2_A* 3af3_A* 3af4_A* 3avp_A* 3avo_A* 3avq_A* Back     alignment and structure
>1w1w_A Structural maintenance of chromosome 1; cohesin, chromosome segregation, cell adhesion, kleisin, MIT cell cycle; HET: ATG; 2.90A {Saccharomyces cerevisiae} SCOP: c.37.1.12 Back     alignment and structure
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B* Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2p5t_B PEZT; postsegregational killing system, phosphoryltransferase, HEL helix motif, transcription regulator; 3.20A {Streptococcus pneumoniae} Back     alignment and structure
>3jvv_A Twitching mobility protein; hexameric P-loop ATPase, secretion ATPase, ATP-binding, FIMB nucleotide-binding, transport; HET: ACP CIT; 2.60A {Pseudomonas aeruginosa} PDB: 3jvu_A* Back     alignment and structure
>1u0l_A Probable GTPase ENGC; permutation, OB-fold, zinc-finger, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; HET: GDP; 2.80A {Thermotoga maritima} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>3asz_A Uridine kinase; cytidine phosphorylation, transferase; HET: C5P; 2.25A {Thermus thermophilus} PDB: 3asy_A* Back     alignment and structure
>2r6a_A DNAB helicase, replicative helicase; replication, DNAB; 2.90A {Geobacillus stearothermophilus} PDB: 2r6c_A 2r6d_A 2r6e_A 2vyf_A 2vye_A Back     alignment and structure
>3cf0_A Transitional endoplasmic reticulum ATPase; AAA, P97/VCP, ERAD, CDC48, ATP-binding, lipid-binding, nucle binding, nucleus, phosphoprotein, transport; HET: ADP; 3.00A {Mus musculus} Back     alignment and structure
>3auy_A DNA double-strand break repair RAD50 ATPase; DNA repair, ABC transporter ATPase domain-like; HET: DNA ADP; 2.70A {Methanocaldococcus jannaschii} PDB: 3aux_A* 3av0_B* Back     alignment and structure
>1mky_A Probable GTP-binding protein ENGA; GTPase, DER, KH-domain, tandem G-domains, ligand binding protein; HET: GDP; 1.90A {Thermotoga maritima} SCOP: c.37.1.8 c.37.1.8 d.52.5.1 Back     alignment and structure
>1htw_A HI0065; nucleotide-binding fold, structural genomics, structure 2 function project, S2F, unknown function; HET: ADP; 1.70A {Haemophilus influenzae} SCOP: c.37.1.18 PDB: 1fl9_A Back     alignment and structure
>2rcn_A Probable GTPase ENGC; YJEQ, circularly permuted, GTP-binding, hydrolase, nucleotide-binding; HET: GDP; 2.25A {Salmonella typhimurium} PDB: 2ykr_W 4a2i_V Back     alignment and structure
>2qtf_A Protein HFLX, GTP-binding protein; beta-alpha-barrels, nucleotide-binding, nucleotide binding protein; 2.00A {Sulfolobus solfataricus P2} PDB: 2qth_A* 3kxi_A* 3kxl_A 3kxk_A Back     alignment and structure
>1ni3_A YCHF GTPase, YCHF GTP-binding protein; structural genomics, GTP1OBG, PSI, protein structure initiative; 2.80A {Schizosaccharomyces pombe} SCOP: c.37.1.8 d.15.10.2 Back     alignment and structure
>1gvn_B Zeta; postsegregational killing system, plasmid; 1.95A {Streptococcus pyogenes} SCOP: c.37.1.21 PDB: 3q8x_B* Back     alignment and structure
>3lxx_A GTPase IMAP family member 4; structural genomics consortium, SGC, coiled coil, GTP- binding, nucleotide-binding, immune system; HET: GDP; 2.15A {Homo sapiens} Back     alignment and structure
>2qag_A Septin-2, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2ce7_A Cell division protein FTSH; metalloprotease; HET: ADP; 2.44A {Thermotoga maritima} SCOP: a.269.1.1 c.37.1.20 PDB: 2cea_A* 3kds_E* Back     alignment and structure
>2yv5_A YJEQ protein; hydrolase, GTPase, permutation, structural genomics, NPPSFA, national project on protein structural and functional analyses; HET: GDP; 1.90A {Aquifex aeolicus} Back     alignment and structure
>2ius_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- binding, cell division, transmembrane, inner membrane; HET: DNA; 2.7A {Escherichia coli} PDB: 2j5p_A* Back     alignment and structure
>2jeo_A Uridine-cytidine kinase 1; UCK, transferase, ATP-binding, nucleoside kinase, nucleotide-binding; 2.50A {Homo sapiens} PDB: 2uvq_A* Back     alignment and structure
>1v5w_A DMC1, meiotic recombination protein DMC1/LIM15 homolog; DNA-binding protein, ring protein, octamer, AAA ATPase; 3.20A {Homo sapiens} SCOP: c.37.1.11 PDB: 2zjb_A Back     alignment and structure
>1nij_A Hypothetical protein YJIA; structural genomics, P-loop protein, GTP binding, structure function project, S2F, unknown function; 2.00A {Escherichia coli} SCOP: c.37.1.10 d.237.1.1 Back     alignment and structure
>3llm_A ATP-dependent RNA helicase A; alpha-beta-alpha, structural genomics, structural genomics consortium, SGC, activator, ATP-binding, DNA-binding; HET: ADP; 2.80A {Homo sapiens} Back     alignment and structure
>3kl4_A SRP54, signal recognition 54 kDa protein; signal recognition particle, SRP, SRP54, FFH, signal sequenc peptide; 3.50A {Sulfolobus solfataricus} PDB: 1qzx_A 1qzw_A Back     alignment and structure
>2i3b_A HCR-ntpase, human cancer-related ntpase; AAA, rossmann, hydrolase; NMR {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>2z43_A DNA repair and recombination protein RADA; archaea, filament, DNA binding, molecular SWI RECA, DMC1; HET: DNA; 1.93A {Sulfolobus solfataricus} PDB: 2bke_A* 2dfl_A* 2zub_A* 2zuc_A* 2zud_A* Back     alignment and structure
>4ag6_A VIRB4 ATPase, type IV secretory pathway VIRB4 components-like P; hydrolase, type IV secretion, conjugation; 2.35A {Thermoanaerobacter pseudethanolicus} PDB: 4ag5_A Back     alignment and structure
>2ged_A SR-beta, signal recognition particle receptor beta subunit; protein transport, G protein, proline isomerization, circular permutation; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>3bos_A Putative DNA replication factor; P-loop containing nucleoside triphosphate hydrolases, struct genomics; HET: MSE CDP; 1.75A {Shewanella amazonensis} PDB: 3sc3_A Back     alignment and structure
>3b9p_A CG5977-PA, isoform A; AAA ATPase, ATP-binding, nucleotide-binding, hydrolase; 2.70A {Drosophila melanogaster} Back     alignment and structure
>1wb9_A DNA mismatch repair protein MUTS; DNA-binding, ATP-binding, DNA binding, DNA repair, mismatch recognition; HET: DNA ADP; 2.10A {Escherichia coli} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1wbb_A* 1e3m_A* 1oh5_A* 1oh6_A* 1oh7_A* 1oh8_A* 1w7a_A* 2wtu_A* 1wbd_A* 1ng9_A* 3k0s_A* Back     alignment and structure
>2qby_A CDC6 homolog 1, cell division control protein 6 homolog 1; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>2qmh_A HPR kinase/phosphorylase; V267F mutation, ATP-binding, carbohydrate metabolism, magnesium, metal-binding, multifunctional enzyme; 2.60A {Lactobacillus casei} PDB: 1jb1_A 1kkl_A 1kkm_A* Back     alignment and structure
>1ko7_A HPR kinase/phosphatase; protein kinase, phosphotransfer, protein phosphatase, dual activity, product, substrate, transferase, hydrolase; 1.95A {Staphylococcus xylosus} SCOP: c.98.2.1 c.91.1.2 Back     alignment and structure
>1fnn_A CDC6P, cell division control protein 6; ORC1, AAA protein, DNA replication initation factor, cell cycle control factor; HET: ADP; 2.00A {Pyrobaculum aerophilum} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>4fcw_A Chaperone protein CLPB; AAA domain; HET: ADP; 2.35A {Thermus thermophilus} PDB: 4fcv_A* 4fd2_A* 4fct_A* Back     alignment and structure
>2e87_A Hypothetical protein PH1320; GTP-binding, GTPase, OBG, bundle, GDP, complex, structural G NPPSFA; HET: GDP; 2.35A {Pyrococcus horikoshii} Back     alignment and structure
>2i1q_A DNA repair and recombination protein RADA; ATPase, recombinase, ATP complex, calcium stimulation, RECA, DMC1; HET: DNA ANP; 1.90A {Methanococcus voltae} SCOP: a.60.4.1 c.37.1.11 PDB: 1xu4_A* 2b21_A* 2fpk_A* 2fpl_A* 2fpm_A* 1t4g_A* 3fyh_A* 2f1j_A* 2f1i_A* 2f1h_A* 3ntu_A* 3ewa_A* 3ew9_A* 3etl_A* 4dc9_A* 2gdj_A* Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>1t9h_A YLOQ, probable GTPase ENGC; N-terminal beta-barrel domain with oligonucleotide binding fold, central GTP binding domain; 1.60A {Bacillus subtilis} SCOP: b.40.4.5 c.37.1.8 Back     alignment and structure
>3thx_A DNA mismatch repair protein MSH2; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 2o8c_A* 2o8d_A* 2o8f_A* 3thw_A* 2o8b_A* 3thy_A* 3thz_A* 2o8e_A* Back     alignment and structure
>1u94_A RECA protein, recombinase A; homologous recombination, ATPase, DNA repair, DNA binding protein; 1.90A {Escherichia coli} SCOP: c.37.1.11 d.48.1.1 PDB: 1u98_A 1u99_A 1xms_A* 1xmv_A* 2rec_A 2reb_A 1n03_A* 1rea_A 1aa3_A Back     alignment and structure
>3a8t_A Adenylate isopentenyltransferase; rossmann fold protein; HET: ATP; 2.37A {Humulus lupulus} Back     alignment and structure
>2f6r_A COA synthase, bifunctional coenzyme A synthase; 18044849, bifunctional coenzyme A synthase (COA synthase), S genomics; HET: ACO UNL; 1.70A {Mus musculus} Back     alignment and structure
>3bh0_A DNAB-like replicative helicase; ATPase, replication; 2.35A {Bacillus phage SPP1} Back     alignment and structure
>2yhs_A FTSY, cell division protein FTSY; cell cycle, protein targeting, simibi class GTPase, GTP-BIND membrane, nucleotide-binding; 1.60A {Escherichia coli} PDB: 2qy9_A 2xxa_B* 1fts_A Back     alignment and structure
>2zts_A Putative uncharacterized protein PH0186; KAIC like protein, ATP-binding, nucleotide-binding, ATP- binding protein; HET: ADP; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>4a1f_A DNAB helicase, replicative DNA helicase; hydrolase, DNA replication, ATPase; HET: FLC; 2.50A {Helicobacter pylori} Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>1n0w_A DNA repair protein RAD51 homolog 1; DNA repair, homologous recombination, breast cancer susceptibility, RECA-like ATPase, protein complex; HET: DNA MSE; 1.70A {Homo sapiens} SCOP: c.37.1.11 Back     alignment and structure
>3tlx_A Adenylate kinase 2; structural genomics, structural genomics consortium, SGC, RO fold, transferase, ATP binding, phosphorylation; HET: ADP ATP AMP; 2.75A {Plasmodium falciparum} Back     alignment and structure
>3h4m_A Proteasome-activating nucleotidase; ATPase, PAN, ATP-binding, nucleotide-binding, HY; HET: ADP; 3.11A {Methanocaldococcus jannaschii} Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>2wsm_A Hydrogenase expression/formation protein (HYPB); metal binding protein; 2.30A {Archaeoglobus fulgidus} Back     alignment and structure
>3lda_A DNA repair protein RAD51; DNA binding protein, ATP-binding, DNA damage, DNA recombinat repair, nucleotide-binding; HET: DNA; 2.50A {Saccharomyces cerevisiae} PDB: 1szp_A* Back     alignment and structure
>3n70_A Transport activator; sigma-54, ntpase, PSI, MCSG, structural genomics, center for structural genomics; 2.80A {Escherichia coli} Back     alignment and structure
>1l8q_A Chromosomal replication initiator protein DNAA; AAA+, helix-turn-helix, nucleotide-binding, DNA binding, REP initiation, DNA binding protein; HET: ADP; 2.70A {Aquifex aeolicus} SCOP: a.4.12.2 c.37.1.20 PDB: 3r8f_A* 2hcb_A* Back     alignment and structure
>1njg_A DNA polymerase III subunit gamma; rossman-like fold, AAA+ ATPase domains, sensor 1, sensor 2, transferase; HET: DNA; 2.20A {Escherichia coli} SCOP: c.37.1.20 PDB: 1njf_A* Back     alignment and structure
>3umf_A Adenylate kinase; rossmann fold, transferase; 2.05A {Schistosoma mansoni} Back     alignment and structure
>2p65_A Hypothetical protein PF08_0063; CLPB, malaria, structural genomics, structural genomics consortium, SGC, unknown function; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2v3c_C SRP54, signal recognition 54 kDa protein; nucleotide-binding, signal recognition particle, GTP-binding, RNA-binding; 2.50A {Methanocaldococcus jannaschii} PDB: 3ndb_B Back     alignment and structure
>2ewv_A Twitching motility protein PILT; pilus retraction motor, ATPase, hexameric PILT, protein TRAN; HET: ADP; 2.80A {Aquifex aeolicus} PDB: 2eww_A* 2gsz_A* Back     alignment and structure
>2bbw_A Adenylate kinase 4, AK4; nucleotide kinase, nucleotide binding, human, structura genomics, structural genomics consortium, SGC, transferase; HET: GP5; 2.05A {Homo sapiens} PDB: 2ar7_A* 3ndp_A Back     alignment and structure
>4dhe_A Probable GTP-binding protein ENGB; melioidosis, RAS-like GTPase, cell division, cell cycle, SEP GTP-binding; 2.20A {Burkholderia thailandensis} Back     alignment and structure
>1sxj_D Activator 1 41 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2q6t_A DNAB replication FORK helicase; hydrolase; 2.90A {Thermus aquaticus} Back     alignment and structure
>2j1l_A RHO-related GTP-binding protein RHOD; GTPase, membrane, prenylation, hydrolase, nucleotide-binding, methylation, lipoprotein, endosome DYNA; HET: GDP; 2.5A {Homo sapiens} Back     alignment and structure
>2g3y_A GTP-binding protein GEM; small GTPase, GDP, inactive state, RGK family, structur genomics, structural genomics consortium, SGC, signaling PR; HET: GDP; 2.40A {Homo sapiens} SCOP: c.37.1.8 Back     alignment and structure
>2qu8_A Putative nucleolar GTP-binding protein 1; GTPase, malaria, structural genomics, structural genomics consortium, SGC, unknown function; HET: GDP; 2.01A {Plasmodium falciparum} Back     alignment and structure
>1sky_E F1-ATPase, F1-ATP synthase; F1FO ATP synthase, alpha3BETA3 SUBC F1-ATPase, hydrolase; 3.20A {Bacillus SP} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 Back     alignment and structure
>2hf9_A Probable hydrogenase nickel incorporation protein HYPB; alpha and beta protein; HET: GSP; 1.90A {Methanocaldococcus jannaschii} PDB: 2hf8_A* Back     alignment and structure
>2z4s_A Chromosomal replication initiator protein DNAA; AAA+ ATPase, domain III (ATPase domain), ATP-binding, cytoplasm, DNA replication; HET: ADP; 3.00A {Thermotoga maritima} PDB: 2z4r_A* Back     alignment and structure
>2b6h_A ADP-ribosylation factor 5; membrane trafficking, GDP, structural genomics, structural G consortium, SGC, protein transport; HET: GDP; 1.76A {Homo sapiens} SCOP: c.37.1.8 PDB: 1z6x_A* 3aq4_A* Back     alignment and structure
>1xp8_A RECA protein, recombinase A; recombination, radioresistance, DNA-repair, ATPase, DNA-BIND protein, DNA binding protein; HET: AGS; 2.50A {Deinococcus radiodurans} SCOP: c.37.1.11 d.48.1.1 Back     alignment and structure
>2qz4_A Paraplegin; AAA+, SPG7, protease, ADP, structural genomics, structural G consortium, SGC, ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.22A {Homo sapiens} Back     alignment and structure
>3dm5_A SRP54, signal recognition 54 kDa protein; protein-RNA, signal recognition particle, SRP-GTPase, protein targeting, cytoplasm, GTP-binding; HET: GDP; 2.51A {Pyrococcus furiosus} Back     alignment and structure
>3def_A T7I23.11 protein; chloroplast, TOC33, GTPase, hydrolase; HET: GDP; 1.96A {Arabidopsis thaliana} PDB: 3bb3_A* 3bb4_A* 2j3e_A* Back     alignment and structure
>3cnl_A YLQF, putative uncharacterized protein; circular permutation, GNP, signaling protein; HET: GNP; 2.00A {Thermotoga maritima} PDB: 3cnn_A* 3cno_A* Back     alignment and structure
>2r62_A Cell division protease FTSH homolog; ATPase domain, ATP-binding, cell CELL division, hydrolase, membrane, metal-binding; 3.30A {Helicobacter pylori} PDB: 2r65_A* Back     alignment and structure
>1h65_A Chloroplast outer envelope protein OEP34; GTPase, translocon; HET: GDP; 2.0A {Pisum sativum} SCOP: c.37.1.8 PDB: 3bb1_A* Back     alignment and structure
>2hup_A RAS-related protein RAB-43; G-protein, GDP, structural genomics, structural genomics consortium, SGC, signaling protein; HET: GDP; 2.05A {Homo sapiens} Back     alignment and structure
>1g41_A Heat shock protein HSLU; AAA-ATPase, CLPY, ATP-dependent proteolysis, chaperone; HET: ADP; 2.30A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1g3i_A* 1im2_A* 1kyi_A* 1g4a_E* 1g4b_E 1yyf_A* 1do0_A* 1do2_A* 1e94_E* 1hqy_E* 1ht1_E* 1ht2_E* Back     alignment and structure
>4gzl_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTP binding, membrane, hydrolase; HET: GNP; 2.00A {Homo sapiens} PDB: 3th5_A* 4gzm_A* Back     alignment and structure
>2vhj_A Ntpase P4, P4; non- hydrolysable ATP analogue, hydrolase, virus dsRNA, molecular motor, packaging ATPase, hexameric helicase; HET: ADP; 1.80A {Pseudomonas phage PHI12} PDB: 2vhq_A* 1w44_A* 1w46_A* 1w47_A* 1w48_A* 1w49_A* 1w4a_A* 1w4b_A* 1w4c_A 2vht_A* 2vhu_A* 2vhc_A* Back     alignment and structure
>3hws_A ATP-dependent CLP protease ATP-binding subunit CL; CLPXP, AAA+ molecular machine, hexamer, asymmetric,, ATP-BIN chaperone, metal-binding; HET: ADP; 3.25A {Escherichia coli} PDB: 3hte_A Back     alignment and structure
>2qag_C Septin-7; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>1ewq_A DNA mismatch repair protein MUTS; multiple domains of protein, mostly mixed alpha-beta structures, one domain is entirely helical; HET: DNA; 2.20A {Thermus aquaticus} SCOP: a.113.1.1 c.37.1.12 c.55.6.1 d.75.2.1 PDB: 1nne_A* 1fw6_A* 1ewr_A* Back     alignment and structure
>2xau_A PRE-mRNA-splicing factor ATP-dependent RNA helica; hydrolase, ribosome biogenesis, ATPase, ATP-binding, OB-fold; HET: ADP; 1.90A {Saccharomyces cerevisiae} PDB: 3kx2_B* Back     alignment and structure
>3p32_A Probable GTPase RV1496/MT1543; structural genomics, seattle structural genomics center for infectious disease, ssgcid, MEAB, MMAA; HET: GDP PGE; 1.90A {Mycobacterium tuberculosis} PDB: 3md0_A* 4gt1_A* 3nxs_A* 3tk1_A* Back     alignment and structure
>1cr0_A DNA primase/helicase; RECA-type protein fold, transferase; HET: DNA; 2.30A {Enterobacteria phage T7} SCOP: c.37.1.11 PDB: 1cr1_A* 1cr2_A* 1cr4_A* 1e0j_A* 1e0k_A* Back     alignment and structure
>3syl_A Protein CBBX; photosynthesis, rubisco activase, AAA+ protein, calvin cycle chaperone; 3.00A {Rhodobacter sphaeroides} PDB: 3syk_A 3zuh_A* Back     alignment and structure
>2w0m_A SSO2452; RECA, SSPF, unknown FUN; 2.0A {Sulfolobus solfataricus P2} Back     alignment and structure
>2chg_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATPase, ATP-binding, nucleotide-binding; HET: ANP; 2.1A {Archaeoglobus fulgidus} Back     alignment and structure
>2v1u_A Cell division control protein 6 homolog; DNA replication, nucleotide-binding, replication, archaea; HET: ADP; 3.10A {Aeropyrum pernix} Back     alignment and structure
>3co5_A Putative two-component system transcriptional RES regulator; structural genomics, APC89341.1; 2.40A {Neisseria gonorrhoeae} Back     alignment and structure
>3d8b_A Fidgetin-like protein 1; AAA+, ATPase, ADP, SGC, structural genomics consortium, ATP- hydrolase, magnesium, metal-binding, nucleotide-binding; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>1sxj_E Activator 1 40 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>3bgw_A DNAB-like replicative helicase; ATPase, replication; 3.91A {Bacillus phage SPP1} Back     alignment and structure
>1knx_A Probable HPR(Ser) kinase/phosphatase; HPR kinase, HPR kinase/phosphatase, HPRK/P, P-loop, walker A BOX, catabolite repression; 2.50A {Mycoplasma pneumoniae} SCOP: c.98.2.1 c.91.1.2 Back     alignment and structure
>1xwi_A SKD1 protein; VPS4B, AAA ATPase, protein transport; 2.80A {Homo sapiens} Back     alignment and structure
>1d2n_A N-ethylmaleimide-sensitive fusion protein; hexamerization domain, ATPase, transport; HET: ANP; 1.75A {Cricetulus griseus} SCOP: c.37.1.20 PDB: 1nsf_A* Back     alignment and structure
>3t15_A Ribulose bisphosphate carboxylase/oxygenase activ chloroplastic; photosynthesis, rubisco activase, AAA+ protein; 2.95A {Nicotiana tabacum} PDB: 3zw6_A Back     alignment and structure
>2r44_A Uncharacterized protein; putative ATPase, structural genomics, joint center for struc genomics, JCSG; HET: MSE PG4; 2.00A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>2j37_W Signal recognition particle 54 kDa protein (SRP54); ribosome, SRP, translation/RNA; 8.00A {Canis SP} PDB: 1wgw_A Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>1ofh_A ATP-dependent HSL protease ATP-binding subunit HSLU; chaperone, hydrolase, ATP-binding; HET: ADP; 2.5A {Haemophilus influenzae} SCOP: c.37.1.20 PDB: 1ofi_A* Back     alignment and structure
>3pvs_A Replication-associated recombination protein A; maintenance of genome stability Pro recombination; 2.50A {Escherichia coli} Back     alignment and structure
>1g8f_A Sulfate adenylyltransferase; alpha-beta protein, beta-barrel, rossmann-fold, kinase fold; 1.95A {Saccharomyces cerevisiae} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1g8g_A* 1g8h_A* 1j70_A 1jec_A 1jed_A* 1jee_A* Back     alignment and structure
>1x6v_B Bifunctional 3'-phosphoadenosine 5'- phosphosulfate synthethase 1; transferase, ATP sulfurylase, APS kinase, PAPS; HET: ADP; 1.75A {Homo sapiens} SCOP: b.122.1.3 c.26.1.5 c.37.1.4 PDB: 1xjq_B* 1xnj_B* 2qjf_A* 2ofx_A* 2ofw_A* Back     alignment and structure
>3eie_A Vacuolar protein sorting-associated protein 4; AAA ATPase, ATP-binding cassette, ATP-binding, endosome, MEM nucleotide-binding; 2.70A {Saccharomyces cerevisiae} PDB: 3eih_A* 2rko_A 3mhv_C Back     alignment and structure
>3pfi_A Holliday junction ATP-dependent DNA helicase RUVB; probable holliday junction DNA helicase; HET: ADP; 2.69A {Campylobacter jejuni subsp} Back     alignment and structure
>3uk6_A RUVB-like 2; hexameric AAA+ ATP-ASE, DNA unwinding, hydrolase; HET: ADP; 2.95A {Homo sapiens} PDB: 2xsz_D* Back     alignment and structure
>1um8_A ATP-dependent CLP protease ATP-binding subunit CL; CLPP binding loop, chaperone; HET: ADP; 2.60A {Helicobacter pylori} SCOP: c.37.1.20 Back     alignment and structure
>2qpt_A EH domain-containing protein-2; protein-nucleotide complex, membrane protein, endocytosis; HET: ANP; 3.10A {Mus musculus} Back     alignment and structure
>3th5_A RAS-related C3 botulinum toxin substrate 1; rossmann fold, GTPase, GTP binding, protein binding, signali protein; HET: GNP; 2.30A {Homo sapiens} Back     alignment and structure
>2qby_B CDC6 homolog 3, cell division control protein 6 homolog 3; winged-helix domain, helix-turn-helix, AAA+ ATPase domain, protein-DNA complex; HET: DNA SPD ADP; 3.35A {Sulfolobus solfataricus} Back     alignment and structure
>1zcb_A G alpha I/13; GTP-binding, lipoprotein, membrane, transducer, signaling PR; HET: GDP; 2.00A {Mus musculus} SCOP: a.66.1.1 c.37.1.8 PDB: 3ab3_A* 3cx8_A* 3cx7_A* 3cx6_A* 1zca_A* Back     alignment and structure
>1puj_A YLQF, conserved hypothetical protein YLQF; structural genomics, nysgxrc T18, GTPase, PSI, protein structure initiative; HET: GNP; 2.00A {Bacillus subtilis} SCOP: c.37.1.8 Back     alignment and structure
>1m8p_A Sulfate adenylyltransferase; rossmann fold, phosphosulfate binding, T-state; HET: PPS; 2.60A {Penicillium chrysogenum} SCOP: b.122.1.3 c.26.1.5 c.37.1.15 PDB: 1i2d_A* Back     alignment and structure
>2qen_A Walker-type ATPase; unknown function; HET: ADP; 2.25A {Pyrococcus abyssi} Back     alignment and structure
>3geh_A MNME, tRNA modification GTPase MNME; G protein, U34, GTP-binding, HYDR magnesium, metal-binding, nucleotide-binding, potassium, TR processing; HET: GDP FON; 3.20A {Nostoc SP} Back     alignment and structure
>1q57_A DNA primase/helicase; dntpase, DNA replication, transferase; HET: DNA; 3.45A {Enterobacteria phage T7} SCOP: c.37.1.11 e.13.1.2 Back     alignment and structure
>2bjv_A PSP operon transcriptional activator; AAA, transcription activation, gene regulation, sigma54 activator, enhancer binding protein, PSPF; 1.7A {Escherichia coli} PDB: 2bjw_A 2c96_A* 2c98_A* 2c99_A* 2c9c_A* 2vii_A* Back     alignment and structure
>2oap_1 GSPE-2, type II secretion system protein; hexameric ATPase, hydrolase; HET: ANP; 2.95A {Archaeoglobus fulgidus} PDB: 2oaq_1 Back     alignment and structure
>1tue_A Replication protein E1; helicase, replication, E1E2 complex, AAA+ protein; 2.10A {Human papillomavirus type 18} SCOP: c.37.1.20 Back     alignment and structure
>2qag_B Septin-6, protein NEDD5; cell cycle, cell division, GTP-binding, nucleotide-binding, phosphorylation, acetylation, alternative splicing, coiled coil; HET: GDP GTP; 4.00A {Homo sapiens} Back     alignment and structure
>2axn_A 6-phosphofructo-2-kinase/fructose-2,6- biphosphatase 3 (6PF-2-K/FRU- 2,6-P2ASE brain/placenta-type...; bifunctional enzyme, EDTA complex; HET: F6P EDT ADP; 2.10A {Homo sapiens} PDB: 2dwo_A* 2dwp_A* 2i1v_B* 3qpu_A* 3qpv_A* 3qpw_A* Back     alignment and structure
>2qp9_X Vacuolar protein sorting-associated protein 4; ATPase domain, beta domain, C-terminal helix, ATP-binding, E nucleotide-binding; 2.90A {Saccharomyces cerevisiae} PDB: 2qpa_A* Back     alignment and structure
>3l0i_B RAS-related protein RAB-1A; GEF-GDF-RAB complex, GTP-binding, guanine-nucleotide exchang GDI-displacement factor; 2.85A {Homo sapiens} Back     alignment and structure
>2x2e_A Dynamin-1; nitration, hydrolase, membrane fission, nucleotide-binding, endocytosis, motor protein; HET: GDP; 2.00A {Homo sapiens} PDB: 2x2f_A* 3zyc_A* 3zys_A Back     alignment and structure
>1lnz_A SPO0B-associated GTP-binding protein; GTPase, OBG, stringent factor, stress response, sporulation, large G-protein, structural genomics, PSI; HET: G4P; 2.60A {Bacillus subtilis} SCOP: b.117.1.1 c.37.1.8 Back     alignment and structure
>2xxa_A Signal recognition particle protein; protein transport, RNA/RNA binding protein, hydrolase, gtpas; HET: GCP; 3.94A {Escherichia coli} PDB: 2j28_9 Back     alignment and structure
>1bif_A 6-phosphofructo-2-kinase/ fructose-2,6-bisphospha; transferase (phospho), phosphatase, hydrolase (phosp glycolysis, bifunctional enzyme; HET: AGS; 2.00A {Rattus norvegicus} SCOP: c.37.1.7 c.60.1.4 PDB: 3bif_A* 2bif_A* 1k6m_A* 1c80_A* 1c7z_A* 1c81_A* 1tip_A* 1fbt_A Back     alignment and structure
>2iut_A DNA translocase FTSK; nucleotide-binding, chromosome partition, ATP-binding, DNA- cell division, DNA translocation, KOPS, membrane; HET: DNA SAP; 2.25A {Pseudomonas aeruginosa} PDB: 2iuu_A* Back     alignment and structure
>2gks_A Bifunctional SAT/APS kinase; transferase, sulfurylase; HET: ADP; 2.31A {Aquifex aeolicus} Back     alignment and structure
>3ec1_A YQEH GTPase; atnos1, atnoa1, trap, PVHL, hydrolase, signaling protein; HET: GDP; 2.36A {Geobacillus stearothermophilus} Back     alignment and structure
>2o8b_B DNA mismatch repair protein MSH6; DNA damage response, somatic hypermutat protein-DNA complex, DNA mispair, cancer; HET: DNA ADP; 2.75A {Homo sapiens} PDB: 2o8c_B* 2o8d_B* 2o8e_B* 2o8f_B* Back     alignment and structure
>4b4t_K 26S protease regulatory subunit 6B homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3nbx_X ATPase RAVA; AAA+ ATPase, alpha-beta-alpha structure, rossman fold, hydro; HET: ADP; 2.91A {Escherichia coli} Back     alignment and structure
>3pxg_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 3.65A {Bacillus subtilis} Back     alignment and structure
>1hqc_A RUVB; extended AAA-ATPase domain, complex with nucleotide, hydrolase; HET: ADE; 3.20A {Thermus thermophilus} SCOP: a.4.5.11 c.37.1.20 PDB: 1ixs_B* 1ixr_C* Back     alignment and structure
>1in4_A RUVB, holliday junction DNA helicase RUVB; AAA+-class ATPase, winged-helix domain, ATP hydrolysis, walker A, walker B, sensor 1, sensor 2; HET: ADP; 1.60A {Thermotoga maritima} SCOP: a.4.5.11 c.37.1.20 PDB: 1in5_A* 1in6_A* 1in8_A* 1in7_A* 1j7k_A* Back     alignment and structure
>3vfd_A Spastin; ATPase, microtubule severing, hydrolase; 3.30A {Homo sapiens} Back     alignment and structure
>4b4t_J 26S protease regulatory subunit 8 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2zan_A Vacuolar protein sorting-associating protein 4B; SKD1, VPS4B, AAA ATPase, ATP-binding, coiled coil, membrane, nucleotide-binding, phosphorylation; HET: ATP; 3.00A {Mus musculus} PDB: 2zam_A* 2zao_A* 2jqh_A 2jqk_A 1wr0_A 2jq9_A 2k3w_A 1yxr_A Back     alignment and structure
>2hjg_A GTP-binding protein ENGA; GTPase ENGA KH-domain, hydrolase; HET: GDP; 2.50A {Bacillus subtilis} Back     alignment and structure
>3l0o_A Transcription termination factor RHO; helicase, RHO factor, RNA capture mechanism, ATP-binding, hydrolase, nucleotide-binding, RN binding; 2.35A {Thermotoga maritima} Back     alignment and structure
>3h2y_A GTPase family protein; GTP-binding protein YQEH, possibly involved in replication initiation, csgid, IDP90222; HET: DGI; 1.80A {Bacillus anthracis str} Back     alignment and structure
>4b4t_L 26S protease subunit RPT4; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1p9r_A General secretion pathway protein E; bacterial type II secretion system cytoplasmic protein - GSPE, putative ATPase/ ATP binding protein; 2.50A {Vibrio cholerae} SCOP: c.37.1.11 PDB: 1p9w_A* Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>2j69_A Bacterial dynamin-like protein; FZO, FZL, GTPase, hydrolase; 3.0A {Nostoc punctiforme} PDB: 2j68_A 2w6d_A* Back     alignment and structure
>3o47_A ADP-ribosylation factor GTPase-activating protein ribosylation factor 1; structural genomics consortium, GTPase activation; HET: GDP; 2.80A {Homo sapiens} Back     alignment and structure
>4b4t_M 26S protease regulatory subunit 6A; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3dpu_A RAB family protein; roccor, G-domain, COR, GTP-binding, nucleotide-binding, SIGN protein; 2.90A {Chlorobaculum tepidum} Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Back     alignment and structure
>3gee_A MNME, tRNA modification GTPase MNME; G protein, cytoplasm, GTP- binding, hydrolase, magnesium, metal-binding, nucleotide- binding, potassium; HET: GDP FON; 2.95A {Chlorobium tepidum} PDB: 3gei_A* Back     alignment and structure
>1jr3_A DNA polymerase III subunit gamma; processivity, processivity clamp, clamp loader, AAA+ ATPase, transferase; HET: DNA; 2.70A {Escherichia coli} SCOP: a.80.1.1 c.37.1.20 PDB: 1xxh_B* 3glh_B* 3glf_B* 3gli_B* 3glg_B* 1xxi_B* Back     alignment and structure
>2fna_A Conserved hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE ADP; 2.00A {Sulfolobus solfataricus} SCOP: a.4.5.11 c.37.1.20 Back     alignment and structure
>1w5s_A Origin recognition complex subunit 2 ORC2; replication, CDC6, DNA replication initiation, DNA BIND protein, AAA+ ATPase; HET: ADP; 2.4A {Aeropyrum pernix} SCOP: a.4.5.11 c.37.1.20 PDB: 1w5t_A* Back     alignment and structure
>3hu3_A Transitional endoplasmic reticulum ATPase; VCP, transport protein; HET: AGS; 2.20A {Homo sapiens} PDB: 3hu2_A* 3hu1_A* 1e32_A* 1s3s_A* Back     alignment and structure
>1zp6_A Hypothetical protein ATU3015; alpha-beta protein., structural genomics, PSI, protein struc initiative; 3.20A {Agrobacterium tumefaciens str} SCOP: c.37.1.25 Back     alignment and structure
>1sxj_A Activator 1 95 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2c9o_A RUVB-like 1; hexameric helicase, AAA+-ATPase, ATP-binding, chromatin regulator, growth regulation, hydrolase, nuclear protein, DNA recombination; HET: ADP; 2.2A {Homo sapiens} PDB: 2xsz_A* Back     alignment and structure
>1iqp_A RFCS; clamp loader, extended AAA-ATPase domain, complex with ADP, replication; HET: ADP; 2.80A {Pyrococcus furiosus} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>2wkq_A NPH1-1, RAS-related C3 botulinum toxin substrate 1; transferase, cell adhesion, nucleotide-binding, protein engineering, RAS superfamily LOV2; HET: GTP FMN; 1.60A {Avena sativa} PDB: 2wkr_A* 2wkp_A* Back     alignment and structure
>4b4t_I 26S protease regulatory subunit 4 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3e1s_A Exodeoxyribonuclease V, subunit RECD; alpha and beta protein, ATP-binding, nucleotide-binding, HYD; 2.20A {Deinococcus radiodurans} PDB: 3gp8_A 3gpl_A* Back     alignment and structure
>3q5d_A Atlastin-1; G protein, GTPase, GDP/GTP binding, hydrolase; HET: GDP; 2.70A {Homo sapiens} PDB: 3q5e_A* 3qnu_A* 3qof_A* Back     alignment and structure
>4b4t_H 26S protease regulatory subunit 7 homolog; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>2a5y_B CED-4; apoptosis; HET: ATP; 2.60A {Caenorhabditis elegans} SCOP: a.4.5.80 a.77.1.3 c.37.1.20 PDB: 3lqq_A* 3lqr_A* Back     alignment and structure
>1g8p_A Magnesium-chelatase 38 kDa subunit; parallel beta sheet, P-loop, rossman fold, AAA+, photosynthesis, metal transport; 2.10A {Rhodobacter capsulatus} SCOP: c.37.1.20 PDB: 2x31_G Back     alignment and structure
>2chq_A Replication factor C small subunit; DNA-binding protein, DNA replication, clamp loader, AAA+ ATP ATP-binding, nucleotide-binding; HET: ANP; 3.5A {Archaeoglobus fulgidus} PDB: 2chv_A Back     alignment and structure
>1sxj_B Activator 1 37 kDa subunit; clamp loader, processivity clamp, DNA sliding clamp, AAA+ at polymerase, DNA-binding protein; HET: AGS ADP; 2.85A {Saccharomyces cerevisiae} SCOP: a.80.1.1 c.37.1.20 Back     alignment and structure
>1sq5_A Pantothenate kinase; P-loop, transferase; HET: PAU ADP; 2.20A {Escherichia coli} SCOP: c.37.1.6 PDB: 1esm_A* 1esn_A* Back     alignment and structure
>1z6t_A APAF-1, apoptotic protease activating factor 1; caspase activation, ADP, nucleotide binding, CARD, apoptosis; HET: ADP; 2.21A {Homo sapiens} Back     alignment and structure
>1e9r_A Conjugal transfer protein TRWB; coupling protein, bacterial conjugation, F1-ATPase-like quaternary structure, ring helicases; 2.4A {Escherichia coli} SCOP: c.37.1.11 PDB: 1e9s_A 1gki_A* 1gl7_A* 1gl6_A* Back     alignment and structure
>1of1_A Thymidine kinase; transferase, antiviral drug, enzyme- prodrug gene, DNA synthesis, ATP-binding; HET: SCT; 1.95A {Herpes simplex virus} SCOP: c.37.1.1 Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>4a9a_A Ribosome-interacting GTPase 1; DRG-DFRP complex, ribosome binding GTPase; 2.67A {Saccharomyces cerevisiae} Back     alignment and structure
>2ck3_D ATP synthase subunit beta\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1cow_D* 1bmf_D* 1e1q_D* 1e1r_D* 1efr_D* 1e79_D* 1h8h_D* 1ohh_D* 1qo1_D 1w0j_D* 1w0k_D* 1h8e_D* 2jdi_D* 2jiz_D* 2jj1_D* 2jj2_D* 2v7q_D* 2wss_D* 2w6j_D 2w6e_D ... Back     alignment and structure
>2x8a_A Nuclear valosin-containing protein-like; nuclear protein; 2.60A {Homo sapiens} Back     alignment and structure
>1xzp_A Probable tRNA modification GTPase TRME; GTP-binding, THF-binding, hydrolase; 2.30A {Thermotoga maritima} SCOP: a.24.25.1 c.37.1.8 d.250.1.2 PDB: 1xzq_A* 1xzp_B 1xzq_B* Back     alignment and structure
>3cmw_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 2.80A {Escherichia coli} PDB: 3cmt_A* 3cmx_A* 3cmv_A* Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>3izq_1 HBS1P, elongation factor 1 alpha-like protein; NO-GO mRNA decay, ribosomal protein,hydrolase; 9.50A {Saccharomyces cerevisiae} Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>3thx_B DNA mismatch repair protein MSH3; ABC family ATPase, mismatch recognition, mismatched unpaired DNA binding protein-DNA complex; HET: DNA ADP; 2.70A {Homo sapiens} PDB: 3thw_B* 3thy_B* 3thz_B* Back     alignment and structure
>4dcu_A GTP-binding protein ENGA; GTPase, GDP, protein binding, hydrolase; HET: GDP; 2.00A {Bacillus subtilis} PDB: 4dct_A* 4dcs_A* 4dcv_A* 2hjg_A* Back     alignment and structure
>1j3b_A ATP-dependent phosphoenolpyruvate carboxykinase; adenosine triphosphate, T thermophilus; 2.00A {Thermus thermophilus} SCOP: c.91.1.1 c.109.1.1 PDB: 1xkv_A* 2pc9_A* Back     alignment and structure
>3tr0_A Guanylate kinase, GMP kinase; purines, pyrimidines, nucleosides, nucleotides, transferase; HET: 5GP; 1.85A {Coxiella burnetii} Back     alignment and structure
>3upu_A ATP-dependent DNA helicase DDA; RECA-like domain, SH3 domain, PIN-tower interface, coupling hydrolysis to DNA unwinding, ssDNA; 3.30A {Enterobacteria phage T4} Back     alignment and structure
>3cmu_A Protein RECA, recombinase A; homologous recombination, recombination/DNA complex; HET: DNA ADP; 4.20A {Escherichia coli} Back     alignment and structure
>1ii2_A Phosphoenolpyruvate carboxykinase; phosphate binding loop, lyase; 2.00A {Trypanosoma cruzi} SCOP: c.91.1.1 c.109.1.1 Back     alignment and structure
>2olr_A Phosphoenolpyruvate carboxykinase; carbon dioxide, lyase; HET: ATP; 1.60A {Escherichia coli K12} SCOP: c.91.1.1 c.109.1.1 PDB: 1k3c_A* 1k3d_A* 1aq2_A* 2olq_A* 1os1_A* 2pxz_X* 1ayl_A* 2py7_X* 1oen_A 1ylh_A* 1ygg_A* Back     alignment and structure
>3te6_A Regulatory protein SIR3; heterochromatin, gene silencing, SIR complex, HMR, HML, TELO AAA+ domain, structural, nucleus, gene RE; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2cvh_A DNA repair and recombination protein RADB; filament formation, homologous recombination, ATPase domain, hyperthermophIle; HET: DNA; 2.20A {Thermococcus kodakarensis} PDB: 2cvf_A* Back     alignment and structure
>1qvr_A CLPB protein; coiled coil, AAA ATPase, chaperone; HET: ANP; 3.00A {Thermus thermophilus} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 Back     alignment and structure
>3f9v_A Minichromosome maintenance protein MCM; replicative helicase, DNA replication, MCM complex, AAA+ Pro ATP-binding, DNA-binding, helicase; 4.35A {Sulfolobus solfataricus} Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>1ytm_A Phosphoenolpyruvate carboxykinase [ATP], phosphoenolpyruvate; domain closure, nucleotide binding; HET: ATP; 2.20A {Anaerobiospirillum succiniciproducens} PDB: 1yvy_A Back     alignment and structure
>3p26_A Elongation factor 1 alpha-like protein; GTP/GDP binding domain, beta-barrel, translational GTPase, D structural genomics; 2.50A {Saccharomyces cerevisiae} PDB: 3p27_A* Back     alignment and structure
>2c61_A A-type ATP synthase non-catalytic subunit B; hydrolase, H+ ATPase, A1AO, ATP synthesis, hydrogen ION transport, ION transport; 1.5A {Methanosarcina mazei GO1} PDB: 3dsr_A* 3b2q_A* 2rkw_A* 3eiu_A* Back     alignment and structure
>3gqb_A V-type ATP synthase alpha chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_A* 3a5d_A 3j0j_A* 1um2_C Back     alignment and structure
>3u61_B DNA polymerase accessory protein 44; AAA+, ATP hydrolase, clamp loader, sliding clamp, primer-TEM DNA, DNA binding protein-DNA complex; HET: DNA ADP 08T; 3.20A {Enterobacteria phage T4} PDB: 3u5z_B* 3u60_B* Back     alignment and structure
>3vr4_A V-type sodium ATPase catalytic subunit A; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_A* 3vr2_A* 3vr5_A 3vr6_A* Back     alignment and structure
>1fx0_B ATP synthase beta chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_B* Back     alignment and structure
>1qhl_A Protein (cell division protein MUKB); SMC, chromosome partitioning; 2.20A {Escherichia coli} SCOP: c.37.1.12 Back     alignment and structure
>3pxi_A Negative regulator of genetic competence CLPC/MEC; CLPB, proteolysis, CLPX, HSP100/CLP, AAA+ proteins, PR binding; 6.93A {Bacillus subtilis} Back     alignment and structure
>3qq5_A Small GTP-binding protein; hydrogenase, H-cluster, HYDA maturation, GTP-binding domain, maturation enzyme, oxidoreductase; 2.99A {Thermotoga neapolitana} Back     alignment and structure
>1w36_D RECD, exodeoxyribonuclease V alpha chain; recombination, helicase, hydrolase, DNA repair; HET: DNA; 3.1A {Escherichia coli} SCOP: c.37.1.19 c.37.1.19 PDB: 3k70_D* Back     alignment and structure
>3mfy_A V-type ATP synthase alpha chain; A-type ATP synthase, P loop, phenylalanine mutant, hydrolase; 2.35A {Pyrococcus horikoshii} PDB: 3i4l_A* 3i72_A 3i73_A* 3p20_A 3ikj_A 3qg1_A 3nd8_A 3nd9_A 1vdz_A 3qia_A 3qjy_A 3m4y_A 3se0_A 3sdz_A Back     alignment and structure
>1r6b_X CLPA protein; AAA+, N-terminal domain, CLPS, crystal, binding mechanism, hydrolase; HET: ADP; 2.25A {Escherichia coli} SCOP: a.174.1.1 c.37.1.20 c.37.1.20 PDB: 1ksf_X* Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Back     alignment and structure
>3mca_A HBS1, elongation factor 1 alpha-like protein; protein protein complex, translation regulation; 2.74A {Schizosaccharomyces pombe} Back     alignment and structure
>1iy2_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 3.20A {Thermus thermophilus} SCOP: c.37.1.20 Back     alignment and structure
>4ido_A Atlastin-1; GTPase, GTP/GDP binding, hydrolase; HET: GDP; 2.09A {Homo sapiens} PDB: 4idn_A* 3q5d_A* 3q5e_A* 4idq_A* 4idp_A* 3qnu_A* 3qof_A* Back     alignment and structure
>2f1r_A Molybdopterin-guanine dinucleotide biosynthesis protein B (MOBB); structural genomics, PSI, protein structure initiative; 2.10A {Archaeoglobus fulgidus} Back     alignment and structure
>1udx_A The GTP-binding protein OBG; TGS domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.07A {Thermus thermophilus} SCOP: b.117.1.1 c.37.1.8 d.242.1.1 Back     alignment and structure
>3vr4_D V-type sodium ATPase subunit D; V-ATPase, rotary motor, P-loop, hydrolas ATPase, ATP binding; HET: MSE B3P; 2.17A {Enterococcus hirae} PDB: 3vr3_D* 3vr2_D* 3vr5_D 3vr6_D* Back     alignment and structure
>3gqb_B V-type ATP synthase beta chain; A3B3, V-ATPase, ATP synthesis, ATP-binding, hydrogen ION TRA hydrolase, ION transport; 2.80A {Thermus thermophilus HB8} PDB: 3a5c_D* 3a5d_D 3j0j_D* Back     alignment and structure
>1u0j_A DNA replication protein; AAA+ protein, P-loop atpases, helicase; HET: DNA ADP; 2.10A {Adeno-associated virus - 2} SCOP: c.37.1.20 PDB: 1s9h_A Back     alignment and structure
>2r9v_A ATP synthase subunit alpha; TM1612, structural genomics, JOI for structural genomics, JCSG, protein structure initiative ATP synthesis; HET: ATP PG4; 2.10A {Thermotoga maritima MSB8} Back     alignment and structure
>3zvr_A Dynamin-1; hydrolase, DRP1, DRP, endocytosis, mitochondrial fission, GT stalk, PH, BSE, membrane fission; HET: 1PE; 3.10A {Rattus norvegicus} PDB: 3snh_A Back     alignment and structure
>3cf2_A TER ATPase, transitional endoplasmic reticulum ATPase, valosi; AAA, CDC48, ERAD, transport protein; HET: ADP ANP; 3.50A {Mus musculus} PDB: 3cf1_A* 3cf3_A* 1r7r_A* Back     alignment and structure
>2qm8_A GTPase/ATPase; G protein, G3E, metallochaperone, chaperone; HET: MSE; 1.70A {Methylobacterium extorquens} SCOP: c.37.1.10 PDB: 2qm7_A* Back     alignment and structure
>1r5b_A Eukaryotic peptide chain release factor GTP-bindi subunit; translation termination, peptide release, GTPase, translatio; 2.35A {Schizosaccharomyces pombe} SCOP: b.43.3.1 b.44.1.1 c.37.1.8 PDB: 1r5n_A* 1r5o_A* 3e20_A Back     alignment and structure
>2qe7_A ATP synthase subunit alpha; blockage of ATP hydrolysis, F1-ATPase, single analysis, thermoalkaliphilic, hydrolase; 3.06A {Bacillus SP} PDB: 1sky_B Back     alignment and structure
>3vkw_A Replicase large subunit; alpha/beta domain, helicase, transferase; 1.90A {Tomato mosaic virus} Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>2ck3_A ATP synthase subunit alpha\, mitochondrial; hydrolase; HET: ANP ADP; 1.9A {Bos taurus} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1bmf_A* 1e1q_A* 1e1r_A* 1e79_A* 1h8h_A* 1nbm_A* 1ohh_A* 1qo1_A 1w0j_A* 1w0k_A* 1h8e_A* 2jdi_A* 2wss_A* 2w6j_A 2w6e_A 2w6g_A 2w6f_A 2w6h_A 2w6i_A 1cow_A* ... Back     alignment and structure
>1fx0_A ATP synthase alpha chain; latent ATPase, thermal stability, potential tentoxin binding hydrolase; 3.20A {Spinacia oleracea} SCOP: a.69.1.1 b.49.1.1 c.37.1.11 PDB: 1kmh_A* Back     alignment and structure
>1ixz_A ATP-dependent metalloprotease FTSH; AAA domain fold, hydrolase; 2.20A {Thermus thermophilus} SCOP: c.37.1.20 PDB: 1iy0_A* 1iy1_A* Back     alignment and structure
>1cip_A Protein (guanine nucleotide-binding protein alpha-1 subunit); GTPase, hydrolase; HET: GNP; 1.50A {Rattus norvegicus} SCOP: a.66.1.1 c.37.1.8 PDB: 1agr_A* 1bof_A* 1gdd_A* 1gfi_A* 1gia_A* 1gp2_A* 3ffa_A* 3ffb_A* 1gg2_A* 1git_A* 1svs_A* 1svk_A* 2zjz_A* 2zjy_A* 3ums_A* 2pz2_A* 2pz3_A* 1as0_A* 1as2_A* 1as3_A* ... Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3fwy_A Light-independent protochlorophyllide reductase I ATP-binding protein; BCHL, electron donor, DPOR, Fe protein, nitrogenase; HET: ADP; 1.63A {Rhodobacter sphaeroides 2} Back     alignment and structure
>3vqt_A RF-3, peptide chain release factor 3; translation, GTPase; HET: GDP; 1.80A {Desulfovibrio vulgaris} PDB: 3vr1_A* Back     alignment and structure
>3oaa_A ATP synthase subunit alpha; rossmann fold, hydrolase, hydrolase-transport PROT complex; HET: ANP ADP; 3.26A {Escherichia coli DH1} PDB: 2a7u_A Back     alignment and structure
>3avx_A Elongation factor TS, elongation factor TU, linke replicase; RNA polymerase, translation, transferase-RNA complex; HET: GH3; 2.41A {Escherichia coli O157} PDB: 3agq_A 3agp_A* 3avu_A 3avv_A 3avt_A* 3avw_A* 3avy_A* 3mmp_A* 3mmp_G* 1efu_B Back     alignment and structure
>4eun_A Thermoresistant glucokinase; putative sugar kinase, enzyme function initiative, EFI, STRU genomics, transferase; 1.60A {Janibacter SP} Back     alignment and structure
>4akg_A Glutathione S-transferase class-MU 26 kDa isozyme heavy chain cytoplasmic; motor protein, AAA+ protein, ASCE protein, P-loop ntpase; HET: ATP ADP; 3.30A {Schistosoma japonicum} PDB: 4ai6_A* 4akh_A* 4aki_A* 3qmz_A Back     alignment and structure
>3fkq_A NTRC-like two-domain protein; RER070207001320, structural GE joint center for structural genomics, JCSG, protein structu initiative, PSI-2; HET: ATP 2PE; 2.10A {Eubacterium rectale} Back     alignment and structure
>2oze_A ORF delta'; para, walker type atpases, DNA segregation, PSM19035, plasmid, DNA binding protein; HET: AGS EPE; 1.83A {Streptococcus pyogenes} Back     alignment and structure
>1lkx_A Myosin IE heavy chain; myosin motor domain, lever ARM, converter domain, contractIle protein; HET: ADP; 3.00A {Dictyostelium discoideum} SCOP: c.37.1.9 Back     alignment and structure
>2gk6_A Regulator of nonsense transcripts 1; UPF1, helicase, NMD, hydrolase; HET: ADP; 2.40A {Homo sapiens} PDB: 2gjk_A* 2gk7_A 2xzo_A* 2xzp_A Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* Back     alignment and structure
>1azs_C GS-alpha; complex (lyase/hydrolase), hydrolase, signal transducing protein, cyclase, effector enzyme; HET: GSP FKP; 2.30A {Bos taurus} SCOP: a.66.1.1 c.37.1.8 PDB: 1azt_A* 3c14_C* 3c15_C* 3c16_C* 1cjt_C* 1cjk_C* 1cju_C* 1cjv_C* 1tl7_C* 1cs4_C* 1u0h_C* 2gvd_C* 2gvz_C* 3e8a_C* 3g82_C* 3maa_C* 1cul_C* 3sn6_A* Back     alignment and structure
>2kjq_A DNAA-related protein; solution structure, NESG, structural genomics, PSI-2, protei structure initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 286
d1r0wa_ 281 c.37.1.12 (A:) Cystic fibrosis transmembrane condu 5e-12
d1sgwa_ 200 c.37.1.12 (A:) Putative ABC transporter PF0895 {Py 1e-11
d1l7vc_ 231 c.37.1.12 (C:) ABC transporter involved in vitamin 1e-11
d1l7vc_231 c.37.1.12 (C:) ABC transporter involved in vitamin 0.002
d1mv5a_ 242 c.37.1.12 (A:) Multidrug resistance ABC transporte 2e-11
d1b0ua_ 258 c.37.1.12 (A:) ATP-binding subunit of the histidin 3e-11
d1vpla_ 238 c.37.1.12 (A:) Putative ABC transporter TM0544 {Th 4e-11
d2awna2 232 c.37.1.12 (A:4-235) Maltose transport protein MalK 4e-11
d1g6ha_ 254 c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jann 4e-11
d1g6ha_254 c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jann 0.002
d1v43a3 239 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N 7e-11
d2hyda1 255 c.37.1.12 (A:324-578) Putative multidrug export AT 7e-11
d1g2912 240 c.37.1.12 (1:1-240) Maltose transport protein MalK 7e-11
d1ji0a_ 240 c.37.1.12 (A:) Branched chain aminoacid ABC transp 8e-11
d1oxxk2 242 c.37.1.12 (K:1-242) Glucose transport protein GlcV 2e-10
d1jj7a_ 251 c.37.1.12 (A:) Peptide transporter Tap1, C-termina 2e-10
d2pmka1 241 c.37.1.12 (A:467-707) Haemolysin B ATP-binding pro 2e-10
d3b60a1 253 c.37.1.12 (A:329-581) Multidrug resistance ABC tra 2e-10
d3d31a2 229 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transpor 2e-10
d1l2ta_ 230 c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jann 4e-09
d3dhwc1 240 c.37.1.12 (C:1-240) Methionine import ATP-binding 1e-08
d2onka1 240 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP 2e-07
d1ye8a1 178 c.37.1.11 (A:1-178) Hypothetical kinase-like prote 3e-06
g1f2t.1 292 c.37.1.12 (A:,B:) Rad50 {Archaeon Pyrococcus furio 6e-05
d1zp6a1 176 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 { 2e-04
d1znwa1 182 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacteriu 7e-04
d1qhxa_ 178 c.37.1.3 (A:) Chloramphenicol phosphotransferase { 9e-04
d1s96a_ 205 c.37.1.1 (A:) Guanylate kinase {Escherichia coli [ 0.002
d1egaa1 179 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain { 0.004
d1nrjb_ 209 c.37.1.8 (B:) Signal recognition particle receptor 0.004
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 281 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain
species: Mouse (Mus musculus) [TaxId: 10090]
 Score = 62.6 bits (152), Expect = 5e-12
 Identities = 12/40 (30%), Positives = 24/40 (60%)

Query: 239 FLNKEILHGISGEFKAGQLTAIMGPSGAGKSTLLNILAGL 278
            +   +L  I+   + G++ AI G +G+GK++LL ++ G 
Sbjct: 46  LVGNPVLKNINLNIEKGEMLAITGSTGSGKTSLLMLILGE 85


>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Length = 200 Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Length = 231 Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Length = 231 Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Length = 242 Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Length = 258 Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Length = 238 Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 232 Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 254 Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 254 Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Length = 239 Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Length = 255 Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Length = 240 Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Length = 240 Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 242 Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Length = 251 Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Length = 241 Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Length = 253 Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Length = 229 Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 230 Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Length = 240 Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Length = 240 Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Length = 178 Back     information, alignment and structure
>d1zp6a1 c.37.1.25 (A:6-181) Hypothetical protein Atu3015 {Agrobacterium tumefaciens [TaxId: 358]} Length = 176 Back     information, alignment and structure
>d1znwa1 c.37.1.1 (A:20-201) Guanylate kinase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 182 Back     information, alignment and structure
>d1qhxa_ c.37.1.3 (A:) Chloramphenicol phosphotransferase {Streptomyces venezuelae [TaxId: 54571]} Length = 178 Back     information, alignment and structure
>d1s96a_ c.37.1.1 (A:) Guanylate kinase {Escherichia coli [TaxId: 562]} Length = 205 Back     information, alignment and structure
>d1egaa1 c.37.1.8 (A:4-182) GTPase Era, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 179 Back     information, alignment and structure
>d1nrjb_ c.37.1.8 (B:) Signal recognition particle receptor beta-subunit {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 209 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query286
d1v43a3239 Hypothetical protein PH0022, N-terminal domain {Py 99.98
d1oxxk2242 Glucose transport protein GlcV, N-terminal domain 99.98
d2awna2232 Maltose transport protein MalK, N-terminal domain 99.97
d1g2912240 Maltose transport protein MalK, N-terminal domain 99.97
d3dhwc1240 Methionine import ATP-binding protein MetN {Escher 99.97
d2onka1240 Molybdate/tungstate import ATP-binding protein Wtp 99.97
d3d31a2229 Sulfate/molybdate ABC transporter, ATP-binding pro 99.97
d1l2ta_230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 99.97
d1b0ua_258 ATP-binding subunit of the histidine permease {Sal 99.96
d1ji0a_240 Branched chain aminoacid ABC transporter {Thermoto 99.95
d1vpla_238 Putative ABC transporter TM0544 {Thermotoga mariti 99.95
d1g6ha_254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 99.95
d2pmka1241 Haemolysin B ATP-binding protein {Escherichia coli 99.94
d1jj7a_251 Peptide transporter Tap1, C-terminal ABC domain {H 99.94
d1mv5a_242 Multidrug resistance ABC transporter LmrA, C-termi 99.94
d2hyda1255 Putative multidrug export ATP-binding/permease pro 99.93
d3b60a1253 Multidrug resistance ABC transporter MsbA, C-termi 99.93
d1l7vc_231 ABC transporter involved in vitamin B12 uptake, Bt 99.9
d1r0wa_281 Cystic fibrosis transmembrane conductance regulato 99.83
d1sgwa_200 Putative ABC transporter PF0895 {Pyrococcus furios 99.76
d1v43a3 239 Hypothetical protein PH0022, N-terminal domain {Py 99.53
d1ji0a_ 240 Branched chain aminoacid ABC transporter {Thermoto 99.52
d1g2912 240 Maltose transport protein MalK, N-terminal domain 99.51
d1g6ha_ 254 MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 99.49
d1l2ta_ 230 MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 99.47
d3dhwc1 240 Methionine import ATP-binding protein MetN {Escher 99.47
d1jj7a_ 251 Peptide transporter Tap1, C-terminal ABC domain {H 99.46
d1r0wa_ 281 Cystic fibrosis transmembrane conductance regulato 99.46
d1oxxk2 242 Glucose transport protein GlcV, N-terminal domain 99.44
d3b60a1 253 Multidrug resistance ABC transporter MsbA, C-termi 99.43
d2pmka1 241 Haemolysin B ATP-binding protein {Escherichia coli 99.42
d2hyda1 255 Putative multidrug export ATP-binding/permease pro 99.38
g1f2t.1292 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 98.26
g1ii8.1369 Rad50 {Archaeon Pyrococcus furiosus [TaxId: 2261]} 97.56
d1u0la2225 Probable GTPase EngC (YjeQ), C-terminal domain {Th 97.36
d1wb9a2 234 DNA repair protein MutS, the C-terminal domain {Es 97.3
d1ewqa2 224 DNA repair protein MutS, the C-terminal domain {Th 97.18
d1gvnb_ 273 Plasmid maintenance system epsilon/zeta, toxin zet 97.11
d1t9ha2 231 Probable GTPase EngC (YjeQ), C-terminal domain {Ba 97.05
d1g6oa_ 323 Hexameric traffic ATPase, HP0525 {Helicobacter pyl 96.78
d1szpa2 251 DNA repair protein Rad51, catalytic domain {Baker' 96.68
d1sq5a_ 308 Pantothenate kinase PanK {Escherichia coli [TaxId: 96.67
d1iqpa2 231 Replication factor C {Archaeon Pyrococcus furiosus 96.58
d1v5wa_ 258 Meiotic recombination protein DMC1/LIM15 homolog { 96.57
d2i1qa2 258 DNA repair protein Rad51, catalytic domain {Archae 96.57
d1htwa_158 Hypothetical protein HI0065 {Haemophilus influenza 96.56
d1pzna2 254 DNA repair protein Rad51, catalytic domain {Archae 96.55
d1cr2a_ 277 Gene 4 protein (g4p, DNA primase), helicase domain 96.52
d1h65a_ 257 Chloroplast protein translocon GTPase Toc34 {Garde 96.51
d1sxja2 253 Replication factor C1 {Baker's yeast (Saccharomyce 96.38
d1ofha_ 309 HslU {Haemophilus influenzae [TaxId: 727]} 96.33
d2p67a1 327 LAO/AO transport system kinase ArgK {Escherichia c 96.32
d1w1wa_427 Smc head domain {Baker's yeast (Saccharomyces cere 96.31
d1sxjd2 237 Replication factor C2 {Baker's yeast (Saccharomyce 96.3
d2fnaa2 283 Archaeal ATPase SSO1545 {Sulfolobus solfataricus [ 96.28
d1in4a2 238 Holliday junction helicase RuvB {Thermotoga mariti 96.23
d1ixsb2 239 Holliday junction helicase RuvB {Thermus thermophi 96.18
d1u94a1 263 RecA protein, ATPase-domain {Escherichia coli [Tax 96.0
d1sxje2 252 Replication factor C5 {Baker's yeast (Saccharomyce 95.99
d1g41a_ 443 HslU {Haemophilus influenzae [TaxId: 727]} 95.96
d1tq4a_ 400 Interferon-inducible GTPase {Mouse (Mus musculus) 95.95
d1nlfa_ 274 Hexameric replicative helicase repA {Escherichia c 95.91
d1r7ra3 265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 95.83
d1sxjb2 224 Replication factor C4 {Baker's yeast (Saccharomyce 95.81
d1d2na_ 246 Hexamerization domain of N-ethylmalemide-sensitive 95.78
d1lv7a_ 256 AAA domain of cell division protein FtsH {Escheric 95.74
d1sxjc2 227 Replication factor C3 {Baker's yeast (Saccharomyce 95.62
d1ixza_ 247 AAA domain of cell division protein FtsH {Thermus 95.48
d2qm8a1 323 Metallochaperone MeaB {Methylobacterium extorquens 95.46
d1fnna2 276 CDC6, N-domain {Archaeon Pyrobaculum aerophilum [T 95.41
d1mo6a1 269 RecA protein, ATPase-domain {Mycobacterium tubercu 95.38
d1f5na2 277 Interferon-induced guanylate-binding protein 1 (GB 95.15
d1xp8a1 268 RecA protein, ATPase-domain {Deinococcus radiodura 95.13
d1xpua3 289 Transcription termination factor Rho, ATPase domai 95.13
d1e32a2 258 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 95.06
d1svma_ 362 Papillomavirus large T antigen helicase domain {Si 94.83
d2a5yb3 277 CED-4, NB-ARC domain {Caenorhabditis elegans [TaxI 94.8
d1r6bx3 315 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 94.78
d1p9ra_ 401 Extracellular secretion NTPase EpsE {Vibrio choler 94.61
d1njfa_ 239 delta prime subunit of DNA polymerase III, N-domai 94.34
d1w5sa2 287 CDC6-like protein APE0152, N-terminal domain {Aero 94.27
d1um8a_ 364 ClpX {Helicobacter pylori [TaxId: 210]} 93.52
d1e9ra_ 433 Bacterial conjugative coupling protein TrwB {Esche 93.51
d1w44a_ 321 NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} 93.46
d1qvra3 315 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 93.07
d1e69a_308 Smc head domain {Thermotoga maritima [TaxId: 2336] 92.9
d2jdid3 276 Central domain of beta subunit of F1 ATP synthase 92.81
d1jbka_ 195 ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} 92.44
d1l8qa2 213 Chromosomal replication initiation factor DnaA {Aq 92.0
d1r6bx2 268 ClpA, an Hsp100 chaperone, AAA+ modules {Escherich 91.84
d1fx0a3 276 Central domain of alpha subunit of F1 ATP synthase 89.97
d1u0ja_ 267 Rep 40 protein helicase domain {Adeno-associated v 87.8
d2jdia3 285 Central domain of alpha subunit of F1 ATP synthase 87.28
d1qvra2 387 ClpB, AAA+ modules {Thermus thermophilus [TaxId: 2 86.96
d1w36d1 359 Exodeoxyribonuclease V alpha chain (RecD) {Escheri 85.62
d1puja_ 273 Probable GTPase YlqF {Bacillus subtilis [TaxId: 14 85.4
d1tuea_ 205 Replication protein E1 helicase domain {Human papi 84.8
d1lkxa_ 684 Myosin S1, motor domain {Dictyostelium discoideum, 84.5
d1gkub1 237 Helicase-like "domain" of reverse gyrase {Archaeon 83.79
d1d0xa2 712 Myosin S1, motor domain {Dictyostelium discoideum 82.86
d2p6ra3 202 Hel308 helicase {Archaeoglobus fulgidus [TaxId: 22 82.54
d1br2a2 710 Myosin S1, motor domain {Chicken (Gallus gallus), 82.1
d1ye8a1178 Hypothetical kinase-like protein Aq_1292 {Aquifex 82.09
d2mysa2 794 Myosin S1, motor domain {Chicken (Gallus gallus), 80.27
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: ABC transporter ATPase domain-like
domain: Hypothetical protein PH0022, N-terminal domain
species: Pyrococcus horikoshii [TaxId: 53953]
Probab=99.98  E-value=6.2e-33  Score=229.04  Aligned_cols=149  Identities=15%  Similarity=0.175  Sum_probs=124.9

Q ss_pred             Cchhhhh-cCCCCCCceeEEEECCeecCchhhhcccceeeEEecCcccCCCCCHHHHHHHHHhcCCCCCCCHHHHHHHHh
Q psy8953           1 MSIELNV-QSIRLTGSSGKILVNGQERKSACIEQFLKLSCYIQQDDALRPKLTVTEAMMIASHLKLGFKVSTQEKKDQVS   79 (286)
Q Consensus         1 ~stll~~-~g~~~~~~~G~i~~~g~~~~~~~~~~~~~~~g~v~Q~~~~~~~~tV~e~l~f~~~~~~~~~~~~~~~~~~v~   79 (286)
                      ||||+++ +|+... .+|+|++||+++...  ...++.+|||||++.+|+++||+|+++|++++   .+.+++++++++.
T Consensus        45 KSTLl~~i~Gl~~p-~sG~I~i~g~~i~~~--~~~~r~ig~v~Q~~~l~~~ltv~enl~~~~~~---~~~~~~~~~~~~~  118 (239)
T d1v43a3          45 KTTTLRMIAGLEEP-TEGRIYFGDRDVTYL--PPKDRNISMVFQSYAVWPHMTVYENIAFPLKI---KKFPKDEIDKRVR  118 (239)
T ss_dssp             HHHHHHHHHTSSCC-SEEEEEETTEECTTS--CGGGGTEEEEEC------CCCHHHHHHTTCC-----CCCHHHHHHHHH
T ss_pred             HHHHHHHHHcCCCC-CCCEEEEcceecccC--CcccceEEEEeechhhcccchHHHHHHHHHHH---cCCCHHHHHHHHH
Confidence            8999999 997544 799999999999764  23457899999999999999999999999986   4578899888877


Q ss_pred             -------hh-----hhhcccCCccc-------------------cCCCcchHHHHHHHHHHHHHHhC-CCEEEEEEcCCC
Q psy8953          80 -------LE-----LWNNFCKKKKK-------------------KKRGLDSSSCSQCVSLLANLAKQ-GRTVVATIHTPS  127 (286)
Q Consensus        80 -------l~-----~~~~~~gG~kq-------------------ptsgLD~~~~~~~~~~l~~l~~~-g~tii~~~h~~~  127 (286)
                             |+     .++.+||||||                   ||++|||.++.+++++|++++++ |+|+|+++|+++
T Consensus       119 ~~l~~~~l~~~~~~~~~~LSGGq~QRvaiAraL~~~P~iLllDEPts~LD~~~~~~i~~ll~~l~~~~g~tii~vTHd~~  198 (239)
T d1v43a3         119 WAAELLQIEELLNRYPAQLSGGQRQRVAVARAIVVEPDVLLMDEPLSNLDAKLRVAMRAEIKKLQQKLKVTTIYVTHDQV  198 (239)
T ss_dssp             HHHHHTTCGGGTTSCTTTCCSSCHHHHHHHHHHTTCCSEEEEESTTTTSCHHHHHHHHHHHHHHHHHHTCEEEEEESCHH
T ss_pred             HHHHHcCChhhhcCChhhCCHHHHHHHHHHhhhccCCCceeecCCcccCCHHHHHHHHHHHHHHHHhcCCeEEEEeCCHH
Confidence                   22     56779999999                   99999999999999999999876 999999999996


Q ss_pred             HHHHHHhhhHhhhcCCeeecccChhcHHH
Q psy8953         128 ALLFEKFDSLYALAKGHCIYRGSISRLVP  156 (286)
Q Consensus       128 ~~~~~~~d~v~~l~~G~i~~~g~~~~~~~  156 (286)
                       ++..+|||+++|++|+|+..|++++++.
T Consensus       199 -~a~~~~dri~vm~~G~iv~~G~~~el~~  226 (239)
T d1v43a3         199 -EAMTMGDRIAVMNRGQLLQIGSPTEVYL  226 (239)
T ss_dssp             -HHHHHCSEEEEEETTEEEEEECHHHHHH
T ss_pred             -HHHHhCCEEEEEECCEEEEEcCHHHHHh
Confidence             4778999999999999999999999864



>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d2awna2 c.37.1.12 (A:4-235) Maltose transport protein MalK, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2onka1 c.37.1.12 (A:1-240) Molybdate/tungstate import ATP-binding protein WtpC (ModC) {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d3d31a2 c.37.1.12 (A:1-229) Sulfate/molybdate ABC transporter, ATP-binding protein {Methanosarcina acetivorans [TaxId: 2214]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1b0ua_ c.37.1.12 (A:) ATP-binding subunit of the histidine permease {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1vpla_ c.37.1.12 (A:) Putative ABC transporter TM0544 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mv5a_ c.37.1.12 (A:) Multidrug resistance ABC transporter LmrA, C-terminal domain {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1l7vc_ c.37.1.12 (C:) ABC transporter involved in vitamin B12 uptake, BtuD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sgwa_ c.37.1.12 (A:) Putative ABC transporter PF0895 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1v43a3 c.37.1.12 (A:7-245) Hypothetical protein PH0022, N-terminal domain {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1ji0a_ c.37.1.12 (A:) Branched chain aminoacid ABC transporter {Thermotoga maritima, TM1139 [TaxId: 2336]} Back     information, alignment and structure
>d1g2912 c.37.1.12 (1:1-240) Maltose transport protein MalK, N-terminal domain {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1g6ha_ c.37.1.12 (A:) MJ1267 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1l2ta_ c.37.1.12 (A:) MJ0796 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d3dhwc1 c.37.1.12 (C:1-240) Methionine import ATP-binding protein MetN {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jj7a_ c.37.1.12 (A:) Peptide transporter Tap1, C-terminal ABC domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r0wa_ c.37.1.12 (A:) Cystic fibrosis transmembrane conductance regulator, CFTR, nucleotide-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1oxxk2 c.37.1.12 (K:1-242) Glucose transport protein GlcV, N-terminal domain {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d3b60a1 c.37.1.12 (A:329-581) Multidrug resistance ABC transporter MsbA, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2pmka1 c.37.1.12 (A:467-707) Haemolysin B ATP-binding protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hyda1 c.37.1.12 (A:324-578) Putative multidrug export ATP-binding/permease protein SAV1866 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1u0la2 c.37.1.8 (A:69-293) Probable GTPase EngC (YjeQ), C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1wb9a2 c.37.1.12 (A:567-800) DNA repair protein MutS, the C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ewqa2 c.37.1.12 (A:542-765) DNA repair protein MutS, the C-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1t9ha2 c.37.1.8 (A:68-298) Probable GTPase EngC (YjeQ), C-terminal domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1g6oa_ c.37.1.11 (A:) Hexameric traffic ATPase, HP0525 {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1szpa2 c.37.1.11 (A:145-395) DNA repair protein Rad51, catalytic domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sq5a_ c.37.1.6 (A:) Pantothenate kinase PanK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1iqpa2 c.37.1.20 (A:2-232) Replication factor C {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1v5wa_ c.37.1.11 (A:) Meiotic recombination protein DMC1/LIM15 homolog {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2i1qa2 c.37.1.11 (A:65-322) DNA repair protein Rad51, catalytic domain {Archaeon Methanococcus voltae [TaxId: 2188]} Back     information, alignment and structure
>d1htwa_ c.37.1.18 (A:) Hypothetical protein HI0065 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1pzna2 c.37.1.11 (A:96-349) DNA repair protein Rad51, catalytic domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1cr2a_ c.37.1.11 (A:) Gene 4 protein (g4p, DNA primase), helicase domain {Bacteriophage T7 [TaxId: 10760]} Back     information, alignment and structure
>d1h65a_ c.37.1.8 (A:) Chloroplast protein translocon GTPase Toc34 {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1sxja2 c.37.1.20 (A:295-547) Replication factor C1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ofha_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2p67a1 c.37.1.10 (A:1-327) LAO/AO transport system kinase ArgK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w1wa_ c.37.1.12 (A:) Smc head domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sxjd2 c.37.1.20 (D:26-262) Replication factor C2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fnaa2 c.37.1.20 (A:1-283) Archaeal ATPase SSO1545 {Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1in4a2 c.37.1.20 (A:17-254) Holliday junction helicase RuvB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ixsb2 c.37.1.20 (B:4-242) Holliday junction helicase RuvB {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1u94a1 c.37.1.11 (A:6-268) RecA protein, ATPase-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxje2 c.37.1.20 (E:4-255) Replication factor C5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g41a_ c.37.1.20 (A:) HslU {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1tq4a_ c.37.1.8 (A:) Interferon-inducible GTPase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nlfa_ c.37.1.11 (A:) Hexameric replicative helicase repA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1sxjb2 c.37.1.20 (B:7-230) Replication factor C4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1d2na_ c.37.1.20 (A:) Hexamerization domain of N-ethylmalemide-sensitive fusion (NSF) protein {Chinese hamster (Cricetulus griseus) [TaxId: 10029]} Back     information, alignment and structure
>d1lv7a_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sxjc2 c.37.1.20 (C:12-238) Replication factor C3 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ixza_ c.37.1.20 (A:) AAA domain of cell division protein FtsH {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2qm8a1 c.37.1.10 (A:5-327) Metallochaperone MeaB {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1fnna2 c.37.1.20 (A:1-276) CDC6, N-domain {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Back     information, alignment and structure
>d1mo6a1 c.37.1.11 (A:1-269) RecA protein, ATPase-domain {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1f5na2 c.37.1.8 (A:7-283) Interferon-induced guanylate-binding protein 1 (GBP1), N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xp8a1 c.37.1.11 (A:15-282) RecA protein, ATPase-domain {Deinococcus radiodurans [TaxId: 1299]} Back     information, alignment and structure
>d1xpua3 c.37.1.11 (A:129-417) Transcription termination factor Rho, ATPase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1e32a2 c.37.1.20 (A:201-458) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1svma_ c.37.1.20 (A:) Papillomavirus large T antigen helicase domain {Simian virus 40 [TaxId: 10633]} Back     information, alignment and structure
>d2a5yb3 c.37.1.20 (B:109-385) CED-4, NB-ARC domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1r6bx3 c.37.1.20 (X:437-751) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1njfa_ c.37.1.20 (A:) delta prime subunit of DNA polymerase III, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1um8a_ c.37.1.20 (A:) ClpX {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1e9ra_ c.37.1.11 (A:) Bacterial conjugative coupling protein TrwB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w44a_ c.37.1.11 (A:) NTPase P4 {Bacteriophage phi-12 [TaxId: 161736]} Back     information, alignment and structure
>d1qvra3 c.37.1.20 (A:536-850) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e69a_ c.37.1.12 (A:) Smc head domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2jdid3 c.37.1.11 (D:82-357) Central domain of beta subunit of F1 ATP synthase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1jbka_ c.37.1.20 (A:) ClpB, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1r6bx2 c.37.1.20 (X:169-436) ClpA, an Hsp100 chaperone, AAA+ modules {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fx0a3 c.37.1.11 (A:97-372) Central domain of alpha subunit of F1 ATP synthase {Spinach (Spinacia oleracea), chloroplast [TaxId: 3562]} Back     information, alignment and structure
>d1u0ja_ c.37.1.20 (A:) Rep 40 protein helicase domain {Adeno-associated virus 2, AAV2 [TaxId: 10804]} Back     information, alignment and structure
>d2jdia3 c.37.1.11 (A:95-379) Central domain of alpha subunit of F1 ATP synthase {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1qvra2 c.37.1.20 (A:149-535) ClpB, AAA+ modules {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1w36d1 c.37.1.19 (D:2-360) Exodeoxyribonuclease V alpha chain (RecD) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1puja_ c.37.1.8 (A:) Probable GTPase YlqF {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1tuea_ c.37.1.20 (A:) Replication protein E1 helicase domain {Human papillomavirus type 18 [TaxId: 333761]} Back     information, alignment and structure
>d1lkxa_ c.37.1.9 (A:) Myosin S1, motor domain {Dictyostelium discoideum, class-I myosin MyoE [TaxId: 44689]} Back     information, alignment and structure
>d1gkub1 c.37.1.16 (B:1-250) Helicase-like "domain" of reverse gyrase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1d0xa2 c.37.1.9 (A:2-33,A:80-759) Myosin S1, motor domain {Dictyostelium discoideum [TaxId: 44689]} Back     information, alignment and structure
>d2p6ra3 c.37.1.19 (A:1-202) Hel308 helicase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1br2a2 c.37.1.9 (A:80-789) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure
>d1ye8a1 c.37.1.11 (A:1-178) Hypothetical kinase-like protein Aq_1292 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2mysa2 c.37.1.9 (A:4-33,A:80-843) Myosin S1, motor domain {Chicken (Gallus gallus), pectoral muscle [TaxId: 9031]} Back     information, alignment and structure