Psyllid ID: psy904


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590------
MDVDSETESNHDTALTLACAGGHEELVELLLSRGADIEHRDKKGFTPLILAATAGHDKVVDILLNHKADMEAQSERTKDTPLSLACSGGRYEVVELLLTRGANKEHRNVSDYTPLSLAASGGYVNIIKLLLTHGAEINSRTGSKLGISPLMLAAMNGHTAAVKLLLDMGSDINAQIETNRNTALTLACFQGRHEVVSLLLDRKANVEHRAKTGLTPLMEAASGGYVEVGRVLLDKGADVNAPPVPSSRDTALTIAADKGHCRFVELLLSKGAQVEVKNKKGNSPLWLAANGGHLSVVELLCKHGADIDSQDNRKVSCLMAAFRKGHVKAVRWMVNHVAQFPSDQEMTRYIQTVNDKELLDKCQECSMVIRVAKNQQAERANKNANILLEELDMEKWREESKRAAQARKRERKKQKKLEKKEEKRKAMEEEEEVIRVAKNQQAERANKNANILLEELDMEKWREESKRAAQARKRERKKQKKLEKKEEKRKAMEEEEEEEEEVEVQEVEGEMMEEETEENDMHSSGGGRGEGEEGDSGIDANSQASCSSNEVKTAAPNSRRKDKKKKKLDMRWFPCYWTGRPMWSIEPSQCLTIANN
ccccccccccccHHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHHccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHccHHHHHHHHHHcccccccccccccccHHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccHHHHHHHccccHHHHHHHHHHHHHHccHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHcHHHHHHHHHHccHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
cccccccccccccHHHHHHHHccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccccHHHHHHHcccHHHHHHHHHcccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccccccHHHHHHHHccHHHHHHHHHccccccccccccccHHHHHHHHccHHHHHHHHHHcccccccccccccHHHHHHHHccHHHHHHHHHcccccccccccccccccHHHHHHHcccHHHHHHHHHccccccccccccHHHHHHcccHHHHHHHHHccccccccccccccHHHHHHHcccccEEEEEEEcccccccccccccHHHHHHHcccccEEEEEccccccccccccccccccccccccccEEEHHHccccccccccccccccccccccccccHHccccHHHHccccccccccccccccccccccccHHHHHHHcccccccccccccccccccccccccccEEcccc
mdvdsetesnhdTALTLACAGGHEELVELLLSRgadiehrdkkgftpLILAATAGHDKVVDILLNHKAdmeaqsertkdtplslacsggRYEVVELLLTrgankehrnvsdytplslaasGGYVNIIKLLLTHGaeinsrtgsklgiSPLMLAAMNGHTAAVKLLLDMGSDINAQIETNRNTALTLACFQGRHEVVSLLLDRKANVEHRaktgltplmeaasggyVEVGRVLLdkgadvnappvpssrdtaLTIAADKGHCRFVELLLSkgaqvevknkkgnsplwlaanggHLSVVELLCKhgadidsqdnrKVSCLMAAFRKGHVKAVRWMVNHvaqfpsdqeMTRYIQTVNDKELLDKCQECSMVIRVAKNQQAERANKNANILLEELDMEKWREESKRAAQARKRERKKQKKLEKKEEKRKAMEEEEEVIRVAKNQQAERANKNANILLEELDMEKWREESKRAAQARKRERKKQKKLEKKEEKRKAMEEEEEEEEEVEVQEVEgemmeeeteendmhssgggrgegeegdsgidansqascssnevktaapnsrrkdkkkkkldmrwfpcywtgrpmwsiepsqcltiann
mdvdsetesnhdtALTLACAGGHEELVELLLSRGADIEHRDKKGFTPLILAATAGHDKVVDILLNHKADmeaqsertkdtplslacsGGRYEVVELLLTrgankehrnvsdytplsLAASGGYVNIIKLLLTHGAEINSRTGSKLGISPLMLAAMNGHTAAVKLLLDMGSDINAQIETNRNTALTLACFQGRHEVVSLLLDRKANVEHRaktgltplmeaasGGYVEVGRVLLDKGadvnappvpssRDTALTIAADKGHCRFVELLLSKGAQVEVKNKKGNSPLWLAANGGHLSVVELLCKHGADIDSQDNRKVSCLMAAFRKGHVKAVRWMVNHVaqfpsdqemtRYIQTVNDKELLDKCQECSMVIRVaknqqaerankNANIlleeldmekwREESKRAAqarkrerkkqkklekkeekrkameeeeevirvaknqqaeranknanilleeldmekwREESKRAAqarkrerkkqkklekkeekrkameeeeeeeeevevqevegemmeeeteendmhssggGRGEGEEGDSGIDAnsqascssnevktaapnsrrkdkkkkkldmrwfpcywtgrpmwsiepsqcltiann
MDVDSETESNHDTALTLACAGGHEELVELLLSRGADIEHRDKKGFTPLILAATAGHDKVVDILLNHKADMEAQSERTKDTPLSLACSGGRYEVVELLLTRGANKEHRNVSDYTPLSLAASGGYVNIIKLLLTHGAEINSRTGSKLGISPLMLAAMNGHTAAVKLLLDMGSDINAQIETNRNTALTLACFQGRHEVVSLLLDRKANVEHRAKTGLTPLMEAASGGYVEVGRVLLDKGADVNAPPVPSSRDTALTIAADKGHCRFVELLLSKGAQVEVKNKKGNSPLWLAANGGHLSVVELLCKHGADIDSQDNRKVSCLMAAFRKGHVKAVRWMVNHVAQFPSDQEMTRYIQTVNDKELLDKCQECSMVIRVAKNQQAERANKNANILLEELDMEKWreeskraaqarkrerkkqkklekkeekrkameeeeevirvakNQQAERANKNANILLEELDMEKWreeskraaqarkrerkkqkklekkeekrkameeeeeeeeevevqevegemmeeeteeNDMHssgggrgegeegdsgIDANSQASCSSNEVKTAAPNSRRkdkkkkkLDMRWFPCYWTGRPMWSIEPSQCLTIANN
*************ALTLACAGGHEELVELLLSRGADIEHRDKKGFTPLILAATAGHDKVVDILLNH****************SLACSGGRYEVVELLLTRGANKEHRNVSDYTPLSLAASGGYVNIIKLLLTHGAEINSRTGSKLGISPLMLAAMNGHTAAVKLLLDMGSDINAQIETNRNTALTLACFQGRHEVVSLLLDRKANVEHRAKTGLTPLMEAASGGYVEVGRVLLDKGADV**********TALTIAADKGHCRFVELLLSKGAQVEVKNKKGNSPLWLAANGGHLSVVELLCKHGADIDSQDNRKVSCLMAAFRKGHVKAVRWMVNHVAQFPSDQEMTRYIQTVNDKELLDKCQECSMVIRVA********************************************************************************************************************************************************************************************************************************
MDVDSETESNHDTALTLACAGGHEELVELLLSRGADIEHRDKKGFTPLILAATAGHDKVVDILLNHKADMEAQSERTKDTPLSLACSGGRYEVVELLLTRGANKEHRNVSDYTPLSLAASGGYVNIIKLLLTHGAEINSRTGSKLGISPLMLAAMNGHTAAVKLLLDMGSDINAQIETNRNTALTLACFQGRHEVVSLLLDRKANVEHRAKTGLTPLMEAASGGYVEVGRVLLDKGADVNAPPVPSSRDTALTIAADKGHCRFVELLLSKGAQVEVKNKKGNSPLWLAANGGHLSVVELLCKHGADIDSQDNRKVSCLMAAFRKGHVKAVRWMVNHVAQFPSDQEMTRYIQTVNDKELLDKCQECSMVIRVAKNQQAERANKNANILLEELDMEKWREESKRAAQARKRERKKQKKLEKKEEKRKAMEEEEEVIRVAKNQQAERANKNANILLEELDMEKWREESKRAA********************************************************************************************************PCYWTGRPMWSIEPSQCLTIA**
************TALTLACAGGHEELVELLLSRGADIEHRDKKGFTPLILAATAGHDKVVDILLNHKADM************SLACSGGRYEVVELLLTRGANKEHRNVSDYTPLSLAASGGYVNIIKLLLTHGAEINSRTGSKLGISPLMLAAMNGHTAAVKLLLDMGSDINAQIETNRNTALTLACFQGRHEVVSLLLDRKANVEHRAKTGLTPLMEAASGGYVEVGRVLLDKGADVNAPPVPSSRDTALTIAADKGHCRFVELLLSKGAQVEVKNKKGNSPLWLAANGGHLSVVELLCKHGADIDSQDNRKVSCLMAAFRKGHVKAVRWMVNHVAQFPSDQEMTRYIQTVNDKELLDKCQECSMVIRVAKNQQAERANKNANILLEELDMEKW*************************************IRVAKNQQAERANKNANILLEELDMEKW**********************************************************************************************************LDMRWFPCYWTGRPMWSIEPSQCLTIANN
*****ETESNHDTALTLACAGGHEELVELLLSRGADIEHRDKKGFTPLILAATAGHDKVVDILLNHKADMEAQSERTKDTPLSLACSGGRYEVVELLLTRGANKEHRNVSDYTPLSLAASGGYVNIIKLLLTHGAEINSRTGSKLGISPLMLAAMNGHTAAVKLLLDMGSDINAQIETNRNTALTLACFQGRHEVVSLLLDRKANVEHRAKTGLTPLMEAASGGYVEVGRVLLDKGADVNAPPVPSSRDTALTIAADKGHCRFVELLLSKGAQVEVKNKKGNSPLWLAANGGHLSVVELLCKHGADIDSQDNRKVSCLMAAFRKGHVKAVRWMVNHVAQFPSDQEMTRYIQTVNDKELLDKCQECSMVIRVAKNQQAERANKNANILLEELDMEKWREESKRAAQARKRERKKQKKLEKKEEKRKAMEEEEEVIRVAKNQQAERANKNANILLEELDMEKWREESKR*********************RKAMEEEEEEE*************************************************************************************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDVDSETESNHDTALTLACAGGHEELVELLLSRGADIEHRDKKGFTPLILAATAGHDKVVDILLNHKADMEAQSERTKDTPLSLACSGGRYEVVELLLTRGANKEHRNVSDYTPLSLAASGGYVNIIKLLLTHGAEINSRTGSKLGISPLMLAAMNGHTAAVKLLLDMGSDINAQIETNRNTALTLACFQGRHEVVSLLLDRKANVEHRAKTGLTPLMEAASGGYVEVGRVLLDKGADVNAPPVPSSRDTALTIAADKGHCRFVELLLSKGAQVEVKNKKGNSPLWLAANGGHLSVVELLCKHGADIDSQDNRKVSCLMAAFRKGHVKAVRWMVNHVAQFPSDQEMTRYIQTVNDKELLDKCQECSMVIxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxENDMHSSGGGRGEGEEGDSGIDANSQASCSSNEVKTAAPNSRRKDKKKKKLDMRWFPCYWTGRPMWSIEPSQCLTIANN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query596 2.2.26 [Sep-21-2011]
Q9VCA8 4001 Ankyrin repeat and KH dom yes N/A 0.609 0.090 0.86 0.0
Q8IWZ3 2542 Ankyrin repeat and KH dom yes N/A 0.498 0.116 0.790 0.0
O75179 2603 Ankyrin repeat domain-con no N/A 0.568 0.130 0.815 0.0
Q99NH0 2603 Ankyrin repeat domain-con no N/A 0.484 0.111 0.815 0.0
Q21920 2620 Ankyrin repeat and KH dom no N/A 0.518 0.117 0.662 1e-144
Q60J38 2636 Ankyrin repeat and KH dom N/A N/A 0.664 0.150 0.615 1e-142
Q9ULJ7 1429 Ankyrin repeat domain-con no N/A 0.553 0.230 0.350 8e-43
Q12955 4377 Ankyrin-3 OS=Homo sapiens no N/A 0.541 0.073 0.332 5e-41
G5E8K5 1961 Ankyrin-3 OS=Mus musculus no N/A 0.541 0.164 0.340 2e-40
Q8C8R3 3898 Ankyrin-2 OS=Mus musculus no N/A 0.548 0.083 0.352 4e-40
>sp|Q9VCA8|ANKHM_DROME Ankyrin repeat and KH domain-containing protein mask OS=Drosophila melanogaster GN=mask PE=1 SV=2 Back     alignment and function desciption
 Score =  729 bits (1881), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 344/400 (86%), Positives = 375/400 (93%)

Query: 1    MDVDSETESNHDTALTLACAGGHEELVELLLSRGADIEHRDKKGFTPLILAATAGHDKVV 60
            +++DSETESNHDTALTLACAGGHEELVELL++RGA+IEHRDKKGFTPLILAATAGHDKVV
Sbjct: 2303 IEIDSETESNHDTALTLACAGGHEELVELLINRGANIEHRDKKGFTPLILAATAGHDKVV 2362

Query: 61   DILLNHKADMEAQSERTKDTPLSLACSGGRYEVVELLLTRGANKEHRNVSDYTPLSLAAS 120
            DILL H A++EAQSERTKDTPLSLACSGGRYEVVELLL+ GANKEHRNVSDYTPLSLAAS
Sbjct: 2363 DILLKHSAELEAQSERTKDTPLSLACSGGRYEVVELLLSVGANKEHRNVSDYTPLSLAAS 2422

Query: 121  GGYVNIIKLLLTHGAEINSRTGSKLGISPLMLAAMNGHTAAVKLLLDMGSDINAQIETNR 180
            GGYVNIIKLLL+HGAEINSRTGSKLGISPLMLAAMNGHT AVKLLLD GSDINAQIETNR
Sbjct: 2423 GGYVNIIKLLLSHGAEINSRTGSKLGISPLMLAAMNGHTPAVKLLLDQGSDINAQIETNR 2482

Query: 181  NTALTLACFQGRHEVVSLLLDRKANVEHRAKTGLTPLMEAASGGYVEVGRVLLDKGADVN 240
            NTALTLACFQGRHEVVSLLLDR+ANVEHRAKTGLTPLMEAASGGY+EVGRVLLDKGADVN
Sbjct: 2483 NTALTLACFQGRHEVVSLLLDRRANVEHRAKTGLTPLMEAASGGYIEVGRVLLDKGADVN 2542

Query: 241  APPVPSSRDTALTIAADKGHCRFVELLLSKGAQVEVKNKKGNSPLWLAANGGHLSVVELL 300
            A PVP+SRDTALTIAADKGH +FVELLLS+ A VEVKNKKGNSPLWLAA+GGHLSVVELL
Sbjct: 2543 AAPVPTSRDTALTIAADKGHQKFVELLLSRNASVEVKNKKGNSPLWLAAHGGHLSVVELL 2602

Query: 301  CKHGADIDSQDNRKVSCLMAAFRKGHVKAVRWMVNHVAQFPSDQEMTRYIQTVNDKELLD 360
              H ADIDSQDNR+VSCLMAAFRKGH K V+WMV +V+QFPSDQEM R+I T++DKEL+D
Sbjct: 2603 YDHNADIDSQDNRRVSCLMAAFRKGHTKIVKWMVQYVSQFPSDQEMIRFIGTISDKELID 2662

Query: 361  KCQECSMVIRVAKNQQAERANKNANILLEELDMEKWREES 400
            KC +C  ++R AK  QA +ANKNA+ILLEELD+E+ REES
Sbjct: 2663 KCFDCMKILRSAKEAQAVKANKNASILLEELDLERTREES 2702




Mediator of receptor tyrosine kinase (RTK) signaling, and may act either downstream of MAPK or transduce signaling through a parallel branch of the RTK pathway.
Drosophila melanogaster (taxid: 7227)
>sp|Q8IWZ3|ANKH1_HUMAN Ankyrin repeat and KH domain-containing protein 1 OS=Homo sapiens GN=ANKHD1 PE=1 SV=1 Back     alignment and function description
>sp|O75179|ANR17_HUMAN Ankyrin repeat domain-containing protein 17 OS=Homo sapiens GN=ANKRD17 PE=1 SV=3 Back     alignment and function description
>sp|Q99NH0|ANR17_MOUSE Ankyrin repeat domain-containing protein 17 OS=Mus musculus GN=Ankrd17 PE=1 SV=2 Back     alignment and function description
>sp|Q21920|ANKHM_CAEEL Ankyrin repeat and KH domain-containing protein R11A8.7 OS=Caenorhabditis elegans GN=R11A8.7 PE=2 SV=3 Back     alignment and function description
>sp|Q60J38|ANKHM_CAEBR Ankyrin repeat and KH domain-containing protein CBG24701 OS=Caenorhabditis briggsae GN=CBG24701 PE=3 SV=3 Back     alignment and function description
>sp|Q9ULJ7|ANR50_HUMAN Ankyrin repeat domain-containing protein 50 OS=Homo sapiens GN=ANKRD50 PE=1 SV=4 Back     alignment and function description
>sp|Q12955|ANK3_HUMAN Ankyrin-3 OS=Homo sapiens GN=ANK3 PE=1 SV=3 Back     alignment and function description
>sp|G5E8K5|ANK3_MOUSE Ankyrin-3 OS=Mus musculus GN=Ank3 PE=1 SV=1 Back     alignment and function description
>sp|Q8C8R3|ANK2_MOUSE Ankyrin-2 OS=Mus musculus GN=Ank2 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query596
307212336 2982 Ankyrin repeat domain-containing protein 0.848 0.169 0.760 0.0
350419534 3091 PREDICTED: hypothetical protein LOC10074 0.874 0.168 0.732 0.0
328790111 3136 PREDICTED: hypothetical protein LOC40998 0.848 0.161 0.759 0.0
307186886 2898 Ankyrin repeat domain-containing protein 0.845 0.173 0.760 0.0
332022374 3049 Ankyrin repeat and KH domain-containing 0.843 0.164 0.759 0.0
242019742 2803 multiple ankyrin repeats single kh domai 0.854 0.181 0.743 0.0
345496985 757 PREDICTED: ankyrin repeat and KH domain- 0.671 0.528 0.912 0.0
270002082 2691 hypothetical protein TcasGA2_TC001033 [T 0.587 0.130 0.892 0.0
189234573 2677 PREDICTED: similar to Ankyrin repeat dom 0.605 0.134 0.892 0.0
328698338 2652 PREDICTED: hypothetical protein LOC10016 0.622 0.139 0.857 0.0
>gi|307212336|gb|EFN88140.1| Ankyrin repeat domain-containing protein 17 [Harpegnathos saltator] Back     alignment and taxonomy information
 Score =  779 bits (2012), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 420/552 (76%), Positives = 448/552 (81%), Gaps = 46/552 (8%)

Query: 1    MDVDSETESNHDTALTLACAGGHEELVELLLSRGADIEHRDKKGFTPLILAATAGHDKVV 60
            MDVDSET+SNHDTALTLACAGGHE+LVELLLSRGADIEHRDKKGFTPLILAATAGH KVV
Sbjct: 1407 MDVDSETDSNHDTALTLACAGGHEDLVELLLSRGADIEHRDKKGFTPLILAATAGHQKVV 1466

Query: 61   DILLNHKADMEAQSERTKDTPLSLACSGGRYEVVELLLTRGANKEHRNVSDYTPLSLAAS 120
            +ILLNH AD+EAQSERTKDTPLSLACSGGRYEVVELLL RGANKEHRNVSDYTPLSLAAS
Sbjct: 1467 EILLNHGADIEAQSERTKDTPLSLACSGGRYEVVELLLNRGANKEHRNVSDYTPLSLAAS 1526

Query: 121  GGYVNIIKLLLTHGAEINSRTGSKLGISPLMLAAMNGHTAAVKLLLDMGSDINAQIETNR 180
            GGYVNIIKLLL HGAEINSRTGSKLGISPLMLAAMNGHTAAVKLLLDMGSDINAQIETNR
Sbjct: 1527 GGYVNIIKLLLNHGAEINSRTGSKLGISPLMLAAMNGHTAAVKLLLDMGSDINAQIETNR 1586

Query: 181  NTALTLACFQGRHEVVSLLLDRKANVEHRAKTGLTPLMEAASGGYVEVGRVLLDKGADVN 240
            NTALTLACFQGRHEVVSLLLDRKANVEHRAKTGLTPLMEAASGGYVEVGRVLL KGADVN
Sbjct: 1587 NTALTLACFQGRHEVVSLLLDRKANVEHRAKTGLTPLMEAASGGYVEVGRVLLTKGADVN 1646

Query: 241  APPVPSSRDTALTIAADKGHCRFVELLLSKGAQVEVKNKKGNSPLWLAANGGHLSVVELL 300
            A PVPSSRDTALTIAADKGHCRFVELLLS+G QVEVKNKKGNSPLWLAANGGHL+VV+LL
Sbjct: 1647 ATPVPSSRDTALTIAADKGHCRFVELLLSRGTQVEVKNKKGNSPLWLAANGGHLNVVDLL 1706

Query: 301  CKHGADIDSQDNRKVSCLMAAFRKGHVKAVRWMVNHVAQFPSDQEMTRYIQTVNDKELLD 360
               GADIDSQDNRKVSCLMAAFRKGH+K V+WMVNHV QFPSDQEMTRY+ T++DKELL+
Sbjct: 1707 YHAGADIDSQDNRKVSCLMAAFRKGHIKVVKWMVNHVTQFPSDQEMTRYVATISDKELLE 1766

Query: 361  KCQECSMVIRVAKNQQAERANKNANILLEELDMEKWREESKRAAQARKRERKKQKKLEKK 420
            KCQEC  VIR AK  QA +ANKNA ILLEELDMEK REESK+AA AR+RERKK+KKLEKK
Sbjct: 1767 KCQECVKVIRAAKETQAAKANKNATILLEELDMEKTREESKKAAAARRRERKKKKKLEKK 1826

Query: 421  EEKRKAMEEEEEVIRVAKNQQAERANKNANILLEELDMEKWREESKRAAQARKRERKKQK 480
            EEKRK  EE +      KN+ A                                +++   
Sbjct: 1827 EEKRKMHEEYK------KNETA------------------------------YEDKEDNG 1850

Query: 481  KLEKKEEKRKAMEEEEEEEEEVEVQEVEGEMMEEETEENDMHSSGGGRGEGEEGDSGIDA 540
            K    EE  +A + E E  +  E  E     +    E+ D       R EG   DSGIDA
Sbjct: 1851 KKSGDEECDRADDSEHEGGDGCERIESVPSPVNRSPEDPD-------REEG---DSGIDA 1900

Query: 541  NSQASCSSNEVK 552
            NSQ SCSSN+VK
Sbjct: 1901 NSQGSCSSNDVK 1912




Source: Harpegnathos saltator

Species: Harpegnathos saltator

Genus: Harpegnathos

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|350419534|ref|XP_003492217.1| PREDICTED: hypothetical protein LOC100740063 [Bombus impatiens] Back     alignment and taxonomy information
>gi|328790111|ref|XP_393472.4| PREDICTED: hypothetical protein LOC409983 [Apis mellifera] Back     alignment and taxonomy information
>gi|307186886|gb|EFN72287.1| Ankyrin repeat domain-containing protein 17 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|332022374|gb|EGI62686.1| Ankyrin repeat and KH domain-containing protein 1 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|242019742|ref|XP_002430318.1| multiple ankyrin repeats single kh domain protein, putative [Pediculus humanus corporis] gi|212515433|gb|EEB17580.1| multiple ankyrin repeats single kh domain protein, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|345496985|ref|XP_003427871.1| PREDICTED: ankyrin repeat and KH domain-containing protein mask [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|270002082|gb|EEZ98529.1| hypothetical protein TcasGA2_TC001033 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|189234573|ref|XP_974489.2| PREDICTED: similar to Ankyrin repeat domain-containing protein 17 (Gene trap ankyrin repeat protein) (Serologically defined breast cancer antigen NY-BR-16) [Tribolium castaneum] Back     alignment and taxonomy information
>gi|328698338|ref|XP_001946819.2| PREDICTED: hypothetical protein LOC100167340 [Acyrthosiphon pisum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query596
FB|FBgn0043884 4001 mask "multiple ankyrin repeats 0.662 0.098 0.860 1.4e-183
UNIPROTKB|E1BVC61330 Gga.53476 "Uncharacterized pro 0.662 0.296 0.822 2.8e-176
UNIPROTKB|I3LSK0 2222 ANKRD17 "Uncharacterized prote 0.662 0.177 0.820 9.4e-176
UNIPROTKB|F1LRM8 2341 Ankrd17 "Protein Ankrd17" [Rat 0.662 0.168 0.820 9.3e-175
UNIPROTKB|G5E964 2352 ANKRD17 "Ankyrin repeat domain 0.662 0.167 0.820 1.1e-174
UNIPROTKB|H0YM23 2487 ANKRD17 "Ankyrin repeat domain 0.662 0.158 0.820 5.3e-174
UNIPROTKB|E2QZ73 2488 ANKRD17 "Uncharacterized prote 0.662 0.158 0.820 5.3e-174
UNIPROTKB|E7EUV3 2490 ANKRD17 "Ankyrin repeat domain 0.662 0.158 0.820 5.4e-174
UNIPROTKB|J9NSE6 2551 ANKRD17 "Uncharacterized prote 0.662 0.154 0.820 8.3e-174
UNIPROTKB|F1LQP1 2592 Ankrd17 "Protein Ankrd17" [Rat 0.662 0.152 0.820 1.1e-173
FB|FBgn0043884 mask "multiple ankyrin repeats single KH domain" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 1759 (624.3 bits), Expect = 1.4e-183, Sum P(2) = 1.4e-183
 Identities = 340/395 (86%), Positives = 371/395 (93%)

Query:     1 MDVDSETESNHDTALTLACAGGHEELVELLLSRGADIEHRDKKGFTPLILAATAGHDKVV 60
             +++DSETESNHDTALTLACAGGHEELVELL++RGA+IEHRDKKGFTPLILAATAGHDKVV
Sbjct:  2303 IEIDSETESNHDTALTLACAGGHEELVELLINRGANIEHRDKKGFTPLILAATAGHDKVV 2362

Query:    61 DILLNHKADMEAQSERTKDTPLSLACSGGRYEVVELLLTRGANKEHRNVSDYTPLSLAAS 120
             DILL H A++EAQSERTKDTPLSLACSGGRYEVVELLL+ GANKEHRNVSDYTPLSLAAS
Sbjct:  2363 DILLKHSAELEAQSERTKDTPLSLACSGGRYEVVELLLSVGANKEHRNVSDYTPLSLAAS 2422

Query:   121 GGYVNIIKLLLTHGAEINSRTGSKLGISPLMLAAMNGHTAAVKLLLDMGSDINAQIETNR 180
             GGYVNIIKLLL+HGAEINSRTGSKLGISPLMLAAMNGHT AVKLLLD GSDINAQIETNR
Sbjct:  2423 GGYVNIIKLLLSHGAEINSRTGSKLGISPLMLAAMNGHTPAVKLLLDQGSDINAQIETNR 2482

Query:   181 NTALTLACFQGRHEVVSLLLDRKANVEHRAKTGLTPLMEAASGGYVEVGRVLLDKGADVN 240
             NTALTLACFQGRHEVVSLLLDR+ANVEHRAKTGLTPLMEAASGGY+EVGRVLLDKGADVN
Sbjct:  2483 NTALTLACFQGRHEVVSLLLDRRANVEHRAKTGLTPLMEAASGGYIEVGRVLLDKGADVN 2542

Query:   241 APPVPSSRDTALTIAADKGHCRFVELLLSKGAQVEVKNKKGNSPLWLAANGGHLSVVELL 300
             A PVP+SRDTALTIAADKGH +FVELLLS+ A VEVKNKKGNSPLWLAA+GGHLSVVELL
Sbjct:  2543 AAPVPTSRDTALTIAADKGHQKFVELLLSRNASVEVKNKKGNSPLWLAAHGGHLSVVELL 2602

Query:   301 CKHGADIDSQDNRKVSCLMAAFRKGHVKAVRWMVNHVAQFPSDQEMTRYIQTVNDKELLD 360
               H ADIDSQDNR+VSCLMAAFRKGH K V+WMV +V+QFPSDQEM R+I T++DKEL+D
Sbjct:  2603 YDHNADIDSQDNRRVSCLMAAFRKGHTKIVKWMVQYVSQFPSDQEMIRFIGTISDKELID 2662

Query:   361 KCQECSMVIRVAKNQQAERANKNANILLEELDMEK 395
             KC +C  ++R AK  QA +ANKNA+ILLEELD+E+
Sbjct:  2663 KCFDCMKILRSAKEAQAVKANKNASILLEELDLER 2697


GO:0007016 "cytoskeletal anchoring at plasma membrane" evidence=ISS
GO:0005200 "structural constituent of cytoskeleton" evidence=ISS
GO:0008283 "cell proliferation" evidence=IMP
GO:0001751 "compound eye photoreceptor cell differentiation" evidence=IMP
GO:0007169 "transmembrane receptor protein tyrosine kinase signaling pathway" evidence=IGI
GO:0009987 "cellular process" evidence=IMP
GO:0003723 "RNA binding" evidence=IEA
GO:0046427 "positive regulation of JAK-STAT cascade" evidence=IMP
GO:0019730 "antimicrobial humoral response" evidence=IMP
GO:0005811 "lipid particle" evidence=IDA
GO:0051298 "centrosome duplication" evidence=IMP
UNIPROTKB|E1BVC6 Gga.53476 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|I3LSK0 ANKRD17 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1LRM8 Ankrd17 "Protein Ankrd17" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|G5E964 ANKRD17 "Ankyrin repeat domain 17, isoform CRA_b" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|H0YM23 ANKRD17 "Ankyrin repeat domain-containing protein 17" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2QZ73 ANKRD17 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|E7EUV3 ANKRD17 "Ankyrin repeat domain-containing protein 17" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|J9NSE6 ANKRD17 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1LQP1 Ankrd17 "Protein Ankrd17" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q8IWZ3ANKH1_HUMANNo assigned EC number0.79060.49830.1168yesN/A
Q9VCA8ANKHM_DROMENo assigned EC number0.860.60900.0907yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query596
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 3e-34
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 2e-33
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 1e-32
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 1e-31
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 5e-31
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 5e-29
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 6e-25
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 2e-24
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 1e-23
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 3e-23
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 8e-23
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 3e-22
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 4e-22
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 6e-22
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 7e-22
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 9e-22
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 1e-21
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 1e-21
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 1e-19
PHA02876682 PHA02876, PHA02876, ankyrin repeat protein; Provis 3e-19
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 5e-19
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 9e-19
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 1e-17
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 2e-17
PHA02876682 PHA02876, PHA02876, ankyrin repeat protein; Provis 5e-17
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 7e-17
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 1e-16
COG0666235 COG0666, Arp, FOG: Ankyrin repeat [General functio 2e-16
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 3e-16
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 9e-16
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 2e-15
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 6e-13
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 7e-13
cd00204126 cd00204, ANK, ankyrin repeats; ankyrin repeats med 3e-12
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 4e-12
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 8e-12
PHA02874434 PHA02874, PHA02874, ankyrin repeat protein; Provis 1e-11
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 1e-11
PHA02876682 PHA02876, PHA02876, ankyrin repeat protein; Provis 3e-11
PHA02989494 PHA02989, PHA02989, ankyrin repeat protein; Provis 8e-11
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 1e-10
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 2e-10
PLN03192823 PLN03192, PLN03192, Voltage-dependent potassium ch 1e-09
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 1e-09
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 3e-09
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 3e-09
PHA02875413 PHA02875, PHA02875, ankyrin repeat protein; Provis 4e-09
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 5e-09
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 6e-09
PLN03192823 PLN03192, PLN03192, Voltage-dependent potassium ch 7e-09
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 9e-09
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 9e-09
PTZ00322664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 9e-09
PHA02878477 PHA02878, PHA02878, ankyrin repeat protein; Provis 1e-08
PLN03192823 PLN03192, PLN03192, Voltage-dependent potassium ch 1e-08
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 2e-08
PTZ00322664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 2e-08
TIGR00870743 TIGR00870, trp, transient-receptor-potential calci 2e-08
PLN03192823 PLN03192, PLN03192, Voltage-dependent potassium ch 6e-08
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 6e-08
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 8e-08
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 8e-08
pfam0002333 pfam00023, Ank, Ankyrin repeat 8e-08
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 1e-07
pfam02463 1162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 1e-07
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 2e-07
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 2e-07
PHA02798489 PHA02798, PHA02798, ankyrin-like protein; Provisio 2e-07
PHA02884300 PHA02884, PHA02884, ankyrin repeat protein; Provis 3e-07
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 4e-07
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 4e-07
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 5e-07
pfam0002333 pfam00023, Ank, Ankyrin repeat 5e-07
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 6e-07
PLN03192823 PLN03192, PLN03192, Voltage-dependent potassium ch 9e-07
pfam0002333 pfam00023, Ank, Ankyrin repeat 1e-06
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 1e-06
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 1e-06
pfam09756189 pfam09756, DDRGK, DDRGK domain 1e-06
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 2e-06
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 2e-06
pfam10243 506 pfam10243, MIP-T3, Microtubule-binding protein MIP 2e-06
pfam09507427 pfam09507, CDC27, DNA polymerase subunit Cdc27 2e-06
COG0419 908 COG0419, SbcC, ATPase involved in DNA repair [DNA 2e-06
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 4e-06
PRK00409782 PRK00409, PRK00409, recombination and DNA strand e 4e-06
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 5e-06
pfam04147 809 pfam04147, Nop14, Nop14-like family 5e-06
pfam1363754 pfam13637, Ank_4, Ankyrin repeats (many copies) 6e-06
pfam0002333 pfam00023, Ank, Ankyrin repeat 9e-06
PHA02989494 PHA02989, PHA02989, ankyrin repeat protein; Provis 1e-05
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 1e-05
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 1e-05
pfam1360630 pfam13606, Ank_3, Ankyrin repeat 1e-05
PHA02946446 PHA02946, PHA02946, ankyin-like protein; Provision 1e-05
PTZ00322 664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 2e-05
pfam0002333 pfam00023, Ank, Ankyrin repeat 2e-05
pfam02463 1162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 2e-05
PTZ00322664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 3e-05
pfam02463 1162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 3e-05
pfam13868349 pfam13868, Trichoplein, Tumour suppressor, Mitosta 3e-05
PLN03192823 PLN03192, PLN03192, Voltage-dependent potassium ch 4e-05
pfam0002333 pfam00023, Ank, Ankyrin repeat 4e-05
PRK12704 520 PRK12704, PRK12704, phosphodiesterase; Provisional 4e-05
pfam1279691 pfam12796, Ank_2, Ankyrin repeats (3 copies) 5e-05
pfam0002333 pfam00023, Ank, Ankyrin repeat 5e-05
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 5e-05
COG0419 908 COG0419, SbcC, ATPase involved in DNA repair [DNA 5e-05
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 5e-05
smart0024830 smart00248, ANK, ankyrin repeats 6e-05
PTZ00322664 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct 7e-05
PRK05035695 PRK05035, PRK05035, electron transport complex pro 9e-05
TIGR02794346 TIGR02794, tolA_full, TolA protein 9e-05
TIGR00870 743 TIGR00870, trp, transient-receptor-potential calci 1e-04
PHA02884300 PHA02884, PHA02884, ankyrin repeat protein; Provis 1e-04
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 1e-04
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 1e-04
PRK12704 520 PRK12704, PRK12704, phosphodiesterase; Provisional 1e-04
smart0024830 smart00248, ANK, ankyrin repeats 1e-04
smart0024830 smart00248, ANK, ankyrin repeats 1e-04
pfam13904261 pfam13904, DUF4207, Domain of unknown function (DU 1e-04
PHA03095471 PHA03095, PHA03095, ankyrin-like protein; Provisio 2e-04
PTZ00121 2084 PTZ00121, PTZ00121, MAEBL; Provisional 2e-04
pfam0002333 pfam00023, Ank, Ankyrin repeat 2e-04
PHA02884300 PHA02884, PHA02884, ankyrin repeat protein; Provis 2e-04
COG0419 908 COG0419, SbcC, ATPase involved in DNA repair [DNA 2e-04
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 2e-04
TIGR02794346 TIGR02794, tolA_full, TolA protein 2e-04
PHA02798489 PHA02798, PHA02798, ankyrin-like protein; Provisio 3e-04
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 3e-04
pfam10243 506 pfam10243, MIP-T3, Microtubule-binding protein MIP 3e-04
pfam1360630 pfam13606, Ank_3, Ankyrin repeat 3e-04
pfam13868349 pfam13868, Trichoplein, Tumour suppressor, Mitosta 3e-04
PRK12704 520 PRK12704, PRK12704, phosphodiesterase; Provisional 3e-04
TIGR02794346 TIGR02794, tolA_full, TolA protein 3e-04
TIGR00927 1096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 3e-04
TIGR00927 1096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 3e-04
PRK10811 1068 PRK10811, rne, ribonuclease E; Reviewed 3e-04
pfam08597242 pfam08597, eIF3_subunit, Translation initiation fa 3e-04
pfam02463 1162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 4e-04
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 4e-04
pfam1360630 pfam13606, Ank_3, Ankyrin repeat 4e-04
smart0024830 smart00248, ANK, ankyrin repeats 4e-04
TIGR02794346 TIGR02794, tolA_full, TolA protein 4e-04
pfam13904261 pfam13904, DUF4207, Domain of unknown function (DU 4e-04
pfam05262489 pfam05262, Borrelia_P83, Borrelia P83/100 protein 4e-04
pfam06658142 pfam06658, DUF1168, Protein of unknown function (D 4e-04
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 5e-04
COG3064 387 COG3064, TolA, Membrane protein involved in colici 5e-04
COG3064387 COG3064, TolA, Membrane protein involved in colici 5e-04
pfam06375 561 pfam06375, BLVR, Bovine leukaemia virus receptor ( 5e-04
COG1579239 COG1579, COG1579, Zn-ribbon protein, possibly nucl 5e-04
PHA02884300 PHA02884, PHA02884, ankyrin repeat protein; Provis 6e-04
COG3064387 COG3064, TolA, Membrane protein involved in colici 6e-04
pfam11169103 pfam11169, DUF2956, Protein of unknown function (D 6e-04
COG5271 4600 COG5271, MDN1, AAA ATPase containing von Willebran 7e-04
pfam1385756 pfam13857, Ank_5, Ankyrin repeats (many copies) 8e-04
COG0419 908 COG0419, SbcC, ATPase involved in DNA repair [DNA 8e-04
PHA03100422 PHA03100, PHA03100, ankyrin repeat protein; Provis 0.001
pfam0002333 pfam00023, Ank, Ankyrin repeat 0.001
pfam02463 1162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 0.001
pfam1360630 pfam13606, Ank_3, Ankyrin repeat 0.001
smart0024830 smart00248, ANK, ankyrin repeats 0.001
TIGR02169 1164 TIGR02169, SMC_prok_A, chromosome segregation prot 0.001
PRK05306 746 PRK05306, infB, translation initiation factor IF-2 0.001
PRK00247429 PRK00247, PRK00247, putative inner membrane protei 0.001
PRK04195482 PRK04195, PRK04195, replication factor C large sub 0.001
PRK09510 387 PRK09510, tolA, cell envelope integrity inner memb 0.001
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 0.002
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 0.002
PRK00409 782 PRK00409, PRK00409, recombination and DNA strand e 0.002
pfam13868349 pfam13868, Trichoplein, Tumour suppressor, Mitosta 0.002
PRK12704 520 PRK12704, PRK12704, phosphodiesterase; Provisional 0.002
COG2433652 COG2433, COG2433, Uncharacterized conserved protei 0.002
PRK02224 880 PRK02224, PRK02224, chromosome segregation protein 0.002
pfam02463 1162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 0.003
pfam024631162 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain 0.003
PRK12704 520 PRK12704, PRK12704, phosphodiesterase; Provisional 0.003
TIGR02168 1179 TIGR02168, SMC_prok_B, chromosome segregation prot 0.003
COG2433652 COG2433, COG2433, Uncharacterized conserved protei 0.003
pfam10310 436 pfam10310, DUF2413, Protein of unknown function (D 0.003
PRK07735 430 PRK07735, PRK07735, NADH dehydrogenase subunit C; 0.003
PRK03918 880 PRK03918, PRK03918, chromosome segregation protein 0.003
pfam07767387 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) 0.003
PRK12472508 PRK12472, PRK12472, hypothetical protein; Provisio 0.003
COG4487 438 COG4487, COG4487, Uncharacterized protein conserve 0.003
PHA02798489 PHA02798, PHA02798, ankyrin-like protein; Provisio 0.004
pfam09756189 pfam09756, DDRGK, DDRGK domain 0.004
COG1196 1163 COG1196, Smc, Chromosome segregation ATPases [Cell 0.004
smart0024830 smart00248, ANK, ankyrin repeats 0.004
smart0024830 smart00248, ANK, ankyrin repeats 0.004
TIGR00927 1096 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger 0.004
pfam05262489 pfam05262, Borrelia_P83, Borrelia P83/100 protein 0.004
PRK00247429 PRK00247, PRK00247, putative inner membrane protei 0.004
pfam12072201 pfam12072, DUF3552, Domain of unknown function (DU 0.004
pfam07543139 pfam07543, PGA2, Protein trafficking PGA2 0.004
PRK00106 535 PRK00106, PRK00106, hypothetical protein; Provisio 0.004
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
 Score =  125 bits (317), Expect = 3e-34
 Identities = 55/119 (46%), Positives = 75/119 (63%), Gaps = 1/119 (0%)

Query: 13  TALTLACAGGHEELVELLLSRGADIEHRDKKGFTPLILAATAGHDKVVDILLNHKADMEA 72
           T L LA + GH E+V+LLL  GAD+  +D  G TPL LAA  GH ++V +LL   AD+ A
Sbjct: 9   TPLHLAASNGHLEVVKLLLENGADVNAKDNDGRTPLHLAAKNGHLEIVKLLLEKGADVNA 68

Query: 73  QSERTKDTPLSLACSGGRYEVVELLLTRGANKEHRNVSDYTPLSLAASGGYVNIIKLLL 131
           +  +  +TPL LA   G  +VV+LLL  GA+   R+    TPL LAA  G++ ++KLLL
Sbjct: 69  RD-KDGNTPLHLAARNGNLDVVKLLLKHGADVNARDKDGRTPLHLAAKNGHLEVVKLLL 126


The number of ANK repeats in a protein can range from 2 to over 20 (ankyrins, for example). ANK repeats may occur in combinations with other types of domains. The structural repeat unit contains two antiparallel helices and a beta-hairpin, repeats are stacked in a superhelical arrangement; this alignment contains 4 consecutive repeats. Length = 126

>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222954 PHA02989, PHA02989, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|233161 TIGR00870, trp, transient-receptor-potential calcium channel protein Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|222931 PHA02798, PHA02798, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|165212 PHA02884, PHA02884, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|220383 pfam09756, DDRGK, DDRGK domain Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|220271 pfam09507, CDC27, DNA polymerase subunit Cdc27 Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|234750 PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|217927 pfam04147, Nop14, Nop14-like family Back     alignment and domain information
>gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|222954 PHA02989, PHA02989, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|165256 PHA02946, PHA02946, ankyin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional Back     alignment and domain information
>gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>gnl|CDD|235334 PRK05035, PRK05035, electron transport complex protein RnfC; Provisional Back     alignment and domain information
>gnl|CDD|234017 TIGR02794, tolA_full, TolA protein Back     alignment and domain information
>gnl|CDD|233161 TIGR00870, trp, transient-receptor-potential calcium channel protein Back     alignment and domain information
>gnl|CDD|165212 PHA02884, PHA02884, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|222447 pfam13904, DUF4207, Domain of unknown function (DUF4207) Back     alignment and domain information
>gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|173412 PTZ00121, PTZ00121, MAEBL; Provisional Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|165212 PHA02884, PHA02884, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|234017 TIGR02794, tolA_full, TolA protein Back     alignment and domain information
>gnl|CDD|222931 PHA02798, PHA02798, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|220648 pfam10243, MIP-T3, Microtubule-binding protein MIP-T3 Back     alignment and domain information
>gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin Back     alignment and domain information
>gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional Back     alignment and domain information
>gnl|CDD|234017 TIGR02794, tolA_full, TolA protein Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|236766 PRK10811, rne, ribonuclease E; Reviewed Back     alignment and domain information
>gnl|CDD|219924 pfam08597, eIF3_subunit, Translation initiation factor eIF3 subunit Back     alignment and domain information
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|234017 TIGR02794, tolA_full, TolA protein Back     alignment and domain information
>gnl|CDD|222447 pfam13904, DUF4207, Domain of unknown function (DUF4207) Back     alignment and domain information
>gnl|CDD|114011 pfam05262, Borrelia_P83, Borrelia P83/100 protein Back     alignment and domain information
>gnl|CDD|219124 pfam06658, DUF1168, Protein of unknown function (DUF1168) Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|115057 pfam06375, BLVR, Bovine leukaemia virus receptor (BLVR) Back     alignment and domain information
>gnl|CDD|224495 COG1579, COG1579, Zn-ribbon protein, possibly nucleic acid-binding [General function prediction only] Back     alignment and domain information
>gnl|CDD|165212 PHA02884, PHA02884, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|225606 COG3064, TolA, Membrane protein involved in colicin uptake [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>gnl|CDD|221012 pfam11169, DUF2956, Protein of unknown function (DUF2956) Back     alignment and domain information
>gnl|CDD|227596 COG5271, MDN1, AAA ATPase containing von Willebrand factor type A (vWA) domain [General function prediction only] Back     alignment and domain information
>gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) Back     alignment and domain information
>gnl|CDD|223496 COG0419, SbcC, ATPase involved in DNA repair [DNA replication, recombination, and repair] Back     alignment and domain information
>gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional Back     alignment and domain information
>gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|233758 TIGR02169, SMC_prok_A, chromosome segregation protein SMC, primarily archaeal type Back     alignment and domain information
>gnl|CDD|235401 PRK05306, infB, translation initiation factor IF-2; Validated Back     alignment and domain information
>gnl|CDD|178945 PRK00247, PRK00247, putative inner membrane protein translocase component YidC; Validated Back     alignment and domain information
>gnl|CDD|235250 PRK04195, PRK04195, replication factor C large subunit; Provisional Back     alignment and domain information
>gnl|CDD|236545 PRK09510, tolA, cell envelope integrity inner membrane protein TolA; Provisional Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|234750 PRK00409, PRK00409, recombination and DNA strand exchange inhibitor protein; Reviewed Back     alignment and domain information
>gnl|CDD|206039 pfam13868, Trichoplein, Tumour suppressor, Mitostatin Back     alignment and domain information
>gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional Back     alignment and domain information
>gnl|CDD|225288 COG2433, COG2433, Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>gnl|CDD|179385 PRK02224, PRK02224, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|217051 pfam02463, SMC_N, RecF/RecN/SMC N terminal domain Back     alignment and domain information
>gnl|CDD|237177 PRK12704, PRK12704, phosphodiesterase; Provisional Back     alignment and domain information
>gnl|CDD|233757 TIGR02168, SMC_prok_B, chromosome segregation protein SMC, common bacterial type Back     alignment and domain information
>gnl|CDD|225288 COG2433, COG2433, Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>gnl|CDD|220684 pfam10310, DUF2413, Protein of unknown function (DUF2413) Back     alignment and domain information
>gnl|CDD|236081 PRK07735, PRK07735, NADH dehydrogenase subunit C; Validated Back     alignment and domain information
>gnl|CDD|235175 PRK03918, PRK03918, chromosome segregation protein; Provisional Back     alignment and domain information
>gnl|CDD|219563 pfam07767, Nop53, Nop53 (60S ribosomal biogenesis) Back     alignment and domain information
>gnl|CDD|237110 PRK12472, PRK12472, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|226889 COG4487, COG4487, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>gnl|CDD|222931 PHA02798, PHA02798, ankyrin-like protein; Provisional Back     alignment and domain information
>gnl|CDD|220383 pfam09756, DDRGK, DDRGK domain Back     alignment and domain information
>gnl|CDD|224117 COG1196, Smc, Chromosome segregation ATPases [Cell division and chromosome partitioning] Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|197603 smart00248, ANK, ankyrin repeats Back     alignment and domain information
>gnl|CDD|233191 TIGR00927, 2A1904, K+-dependent Na+/Ca+ exchanger Back     alignment and domain information
>gnl|CDD|114011 pfam05262, Borrelia_P83, Borrelia P83/100 protein Back     alignment and domain information
>gnl|CDD|178945 PRK00247, PRK00247, putative inner membrane protein translocase component YidC; Validated Back     alignment and domain information
>gnl|CDD|221408 pfam12072, DUF3552, Domain of unknown function (DUF3552) Back     alignment and domain information
>gnl|CDD|219461 pfam07543, PGA2, Protein trafficking PGA2 Back     alignment and domain information
>gnl|CDD|178867 PRK00106, PRK00106, hypothetical protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 596
PHA02876682 ankyrin repeat protein; Provisional 100.0
PHA02946446 ankyin-like protein; Provisional 100.0
PHA02876682 ankyrin repeat protein; Provisional 100.0
KOG4369|consensus 2131 100.0
PHA02730672 ankyrin-like protein; Provisional 100.0
PHA02874434 ankyrin repeat protein; Provisional 100.0
PHA02917661 ankyrin-like protein; Provisional 100.0
PHA02716764 CPXV016; CPX019; EVM010; Provisional 100.0
PHA02716764 CPXV016; CPX019; EVM010; Provisional 100.0
PHA02946446 ankyin-like protein; Provisional 100.0
PHA03095471 ankyrin-like protein; Provisional 100.0
KOG0510|consensus 929 100.0
PHA02874434 ankyrin repeat protein; Provisional 100.0
PHA02730672 ankyrin-like protein; Provisional 100.0
KOG0510|consensus 929 100.0
PHA03095471 ankyrin-like protein; Provisional 100.0
PHA03100480 ankyrin repeat protein; Provisional 100.0
PHA03100480 ankyrin repeat protein; Provisional 100.0
PHA02878477 ankyrin repeat protein; Provisional 100.0
KOG4177|consensus 1143 100.0
PHA02878477 ankyrin repeat protein; Provisional 100.0
PHA02917661 ankyrin-like protein; Provisional 100.0
KOG4177|consensus 1143 100.0
PHA02989494 ankyrin repeat protein; Provisional 100.0
PHA02989494 ankyrin repeat protein; Provisional 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
PHA02875413 ankyrin repeat protein; Provisional 100.0
PHA02792631 ankyrin-like protein; Provisional 100.0
PHA02798489 ankyrin-like protein; Provisional 100.0
PHA02791284 ankyrin-like protein; Provisional 100.0
PHA02798489 ankyrin-like protein; Provisional 100.0
PHA02875413 ankyrin repeat protein; Provisional 100.0
KOG0508|consensus615 100.0
KOG0508|consensus615 100.0
KOG4412|consensus226 100.0
PHA02792631 ankyrin-like protein; Provisional 100.0
KOG4412|consensus226 99.98
KOG4369|consensus 2131 99.97
KOG0509|consensus600 99.97
KOG0509|consensus600 99.97
PHA02795437 ankyrin-like protein; Provisional 99.96
PHA02795437 ankyrin-like protein; Provisional 99.95
PHA02859209 ankyrin repeat protein; Provisional 99.95
PHA02859209 ankyrin repeat protein; Provisional 99.94
KOG0502|consensus296 99.92
KOG0502|consensus296 99.92
KOG0507|consensus 854 99.91
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.91
KOG0507|consensus 854 99.91
PLN03192823 Voltage-dependent potassium channel; Provisional 99.91
TIGR00870 743 trp transient-receptor-potential calcium channel p 99.91
KOG0505|consensus527 99.89
PLN03192823 Voltage-dependent potassium channel; Provisional 99.88
KOG0505|consensus527 99.88
KOG0514|consensus452 99.87
KOG0514|consensus452 99.86
PHA02743166 Viral ankyrin protein; Provisional 99.86
PHA02743166 Viral ankyrin protein; Provisional 99.84
PHA02884300 ankyrin repeat protein; Provisional 99.84
PHA02741169 hypothetical protein; Provisional 99.83
PHA02884300 ankyrin repeat protein; Provisional 99.82
PHA02741169 hypothetical protein; Provisional 99.8
PHA02736154 Viral ankyrin protein; Provisional 99.8
PHA02736154 Viral ankyrin protein; Provisional 99.77
KOG0512|consensus228 99.76
KOG0512|consensus228 99.75
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.72
KOG3676|consensus 782 99.72
KOG0195|consensus448 99.71
KOG3676|consensus 782 99.69
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.69
PF1279689 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 99.68
KOG0195|consensus448 99.67
cd00204126 ANK ankyrin repeats; ankyrin repeats mediate prote 99.65
KOG4214|consensus117 99.58
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.51
COG0666235 Arp FOG: Ankyrin repeat [General function predicti 99.5
KOG4214|consensus117 99.46
KOG1710|consensus396 99.39
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.38
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.37
KOG0515|consensus752 99.36
PF1363754 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 99.35
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.34
KOG1710|consensus396 99.34
PTZ00322 664 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas 99.29
KOG0515|consensus752 99.28
PF1385756 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 99.24
KOG0818|consensus 669 98.77
KOG0783|consensus 1267 98.71
PF1360630 Ank_3: Ankyrin repeat 98.68
KOG0818|consensus 669 98.65
KOG0782|consensus1004 98.63
PF1360630 Ank_3: Ankyrin repeat 98.62
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.59
KOG0783|consensus 1267 98.56
KOG0782|consensus1004 98.53
KOG0705|consensus749 98.48
KOG0506|consensus622 98.48
PF0002333 Ank: Ankyrin repeat Hereditary spherocytosis; Inte 98.47
KOG0506|consensus622 98.45
KOG3609|consensus 822 98.44
KOG2384|consensus223 98.43
KOG0705|consensus749 98.42
KOG0522|consensus 560 98.37
KOG0521|consensus785 98.33
KOG0522|consensus 560 98.29
KOG3609|consensus 822 98.22
PTZ00121 2084 MAEBL; Provisional 98.19
KOG0511|consensus 516 98.18
KOG0511|consensus516 98.1
KOG2505|consensus591 98.1
KOG4364|consensus 811 98.07
KOG0520|consensus975 97.88
KOG2384|consensus223 97.83
KOG0521|consensus785 97.77
PTZ00266 1021 NIMA-related protein kinase; Provisional 97.56
KOG0520|consensus975 97.56
KOG2505|consensus591 97.3
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 96.95
PF03158192 DUF249: Multigene family 530 protein; InterPro: IP 96.84
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 96.61
smart0024830 ANK ankyrin repeats. Ankyrin repeats are about 33 96.51
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 96.49
PF06128284 Shigella_OspC: Shigella flexneri OspC protein; Int 96.47
PLN032181060 maturation of RBCL 1; Provisional 95.86
PF05262489 Borrelia_P83: Borrelia P83/100 protein; InterPro: 95.86
PLN032181060 maturation of RBCL 1; Provisional 95.52
KOG2072|consensus 988 95.3
PF05262489 Borrelia_P83: Borrelia P83/100 protein; InterPro: 95.04
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 94.98
PLN03081697 pentatricopeptide (PPR) repeat-containing protein; 94.62
PLN03077857 Protein ECB2; Provisional 92.97
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 92.78
PF1192976 DUF3447: Domain of unknown function (DUF3447); Int 92.61
PLN03077 857 Protein ECB2; Provisional 92.1
PF07946321 DUF1682: Protein of unknown function (DUF1682); In 91.57
PF07946321 DUF1682: Protein of unknown function (DUF1682); In 89.45
cd07920322 Pumilio Pumilio-family RNA binding domain. Puf rep 88.56
PF1543786 PGBA_C: Plasminogen-binding protein pgbA C-termina 81.62
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
Probab=100.00  E-value=1.6e-45  Score=412.99  Aligned_cols=332  Identities=25%  Similarity=0.304  Sum_probs=287.7

Q ss_pred             CCCCCcHHHHHHhcCcHHHHHHHHHCCCC-ccccCCCCCcHHHHHH----------------------------------
Q psy904            8 ESNHDTALTLACAGGHEELVELLLSRGAD-IEHRDKKGFTPLILAA----------------------------------   52 (596)
Q Consensus         8 d~~g~t~L~~A~~~g~~~ivk~Ll~~g~~-i~~~d~~g~t~L~~A~----------------------------------   52 (596)
                      ++.+.||||.||..|+.++|++|++.+.+ ++..|..|.||||+|+                                  
T Consensus        38 ~~~~~t~LH~A~~~g~~e~V~~ll~~~~~~~~~~~~~~~tpLh~a~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~  117 (682)
T PHA02876         38 ESIPFTAIHQALQLRQIDIVEEIIQQNPELIYITDHKCHSTLHTICIIPNVMDIVISLTLDCDIILDIKYASIILNKHKL  117 (682)
T ss_pred             ccccchHHHHHHHHHhhhHHHHHHHhCcccchhhchhhccccccccCCCCccccccccccchhhcccccHHHHHHHHHHH
Confidence            46789999999999999999999998766 5667788999999666                                  


Q ss_pred             ------------------------------------HcCCHHHHHHHHhCCCCccccccCCCChHHHHHHHCCcHHHHHH
Q psy904           53 ------------------------------------TAGHDKVVDILLNHKADMEAQSERTKDTPLSLACSGGRYEVVEL   96 (596)
Q Consensus        53 ------------------------------------~~g~~eiv~~Ll~~~~~~~~~~~~~~~t~L~~A~~~g~~eivk~   96 (596)
                                                          ..|+.+++++|++.|++++.. +..|.||||+|+..|+.++|++
T Consensus       118 ~~~~~~il~~~~~~~~~~~~~~~~~~~~~~~l~~~i~~~~~~i~k~Ll~~Gadvn~~-d~~G~TpLh~Aa~~G~~~iv~~  196 (682)
T PHA02876        118 DEACIHILKEAISGNDIHYDKINESIEYMKLIKERIQQDELLIAEMLLEGGADVNAK-DIYCITPIHYAAERGNAKMVNL  196 (682)
T ss_pred             HHHHHHHHHHHhcCCcccHHhhccchhhhHHHHHHHHCCcHHHHHHHHhCCCCCCCC-CCCCCCHHHHHHHCCCHHHHHH
Confidence                                                456788999999999998865 5679999999999999999999


Q ss_pred             HHhCCCCccCCCCCCCcHHHHHHhcCCHHHHHHHHhCCCCcc---------------------------ccCCCCCCCcH
Q psy904           97 LLTRGANKEHRNVSDYTPLSLAASGGYVNIIKLLLTHGAEIN---------------------------SRTGSKLGISP  149 (596)
Q Consensus        97 LL~~g~~~~~~d~~g~t~L~~A~~~g~~eiv~~Ll~~g~~~~---------------------------~~~~~~~g~t~  149 (596)
                      |+++|++++..+..|.||||+|+..|+.+++++|++.+.+++                           ....+..|.||
T Consensus       197 LL~~Gad~n~~~~~g~t~L~~A~~~~~~~ivk~Ll~~~~~~~~~~~~L~~ai~~~~~~~~~~Ll~~g~~vn~~d~~g~Tp  276 (682)
T PHA02876        197 LLSYGADVNIIALDDLSVLECAVDSKNIDTIKAIIDNRSNINKNDLSLLKAIRNEDLETSLLLYDAGFSVNSIDDCKNTP  276 (682)
T ss_pred             HHHCCCCcCccCCCCCCHHHHHHHcCCHHHHHHHHhcCCCCCCCcHHHHHHHHcCCHHHHHHHHHCCCCCCCCCCCCCCH
Confidence            999999999999999999999999999888888776654432                           11223458899


Q ss_pred             HHHHHHcCCH-HHHHHHHhcCCCcccccccCCCcHHHHHHHcC-CHHHHHHHHhcCCCcccccCCCChHHHHHHhc-CcH
Q psy904          150 LMLAAMNGHT-AAVKLLLDMGSDINAQIETNRNTALTLACFQG-RHEVVSLLLDRKANVEHRAKTGLTPLMEAASG-GYV  226 (596)
Q Consensus       150 L~~A~~~g~~-eiv~~Ll~~~~~~~~~~~~~~~t~L~~A~~~~-~~~ii~~Ll~~g~~~~~~~~~g~t~L~~A~~~-g~~  226 (596)
                      ||+|+..|+. .++++|+..|++++.. +..|.||||+|+..| ..+++++|+..|++++..+..|.||||+|+.. ++.
T Consensus       277 Lh~Aa~~~~~~~iv~lLl~~gadin~~-d~~g~TpLh~Aa~~g~~~~~v~~Ll~~gadin~~d~~g~TpLh~A~~~~~~~  355 (682)
T PHA02876        277 LHHASQAPSLSRLVPKLLERGADVNAK-NIKGETPLYLMAKNGYDTENIRTLIMLGADVNAADRLYITPLHQASTLDRNK  355 (682)
T ss_pred             HHHHHhCCCHHHHHHHHHHCCCCCCCc-CCCCCCHHHHHHHhCCCHHHHHHHHHcCCCCCCcccCCCcHHHHHHHhCCcH
Confidence            9999999986 5899999999998876 678899999999998 58999999999999999999999999999885 578


Q ss_pred             HHHHHHHhCCCCCCCCCCCCCCCcHHHHHHHcCcHHHHHHHHHCCCCCCCCCCCCChHHHHHHhcCc-HHHHHHHHHCCC
Q psy904          227 EVGRVLLDKGADVNAPPVPSSRDTALTIAADKGHCRFVELLLSKGAQVEVKNKKGNSPLWLAANGGH-LSVVELLCKHGA  305 (596)
Q Consensus       227 ~iv~~Ll~~g~~~~~~~~~~~g~t~L~~A~~~~~~~iv~~Ll~~g~di~~~d~~g~TpL~~A~~~g~-~~iv~~Ll~~ga  305 (596)
                      +++.+|+..|++++.  .+..|.||||+|+..|+.+++++|+++|++++..+..|.||||+|+..++ ..++++|+++|+
T Consensus       356 ~iv~lLl~~gadin~--~d~~G~TpLh~Aa~~~~~~iv~~Ll~~gad~~~~~~~g~T~Lh~A~~~~~~~~~vk~Ll~~ga  433 (682)
T PHA02876        356 DIVITLLELGANVNA--RDYCDKTPIHYAAVRNNVVIINTLLDYGADIEALSQKIGTALHFALCGTNPYMSVKTLIDRGA  433 (682)
T ss_pred             HHHHHHHHcCCCCcc--CCCCCCCHHHHHHHcCCHHHHHHHHHCCCCccccCCCCCchHHHHHHcCCHHHHHHHHHhCCC
Confidence            899999999999887  56789999999999999999999999999999999999999999987655 567899999999


Q ss_pred             CcccCCCCCCCHHHHHHHcC-CHHHHHHHHhCcCCCCCc
Q psy904          306 DIDSQDNRKVSCLMAAFRKG-HVKAVRWMVNHVAQFPSD  343 (596)
Q Consensus       306 d~~~~~~~g~t~L~~A~~~g-~~~iv~~Ll~~~~~~~~~  343 (596)
                      +++.+|..|.||||+|+..| +.+++++|+++|+++...
T Consensus       434 din~~d~~G~TpLh~Aa~~~~~~~iv~lLl~~Gad~n~~  472 (682)
T PHA02876        434 NVNSKNKDLSTPLHYACKKNCKLDVIEMLLDNGADVNAI  472 (682)
T ss_pred             CCCcCCCCCChHHHHHHHhCCcHHHHHHHHHCCCCCCCC
Confidence            99999999999999999876 689999999999976543



>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA02876 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG4369|consensus Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02716 CPXV016; CPX019; EVM010; Provisional Back     alignment and domain information
>PHA02946 ankyin-like protein; Provisional Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0510|consensus Back     alignment and domain information
>PHA02874 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02730 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG0510|consensus Back     alignment and domain information
>PHA03095 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA03100 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG4177|consensus Back     alignment and domain information
>PHA02878 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02917 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4177|consensus Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02989 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02791 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02798 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02875 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0508|consensus Back     alignment and domain information
>KOG0508|consensus Back     alignment and domain information
>KOG4412|consensus Back     alignment and domain information
>PHA02792 ankyrin-like protein; Provisional Back     alignment and domain information
>KOG4412|consensus Back     alignment and domain information
>KOG4369|consensus Back     alignment and domain information
>KOG0509|consensus Back     alignment and domain information
>KOG0509|consensus Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02795 ankyrin-like protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02859 ankyrin repeat protein; Provisional Back     alignment and domain information
>KOG0502|consensus Back     alignment and domain information
>KOG0502|consensus Back     alignment and domain information
>KOG0507|consensus Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG0507|consensus Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>KOG0505|consensus Back     alignment and domain information
>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG0505|consensus Back     alignment and domain information
>KOG0514|consensus Back     alignment and domain information
>KOG0514|consensus Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02743 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02884 ankyrin repeat protein; Provisional Back     alignment and domain information
>PHA02741 hypothetical protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>PHA02736 Viral ankyrin protein; Provisional Back     alignment and domain information
>KOG0512|consensus Back     alignment and domain information
>KOG0512|consensus Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>KOG3676|consensus Back     alignment and domain information
>KOG0195|consensus Back     alignment and domain information
>KOG3676|consensus Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>KOG0195|consensus Back     alignment and domain information
>cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins Back     alignment and domain information
>KOG4214|consensus Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>COG0666 Arp FOG: Ankyrin repeat [General function prediction only] Back     alignment and domain information
>KOG4214|consensus Back     alignment and domain information
>KOG1710|consensus Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG1710|consensus Back     alignment and domain information
>PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional Back     alignment and domain information
>KOG0515|consensus Back     alignment and domain information
>PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A Back     alignment and domain information
>KOG0818|consensus Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>KOG0818|consensus Back     alignment and domain information
>KOG0782|consensus Back     alignment and domain information
>PF13606 Ank_3: Ankyrin repeat Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0783|consensus Back     alignment and domain information
>KOG0782|consensus Back     alignment and domain information
>KOG0705|consensus Back     alignment and domain information
>KOG0506|consensus Back     alignment and domain information
>PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature Back     alignment and domain information
>KOG0506|consensus Back     alignment and domain information
>KOG3609|consensus Back     alignment and domain information
>KOG2384|consensus Back     alignment and domain information
>KOG0705|consensus Back     alignment and domain information
>KOG0522|consensus Back     alignment and domain information
>KOG0521|consensus Back     alignment and domain information
>KOG0522|consensus Back     alignment and domain information
>KOG3609|consensus Back     alignment and domain information
>PTZ00121 MAEBL; Provisional Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>KOG0511|consensus Back     alignment and domain information
>KOG2505|consensus Back     alignment and domain information
>KOG4364|consensus Back     alignment and domain information
>KOG0520|consensus Back     alignment and domain information
>KOG2384|consensus Back     alignment and domain information
>KOG0521|consensus Back     alignment and domain information
>PTZ00266 NIMA-related protein kinase; Provisional Back     alignment and domain information
>KOG0520|consensus Back     alignment and domain information
>KOG2505|consensus Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>smart00248 ANK ankyrin repeats Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>PF05262 Borrelia_P83: Borrelia P83/100 protein; InterPro: IPR007926 This family consists of several Borrelia P83/P100 antigen proteins Back     alignment and domain information
>PLN03218 maturation of RBCL 1; Provisional Back     alignment and domain information
>KOG2072|consensus Back     alignment and domain information
>PF05262 Borrelia_P83: Borrelia P83/100 protein; InterPro: IPR007926 This family consists of several Borrelia P83/P100 antigen proteins Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain Back     alignment and domain information
>PLN03077 Protein ECB2; Provisional Back     alignment and domain information
>PF07946 DUF1682: Protein of unknown function (DUF1682); InterPro: IPR012879 The members of this family are all hypothetical eukaryotic proteins of unknown function Back     alignment and domain information
>PF07946 DUF1682: Protein of unknown function (DUF1682); InterPro: IPR012879 The members of this family are all hypothetical eukaryotic proteins of unknown function Back     alignment and domain information
>cd07920 Pumilio Pumilio-family RNA binding domain Back     alignment and domain information
>PF15437 PGBA_C: Plasminogen-binding protein pgbA C-terminal Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query596
1n11_A437 D34 Region Of Human Ankyrin-R And Linker Length = 4 3e-38
1n11_A437 D34 Region Of Human Ankyrin-R And Linker Length = 4 3e-14
3utm_A351 Crystal Structure Of A Mouse Tankyrase-Axin Complex 2e-24
3utm_A351 Crystal Structure Of A Mouse Tankyrase-Axin Complex 1e-20
3utm_A351 Crystal Structure Of A Mouse Tankyrase-Axin Complex 1e-09
2xeh_A157 Structural Determinants For Improved Thermal Stabil 7e-23
2xeh_A157 Structural Determinants For Improved Thermal Stabil 1e-21
2xee_A157 Structural Determinants For Improved Thermal Stabil 1e-22
2xee_A157 Structural Determinants For Improved Thermal Stabil 1e-20
2xee_A157 Structural Determinants For Improved Thermal Stabil 5e-20
4g8k_A337 Intact Sensor Domain Of Human Rnase L In The Inacti 3e-22
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 4e-22
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 7e-22
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 2e-20
4gmr_A169 Crystal Structure Of Engineered Protein. Northeast 3e-17
1wdy_A285 Crystal Structure Of Ribonuclease Length = 285 4e-22
1wdy_A285 Crystal Structure Of Ribonuclease Length = 285 5e-12
1wdy_A285 Crystal Structure Of Ribonuclease Length = 285 7e-07
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 1e-21
4hqd_A169 Crystal Structure Of Engineered Protein. Northeast 2e-17
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 2e-21
4gpm_A169 Crystal Structure Of Engineered Protein. Northeast 5e-18
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 2e-21
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 4e-19
4f6r_D169 Tubulin:stathmin-Like Domain Complex Length = 169 2e-17
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 3e-21
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 2e-20
1mj0_A166 Sank E3_5: An Artificial Ankyrin Repeat Protein Len 6e-18
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 4e-21
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 5e-20
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 1e-18
1svx_A169 Crystal Structure Of A Designed Selected Ankyrin Re 7e-16
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 7e-21
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 2e-20
2qyj_A166 Crystal Structure Of A Designed Full Consensus Anky 4e-20
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 8e-21
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 1e-20
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 3e-19
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 9e-19
3zu7_B169 Crystal Structure Of A Designed Selected Ankyrin Re 1e-17
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 2e-20
3nog_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 1e-15
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 2e-20
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 3e-20
1n0r_A126 4ank: A Designed Ankyrin Repeat Protein With Four I 5e-20
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 4e-20
2j8s_D169 Drug Export Pathway Of Multidrug Exporter Acrb Reve 5e-17
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 5e-20
4hb5_A169 Crystal Structure Of Engineered Protein. Northeast 2e-16
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 5e-20
4drx_E169 Gtp-Tubulin In Complex With A Darpin Length = 169 5e-16
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 6e-20
4dui_A169 Darpin D1 Binding To Tubulin Beta Chain (not In Com 5e-16
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 6e-20
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 2e-19
2v5q_C167 Crystal Structure Of Wild-type Plk-1 Kinase Domain 1e-15
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 7e-20
4atz_D154 Ad5 Knob In Complex With A Designed Ankyrin Repeat 1e-15
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 1e-19
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 3e-19
2bkg_A166 Crystal Structure Of E3_19 An Designed Ankyrin Repe 2e-16
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 1e-19
3q9u_C158 In Silico And In Vitro Co-Evolution Of A High Affin 2e-19
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 1e-19
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 9e-18
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 2e-17
2bkk_B169 Crystal Structure Of Aminoglycoside Phosphotransfer 2e-14
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 1e-19
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 2e-19
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 6e-19
2p2c_P169 Inhibition Of Caspase-2 By A Designed Ankyrin Repea 1e-16
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 3e-19
3noc_D169 Designed Ankyrin Repeat Protein (Darpin) Binders To 2e-16
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 5e-19
2y1l_E169 Caspase-8 In Complex With Darpin-8.4 Length = 169 4e-14
1uoh_A226 Human Gankyrin Length = 226 2e-18
1uoh_A226 Human Gankyrin Length = 226 9e-16
1uoh_A226 Human Gankyrin Length = 226 3e-13
1uoh_A226 Human Gankyrin Length = 226 3e-08
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 2e-18
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 1e-15
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 4e-13
1qym_A227 X-Ray Structure Of Human Gankyrin Length = 227 3e-08
2dvw_A231 Structure Of The Oncoprotein Gankyrin In Complex Wi 5e-18
2dvw_A231 Structure Of The Oncoprotein Gankyrin In Complex Wi 5e-15
2dvw_A231 Structure Of The Oncoprotein Gankyrin In Complex Wi 9e-13
3aji_A231 Structure Of Gankyrin-S6atpase Photo-Cross-Linked S 7e-18
3aji_A231 Structure Of Gankyrin-S6atpase Photo-Cross-Linked S 7e-15
3aji_A231 Structure Of Gankyrin-S6atpase Photo-Cross-Linked S 6e-12
3b7b_A237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 3e-17
3b7b_A237 Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le 2e-09
4b93_B269 Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyri 9e-16
4b93_B269 Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyri 6e-11
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 4e-15
2v4h_C136 Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 2e-11
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 6e-15
2l6b_A115 Nrc Consensus Ankyrin Repeat Protein Solution Struc 6e-09
1awc_B153 Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 1 1e-14
1awc_B153 Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 1 1e-11
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 1e-14
1n0q_A93 3ank: A Designed Ankyrin Repeat Protein With Three 3e-13
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 2e-14
3zuv_B136 Crystal Structure Of A Designed Selected Ankyrin Re 2e-10
2rfm_A192 Structure Of A Thermophilic Ankyrin Repeat Protein 4e-14
2rfm_A192 Structure Of A Thermophilic Ankyrin Repeat Protein 4e-08
3zkj_A261 Crystal Structure Of Ankyrin Repeat And Socs Box-co 6e-14
3zkj_A261 Crystal Structure Of Ankyrin Repeat And Socs Box-co 4e-12
3zkj_A261 Crystal Structure Of Ankyrin Repeat And Socs Box-co 3e-09
2y0b_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4_ 1e-13
2y0b_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4_ 1e-07
2xzt_G136 Caspase-3 In Complex With Darpin-3.4_i78s Length = 1e-13
2xzt_G136 Caspase-3 In Complex With Darpin-3.4_i78s Length = 8e-08
2xzd_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4 2e-13
2xzd_G136 Caspase-3 In Complex With An Inhibitory Darpin-3.4 2e-07
3d9h_A285 Crystal Structure Of The Splice Variant Of Human As 4e-13
3d9h_A285 Crystal Structure Of The Splice Variant Of Human As 3e-11
3d9h_A285 Crystal Structure Of The Splice Variant Of Human As 5e-09
4grg_A135 Crystal Structure Of Ige Complexed With E2_79, An A 7e-13
4grg_A135 Crystal Structure Of Ige Complexed With E2_79, An A 3e-06
3hg0_D136 Crystal Structure Of A Darpin In Complex With Orf49 8e-13
3hg0_D136 Crystal Structure Of A Darpin In Complex With Orf49 5e-07
2jab_A136 A Designed Ankyrin Repeat Protein Evolved To Picomo 8e-13
2jab_A136 A Designed Ankyrin Repeat Protein Evolved To Picomo 4e-08
3eu9_A240 The Ankyrin Repeat Domain Of Huntingtin Interacting 9e-13
3eu9_A240 The Ankyrin Repeat Domain Of Huntingtin Interacting 2e-06
3so8_A162 Crystal Structure Of Ankra Length = 162 2e-12
3so8_A162 Crystal Structure Of Ankra Length = 162 2e-11
3so8_A162 Crystal Structure Of Ankra Length = 162 1e-04
3v2o_A183 Crystal Structure Of The Peptide Bound Complex Of T 2e-12
3v2o_A183 Crystal Structure Of The Peptide Bound Complex Of T 2e-11
3v2o_A183 Crystal Structure Of The Peptide Bound Complex Of T 1e-04
3v2x_A167 Crystal Structure Of The Peptide Bound Complex Of T 2e-12
3v2x_A167 Crystal Structure Of The Peptide Bound Complex Of T 3e-11
3v2x_A167 Crystal Structure Of The Peptide Bound Complex Of T 1e-04
3uxg_A172 Crystal Structure Of Rfxank Length = 172 4e-12
3twr_A165 Crystal Structure Of Arc4 From Human Tankyrase 2 In 4e-12
3twr_A165 Crystal Structure Of Arc4 From Human Tankyrase 2 In 8e-12
3twr_A165 Crystal Structure Of Arc4 From Human Tankyrase 2 In 2e-09
3twq_A175 Crystal Structure Of Arc4 From Human Tankyrase 2 (A 4e-12
3twq_A175 Crystal Structure Of Arc4 From Human Tankyrase 2 (A 1e-11
3twq_A175 Crystal Structure Of Arc4 From Human Tankyrase 2 (A 2e-09
3twu_A167 Crystal Structure Of Arc4 From Human Tankyrase 2 In 4e-12
3twu_A167 Crystal Structure Of Arc4 From Human Tankyrase 2 In 9e-12
3twu_A167 Crystal Structure Of Arc4 From Human Tankyrase 2 In 2e-09
3v30_A172 Crystal Structure Of The Peptide Bound Complex Of T 5e-12
2dzn_A228 Crystal Structure Analysis Of Yeast Nas6p Complexed 2e-11
1ixv_A231 Crystal Structure Analysis Of Homolog Of Oncoprotei 2e-11
1wg0_A243 Structural Comparison Of Nas6p Protein Structures I 2e-11
1s70_B299 Complex Between Protein Ser/thr Phosphatase-1 (delt 2e-10
3c5r_A137 Crystal Structure Of The Bard1 Ankyrin Repeat Domai 2e-10
3c5r_A137 Crystal Structure Of The Bard1 Ankyrin Repeat Domai 6e-09
1ot8_A239 Structure Of The Ankyrin Domain Of The Drosophila N 3e-10
1k1b_A241 Crystal Structure Of The Ankyrin Repeat Domain Of B 3e-10
1ikn_D236 IkappabalphaNF-Kappab Complex Length = 236 4e-10
1ikn_D236 IkappabalphaNF-Kappab Complex Length = 236 6e-06
1nfi_E213 I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 6e-10
1nfi_E213 I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 7e-06
2kbx_A171 Solution Structure Of Ilk-Pinch Complex Length = 17 1e-09
2kbx_A171 Solution Structure Of Ilk-Pinch Complex Length = 17 2e-08
2kbx_A171 Solution Structure Of Ilk-Pinch Complex Length = 17 4e-08
2kbx_A171 Solution Structure Of Ilk-Pinch Complex Length = 17 1e-04
3f6q_A179 Crystal Structure Of Integrin-Linked Kinase Ankyrin 1e-09
3f6q_A179 Crystal Structure Of Integrin-Linked Kinase Ankyrin 3e-08
3f6q_A179 Crystal Structure Of Integrin-Linked Kinase Ankyrin 3e-06
3f6q_A179 Crystal Structure Of Integrin-Linked Kinase Ankyrin 1e-04
2f8x_K256 Crystal Structure Of Activated Notch, Csl And Maml 4e-09
2f8x_K256 Crystal Structure Of Activated Notch, Csl And Maml 8e-08
2xen_A91 Structural Determinants For Improved Thermal Stabil 1e-08
2xen_A91 Structural Determinants For Improved Thermal Stabil 7e-08
1yyh_A253 Crystal Structure Of The Human Notch 1 Ankyrin Doma 1e-08
1yyh_A253 Crystal Structure Of The Human Notch 1 Ankyrin Doma 1e-07
2he0_A253 Crystal Structure Of A Human Notch1 Ankyrin Domain 2e-08
2he0_A253 Crystal Structure Of A Human Notch1 Ankyrin Domain 2e-07
3hra_A201 Crystal Structure Of Ef0377 An Ankyrin Repeat Prote 2e-08
3hra_A201 Crystal Structure Of Ef0377 An Ankyrin Repeat Prote 7e-04
2zgg_A92 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 1e-07
2zgd_A110 Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom 2e-07
2qc9_A210 Mouse Notch 1 Ankyrin Repeat Intracellular Domain L 9e-07
2qc9_A210 Mouse Notch 1 Ankyrin Repeat Intracellular Domain L 1e-06
2qc9_A210 Mouse Notch 1 Ankyrin Repeat Intracellular Domain L 3e-06
2fo1_E373 Crystal Structure Of The Csl-Notch-Mastermind Terna 9e-07
1ymp_A135 The Crystal Structure Of A Partial Mouse Notch-1 An 1e-06
2f8y_A223 Crystal Structure Of Human Notch1 Ankyrin Repeats T 1e-06
2f8y_A223 Crystal Structure Of Human Notch1 Ankyrin Repeats T 2e-06
1mx6_A168 Structure Of P18ink4c (F92n) Length = 168 2e-06
1mx6_A168 Structure Of P18ink4c (F92n) Length = 168 1e-05
1mx6_A168 Structure Of P18ink4c (F92n) Length = 168 1e-04
1bi8_B166 Mechanism Of G1 Cyclin Dependent Kinase Inhibition 2e-06
1bi8_B166 Mechanism Of G1 Cyclin Dependent Kinase Inhibition 2e-05
1bi8_B166 Mechanism Of G1 Cyclin Dependent Kinase Inhibition 8e-05
1ihb_A162 Crystal Structure Of P18-Ink4c(Ink6) Length = 162 2e-06
1ihb_A162 Crystal Structure Of P18-Ink4c(Ink6) Length = 162 2e-05
1ihb_A162 Crystal Structure Of P18-Ink4c(Ink6) Length = 162 2e-04
1bd8_A156 Structure Of Cdk Inhibitor P19ink4d Length = 156 2e-06
1bd8_A156 Structure Of Cdk Inhibitor P19ink4d Length = 156 2e-05
1bd8_A156 Structure Of Cdk Inhibitor P19ink4d Length = 156 9e-05
1mx4_A168 Structure Of P18ink4c (F82q) Length = 168 3e-06
1mx4_A168 Structure Of P18ink4c (F82q) Length = 168 1e-05
1mx4_A168 Structure Of P18ink4c (F82q) Length = 168 2e-05
1bu9_A168 Solution Structure Of P18-Ink4c, 21 Structures Leng 3e-06
1bu9_A168 Solution Structure Of P18-Ink4c, 21 Structures Leng 2e-05
1bu9_A168 Solution Structure Of P18-Ink4c, 21 Structures Leng 2e-04
3aaa_C123 Crystal Structure Of Actin Capping Protein In Compl 4e-06
1ap7_A168 P19-Ink4d From Mouse, Nmr, 20 Structures Length = 1 1e-05
1ap7_A168 P19-Ink4d From Mouse, Nmr, 20 Structures Length = 1 3e-05
1blx_B166 P19ink4dCDK6 COMPLEX Length = 166 1e-05
1blx_B166 P19ink4dCDK6 COMPLEX Length = 166 3e-05
1myo_A118 Solution Structure Of Myotrophin, Nmr, 44 Structure 1e-05
1myo_A118 Solution Structure Of Myotrophin, Nmr, 44 Structure 2e-05
1mx2_A168 Structure Of F71n Mutant Of P18ink4c Length = 168 1e-05
1mx2_A168 Structure Of F71n Mutant Of P18ink4c Length = 168 2e-05
1mx2_A168 Structure Of F71n Mutant Of P18ink4c Length = 168 2e-05
4hbd_A276 Crystal Structure Of Kank2 Ankyrin Repeats Length = 2e-05
3deo_A183 Structural Basis For Specific Substrate Recognition 6e-05
2rfa_A232 Crystal Structure Of The Mouse Trpv6 Ankyrin Repeat 7e-05
3ui2_A244 Crystal Structure Of The Cpsrp54 Tail Bound To Cpsr 9e-05
1oy3_D282 Crystal Structure Of An IkbbetaNF-Kb P65 Homodimer 3e-04
1k3z_D282 X-Ray Crystal Structure Of The IkbbNF-Kb P65 Homodi 3e-04
3ehq_A222 Crystal Structure Of Human Osteoclast Stimulating F 6e-04
2vge_A229 Crystal Structure Of The C-Terminal Region Of Human 7e-04
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure

Iteration: 1

Score = 142 bits (357), Expect = 7e-34, Method: Compositional matrix adjust. Identities = 123/361 (34%), Positives = 177/361 (49%), Gaps = 18/361 (4%) Query: 12 DTALTLACAG--GHEELVELLLSRGADIEHRDKKGFTPLILAATAGHDKVVDILLNHKAD 69 D L CA GH +V+LLL A+ G TPL +AA GH + V LL +A Sbjct: 79 DDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEAS 138 Query: 70 MEAQSERTKDTPLSLACSGGRYEVVELLLTRGANKEHRNVSDYTPLSLAASGGYVNIIKL 129 +++ TPL +A G+ V ELLL R A+ + TPL +A ++I+KL Sbjct: 139 QACMTKK-GFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKL 197 Query: 130 LLTHGAEINSRTGSKLGISPLMLAAMNGHTAAVKLLLDMGSDINAQIETNRNTALTLACF 189 LL G +S + G +PL +AA + LL G NA+ T L LA Sbjct: 198 LLPRGGSPHSPAWN--GYTPLHIAAKQNQVEVARSLLQYGGSANAE-SVQGVTPLHLAAQ 254 Query: 190 QGRHEVVSLLLDRKANVEHRAKTGLTPLMEAASGGYVEVGRVLLDKGADVNAPPVPSSR- 248 +G E+V+LLL ++AN K+GLTPL A G+V V VL+ G V+A ++R Sbjct: 255 EGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDA----TTRM 310 Query: 249 -DTALTIAADKGHCRFVELLLSKGAQVEVKNKKGNSPLWLAANGGHLSVVELLCKHGADI 307 T L +A+ G+ + V+ LL A V K K G SPL AA GH +V LL K+GA Sbjct: 311 GYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASP 370 Query: 308 DSQDNRKVSCLMAAFRKGHVKA--VRWMVNHVAQF--PSDQEMTRYIQTVNDKELLDKCQ 363 + + + L A R G++ V +V F SD+ + +TV+ E+LD + Sbjct: 371 NEVSSDGTTPLAIAKRLGYISVTDVLKVVTDETSFVLVSDKHRMSFPETVD--EILDVSE 428 Query: 364 E 364 + Sbjct: 429 D 429
>pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 Back     alignment and structure
>pdb|3UTM|A Chain A, Crystal Structure Of A Mouse Tankyrase-Axin Complex Length = 351 Back     alignment and structure
>pdb|3UTM|A Chain A, Crystal Structure Of A Mouse Tankyrase-Axin Complex Length = 351 Back     alignment and structure
>pdb|3UTM|A Chain A, Crystal Structure Of A Mouse Tankyrase-Axin Complex Length = 351 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 Back     alignment and structure
>pdb|4G8K|A Chain A, Intact Sensor Domain Of Human Rnase L In The Inactive Signaling State Length = 337 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 Back     alignment and structure
>pdb|1WDY|A Chain A, Crystal Structure Of Ribonuclease Length = 285 Back     alignment and structure
>pdb|1WDY|A Chain A, Crystal Structure Of Ribonuclease Length = 285 Back     alignment and structure
>pdb|1WDY|A Chain A, Crystal Structure Of Ribonuclease Length = 285 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|1UOH|A Chain A, Human Gankyrin Length = 226 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure
>pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 Back     alignment and structure
>pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 Back     alignment and structure
>pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 Back     alignment and structure
>pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 Back     alignment and structure
>pdb|4B93|B Chain B, Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyrin Repeat Domain Of Varp Length = 269 Back     alignment and structure
>pdb|4B93|B Chain B, Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyrin Repeat Domain Of Varp Length = 269 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure
>pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 Back     alignment and structure
>pdb|1AWC|B Chain B, Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 153 Back     alignment and structure
>pdb|1AWC|B Chain B, Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 153 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 Back     alignment and structure
>pdb|2RFM|A Chain A, Structure Of A Thermophilic Ankyrin Repeat Protein Length = 192 Back     alignment and structure
>pdb|2RFM|A Chain A, Structure Of A Thermophilic Ankyrin Repeat Protein Length = 192 Back     alignment and structure
>pdb|3ZKJ|A Chain A, Crystal Structure Of Ankyrin Repeat And Socs Box-containing Protein 9 (asb9) In Complex With Elonginb And Elonginc Length = 261 Back     alignment and structure
>pdb|3ZKJ|A Chain A, Crystal Structure Of Ankyrin Repeat And Socs Box-containing Protein 9 (asb9) In Complex With Elonginb And Elonginc Length = 261 Back     alignment and structure
>pdb|3ZKJ|A Chain A, Crystal Structure Of Ankyrin Repeat And Socs Box-containing Protein 9 (asb9) In Complex With Elonginb And Elonginc Length = 261 Back     alignment and structure
>pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 Back     alignment and structure
>pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 Back     alignment and structure
>pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 Back     alignment and structure
>pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 Back     alignment and structure
>pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 Back     alignment and structure
>pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 Back     alignment and structure
>pdb|3D9H|A Chain A, Crystal Structure Of The Splice Variant Of Human Asb9 (Hasb9-2), An Ankyrin Repeat Protein Length = 285 Back     alignment and structure
>pdb|3D9H|A Chain A, Crystal Structure Of The Splice Variant Of Human Asb9 (Hasb9-2), An Ankyrin Repeat Protein Length = 285 Back     alignment and structure
>pdb|3D9H|A Chain A, Crystal Structure Of The Splice Variant Of Human Asb9 (Hasb9-2), An Ankyrin Repeat Protein Length = 285 Back     alignment and structure
>pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 Back     alignment and structure
>pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 Back     alignment and structure
>pdb|3HG0|D Chain D, Crystal Structure Of A Darpin In Complex With Orf49 From Lactococcal Phage Tp901-1 Length = 136 Back     alignment and structure
>pdb|3HG0|D Chain D, Crystal Structure Of A Darpin In Complex With Orf49 From Lactococcal Phage Tp901-1 Length = 136 Back     alignment and structure
>pdb|2JAB|A Chain A, A Designed Ankyrin Repeat Protein Evolved To Picomolar Affinity To Her2 Length = 136 Back     alignment and structure
>pdb|2JAB|A Chain A, A Designed Ankyrin Repeat Protein Evolved To Picomolar Affinity To Her2 Length = 136 Back     alignment and structure
>pdb|3EU9|A Chain A, The Ankyrin Repeat Domain Of Huntingtin Interacting Protein 14 Length = 240 Back     alignment and structure
>pdb|3EU9|A Chain A, The Ankyrin Repeat Domain Of Huntingtin Interacting Protein 14 Length = 240 Back     alignment and structure
>pdb|3SO8|A Chain A, Crystal Structure Of Ankra Length = 162 Back     alignment and structure
>pdb|3SO8|A Chain A, Crystal Structure Of Ankra Length = 162 Back     alignment and structure
>pdb|3SO8|A Chain A, Crystal Structure Of Ankra Length = 162 Back     alignment and structure
>pdb|3V2O|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 183 Back     alignment and structure
>pdb|3V2O|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 183 Back     alignment and structure
>pdb|3V2O|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 183 Back     alignment and structure
>pdb|3V2X|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 167 Back     alignment and structure
>pdb|3V2X|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 167 Back     alignment and structure
>pdb|3V2X|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 167 Back     alignment and structure
>pdb|3UXG|A Chain A, Crystal Structure Of Rfxank Length = 172 Back     alignment and structure
>pdb|3TWR|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human 3bp2 Length = 165 Back     alignment and structure
>pdb|3TWR|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human 3bp2 Length = 165 Back     alignment and structure
>pdb|3TWR|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human 3bp2 Length = 165 Back     alignment and structure
>pdb|3TWQ|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 (Apo Form) Length = 175 Back     alignment and structure
>pdb|3TWQ|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 (Apo Form) Length = 175 Back     alignment and structure
>pdb|3TWQ|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 (Apo Form) Length = 175 Back     alignment and structure
>pdb|3TWU|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human Mcl1 Length = 167 Back     alignment and structure
>pdb|3TWU|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human Mcl1 Length = 167 Back     alignment and structure
>pdb|3TWU|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human Mcl1 Length = 167 Back     alignment and structure
>pdb|3V30|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Rfxank Length = 172 Back     alignment and structure
>pdb|2DZN|A Chain A, Crystal Structure Analysis Of Yeast Nas6p Complexed With The Proteasome Subunit, Rpt3 Length = 228 Back     alignment and structure
>pdb|1IXV|A Chain A, Crystal Structure Analysis Of Homolog Of Oncoprotein Gankyrin, An Interactor Of Rb And Cdk46 Length = 231 Back     alignment and structure
>pdb|1WG0|A Chain A, Structural Comparison Of Nas6p Protein Structures In Two Different Crystal Forms Length = 243 Back     alignment and structure
>pdb|1S70|B Chain B, Complex Between Protein Ser/thr Phosphatase-1 (delta) And The Myosin Phosphatase Targeting Subunit 1 (mypt1) Length = 299 Back     alignment and structure
>pdb|3C5R|A Chain A, Crystal Structure Of The Bard1 Ankyrin Repeat Domain And Its Functional Consequences Length = 137 Back     alignment and structure
>pdb|3C5R|A Chain A, Crystal Structure Of The Bard1 Ankyrin Repeat Domain And Its Functional Consequences Length = 137 Back     alignment and structure
>pdb|1OT8|A Chain A, Structure Of The Ankyrin Domain Of The Drosophila Notch Receptor Length = 239 Back     alignment and structure
>pdb|1K1B|A Chain A, Crystal Structure Of The Ankyrin Repeat Domain Of Bcl-3: A Unique Member Of The Ikappab Protein Family Length = 241 Back     alignment and structure
>pdb|1IKN|D Chain D, IkappabalphaNF-Kappab Complex Length = 236 Back     alignment and structure
>pdb|1IKN|D Chain D, IkappabalphaNF-Kappab Complex Length = 236 Back     alignment and structure
>pdb|1NFI|E Chain E, I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 Back     alignment and structure
>pdb|1NFI|E Chain E, I-Kappa-B-AlphaNF-Kappa-B Complex Length = 213 Back     alignment and structure
>pdb|2KBX|A Chain A, Solution Structure Of Ilk-Pinch Complex Length = 171 Back     alignment and structure
>pdb|2KBX|A Chain A, Solution Structure Of Ilk-Pinch Complex Length = 171 Back     alignment and structure
>pdb|2KBX|A Chain A, Solution Structure Of Ilk-Pinch Complex Length = 171 Back     alignment and structure
>pdb|2KBX|A Chain A, Solution Structure Of Ilk-Pinch Complex Length = 171 Back     alignment and structure
>pdb|3F6Q|A Chain A, Crystal Structure Of Integrin-Linked Kinase Ankyrin Repeat Domain In Complex With Pinch1 Lim1 Domain Length = 179 Back     alignment and structure
>pdb|3F6Q|A Chain A, Crystal Structure Of Integrin-Linked Kinase Ankyrin Repeat Domain In Complex With Pinch1 Lim1 Domain Length = 179 Back     alignment and structure
>pdb|3F6Q|A Chain A, Crystal Structure Of Integrin-Linked Kinase Ankyrin Repeat Domain In Complex With Pinch1 Lim1 Domain Length = 179 Back     alignment and structure
>pdb|3F6Q|A Chain A, Crystal Structure Of Integrin-Linked Kinase Ankyrin Repeat Domain In Complex With Pinch1 Lim1 Domain Length = 179 Back     alignment and structure
>pdb|2F8X|K Chain K, Crystal Structure Of Activated Notch, Csl And Maml On Hes-1 Promoter Dna Sequence Length = 256 Back     alignment and structure
>pdb|2F8X|K Chain K, Crystal Structure Of Activated Notch, Csl And Maml On Hes-1 Promoter Dna Sequence Length = 256 Back     alignment and structure
>pdb|2XEN|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module Length = 91 Back     alignment and structure
>pdb|2XEN|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module Length = 91 Back     alignment and structure
>pdb|1YYH|A Chain A, Crystal Structure Of The Human Notch 1 Ankyrin Domain Length = 253 Back     alignment and structure
>pdb|1YYH|A Chain A, Crystal Structure Of The Human Notch 1 Ankyrin Domain Length = 253 Back     alignment and structure
>pdb|2HE0|A Chain A, Crystal Structure Of A Human Notch1 Ankyrin Domain Mutant Length = 253 Back     alignment and structure
>pdb|2HE0|A Chain A, Crystal Structure Of A Human Notch1 Ankyrin Domain Mutant Length = 253 Back     alignment and structure
>pdb|3HRA|A Chain A, Crystal Structure Of Ef0377 An Ankyrin Repeat Protein Length = 201 Back     alignment and structure
>pdb|3HRA|A Chain A, Crystal Structure Of Ef0377 An Ankyrin Repeat Protein Length = 201 Back     alignment and structure
>pdb|2ZGG|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 92 Back     alignment and structure
>pdb|2ZGD|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 110 Back     alignment and structure
>pdb|2QC9|A Chain A, Mouse Notch 1 Ankyrin Repeat Intracellular Domain Length = 210 Back     alignment and structure
>pdb|2QC9|A Chain A, Mouse Notch 1 Ankyrin Repeat Intracellular Domain Length = 210 Back     alignment and structure
>pdb|2QC9|A Chain A, Mouse Notch 1 Ankyrin Repeat Intracellular Domain Length = 210 Back     alignment and structure
>pdb|2FO1|E Chain E, Crystal Structure Of The Csl-Notch-Mastermind Ternary Complex Bound To Dna Length = 373 Back     alignment and structure
>pdb|1YMP|A Chain A, The Crystal Structure Of A Partial Mouse Notch-1 Ankyrin Domain: Repeats 4 Through 7 Preserve An Ankyrin Fold Length = 135 Back     alignment and structure
>pdb|2F8Y|A Chain A, Crystal Structure Of Human Notch1 Ankyrin Repeats To 1.55a Resolution. Length = 223 Back     alignment and structure
>pdb|2F8Y|A Chain A, Crystal Structure Of Human Notch1 Ankyrin Repeats To 1.55a Resolution. Length = 223 Back     alignment and structure
>pdb|1MX6|A Chain A, Structure Of P18ink4c (F92n) Length = 168 Back     alignment and structure
>pdb|1MX6|A Chain A, Structure Of P18ink4c (F92n) Length = 168 Back     alignment and structure
>pdb|1MX6|A Chain A, Structure Of P18ink4c (F92n) Length = 168 Back     alignment and structure
>pdb|1BI8|B Chain B, Mechanism Of G1 Cyclin Dependent Kinase Inhibition From The Structures Cdk6-P19ink4d Inhibitor Complex Length = 166 Back     alignment and structure
>pdb|1BI8|B Chain B, Mechanism Of G1 Cyclin Dependent Kinase Inhibition From The Structures Cdk6-P19ink4d Inhibitor Complex Length = 166 Back     alignment and structure
>pdb|1BI8|B Chain B, Mechanism Of G1 Cyclin Dependent Kinase Inhibition From The Structures Cdk6-P19ink4d Inhibitor Complex Length = 166 Back     alignment and structure
>pdb|1IHB|A Chain A, Crystal Structure Of P18-Ink4c(Ink6) Length = 162 Back     alignment and structure
>pdb|1IHB|A Chain A, Crystal Structure Of P18-Ink4c(Ink6) Length = 162 Back     alignment and structure
>pdb|1IHB|A Chain A, Crystal Structure Of P18-Ink4c(Ink6) Length = 162 Back     alignment and structure
>pdb|1BD8|A Chain A, Structure Of Cdk Inhibitor P19ink4d Length = 156 Back     alignment and structure
>pdb|1BD8|A Chain A, Structure Of Cdk Inhibitor P19ink4d Length = 156 Back     alignment and structure
>pdb|1BD8|A Chain A, Structure Of Cdk Inhibitor P19ink4d Length = 156 Back     alignment and structure
>pdb|1MX4|A Chain A, Structure Of P18ink4c (F82q) Length = 168 Back     alignment and structure
>pdb|1MX4|A Chain A, Structure Of P18ink4c (F82q) Length = 168 Back     alignment and structure
>pdb|1MX4|A Chain A, Structure Of P18ink4c (F82q) Length = 168 Back     alignment and structure
>pdb|1BU9|A Chain A, Solution Structure Of P18-Ink4c, 21 Structures Length = 168 Back     alignment and structure
>pdb|1BU9|A Chain A, Solution Structure Of P18-Ink4c, 21 Structures Length = 168 Back     alignment and structure
>pdb|1BU9|A Chain A, Solution Structure Of P18-Ink4c, 21 Structures Length = 168 Back     alignment and structure
>pdb|3AAA|C Chain C, Crystal Structure Of Actin Capping Protein In Complex With V-1 Length = 123 Back     alignment and structure
>pdb|1AP7|A Chain A, P19-Ink4d From Mouse, Nmr, 20 Structures Length = 168 Back     alignment and structure
>pdb|1AP7|A Chain A, P19-Ink4d From Mouse, Nmr, 20 Structures Length = 168 Back     alignment and structure
>pdb|1BLX|B Chain B, P19ink4dCDK6 COMPLEX Length = 166 Back     alignment and structure
>pdb|1BLX|B Chain B, P19ink4dCDK6 COMPLEX Length = 166 Back     alignment and structure
>pdb|1MYO|A Chain A, Solution Structure Of Myotrophin, Nmr, 44 Structures Length = 118 Back     alignment and structure
>pdb|1MYO|A Chain A, Solution Structure Of Myotrophin, Nmr, 44 Structures Length = 118 Back     alignment and structure
>pdb|1MX2|A Chain A, Structure Of F71n Mutant Of P18ink4c Length = 168 Back     alignment and structure
>pdb|1MX2|A Chain A, Structure Of F71n Mutant Of P18ink4c Length = 168 Back     alignment and structure
>pdb|1MX2|A Chain A, Structure Of F71n Mutant Of P18ink4c Length = 168 Back     alignment and structure
>pdb|4HBD|A Chain A, Crystal Structure Of Kank2 Ankyrin Repeats Length = 276 Back     alignment and structure
>pdb|3DEO|A Chain A, Structural Basis For Specific Substrate Recognition By The Chloroplast Signal Recognition Particle Protein Cpsrp43 Length = 183 Back     alignment and structure
>pdb|2RFA|A Chain A, Crystal Structure Of The Mouse Trpv6 Ankyrin Repeat Domain Length = 232 Back     alignment and structure
>pdb|3UI2|A Chain A, Crystal Structure Of The Cpsrp54 Tail Bound To Cpsrp43 Length = 244 Back     alignment and structure
>pdb|1OY3|D Chain D, Crystal Structure Of An IkbbetaNF-Kb P65 Homodimer Complex Length = 282 Back     alignment and structure
>pdb|1K3Z|D Chain D, X-Ray Crystal Structure Of The IkbbNF-Kb P65 Homodimer Complex Length = 282 Back     alignment and structure
>pdb|3EHQ|A Chain A, Crystal Structure Of Human Osteoclast Stimulating Factor Length = 222 Back     alignment and structure
>pdb|2VGE|A Chain A, Crystal Structure Of The C-Terminal Region Of Human Iaspp Length = 229 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query596
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-115
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-112
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-110
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 1e-101
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 8e-91
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 5e-66
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 8e-42
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 3e-25
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 4e-19
1n11_A 437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 2e-15
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-93
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 4e-84
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-83
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 9e-69
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 3e-42
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 5e-93
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 4e-73
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 4e-67
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 3e-61
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 1e-55
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 4e-86
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 5e-64
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 4e-52
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 1e-19
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 3e-16
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 7e-86
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-83
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 8e-74
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 2e-68
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 6e-26
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 1e-20
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 3e-83
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 6e-83
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 1e-82
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-74
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-67
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 2e-57
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 9e-34
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 9e-25
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 5e-09
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 6e-80
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 2e-72
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 5e-34
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 7e-80
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 3e-62
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 1e-35
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 2e-76
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 4e-65
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 4e-56
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 3e-37
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 1e-75
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 3e-72
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 3e-65
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 5e-48
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 8e-75
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 7e-49
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 2e-45
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 6e-24
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 4e-19
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 4e-08
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 4e-72
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 2e-69
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 1e-65
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 8e-23
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 1e-67
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-62
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 4e-54
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 2e-44
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 7e-24
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 3e-19
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 3e-65
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 2e-64
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-60
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 5e-57
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 1e-26
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 5e-20
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 3e-63
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-61
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 1e-55
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 1e-54
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 2e-32
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 2e-61
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 3e-58
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 1e-56
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 5e-39
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 3e-29
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 3e-25
3v31_A167 Ankyrin repeat family A protein 2; structural geno 7e-58
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-55
3v31_A167 Ankyrin repeat family A protein 2; structural geno 1e-51
3v31_A167 Ankyrin repeat family A protein 2; structural geno 4e-48
3v31_A167 Ankyrin repeat family A protein 2; structural geno 2e-20
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 9e-57
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 5e-56
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 5e-48
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 3e-44
3v30_A172 DNA-binding protein rfxank; structural genomics co 7e-55
3v30_A172 DNA-binding protein rfxank; structural genomics co 9e-55
3v30_A172 DNA-binding protein rfxank; structural genomics co 5e-54
3v30_A172 DNA-binding protein rfxank; structural genomics co 6e-53
3v30_A172 DNA-binding protein rfxank; structural genomics co 1e-46
3v30_A172 DNA-binding protein rfxank; structural genomics co 4e-44
3v30_A172 DNA-binding protein rfxank; structural genomics co 1e-33
3v30_A172 DNA-binding protein rfxank; structural genomics co 3e-08
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 3e-54
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 6e-54
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 2e-51
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 3e-46
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 5e-41
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 4e-29
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 3e-54
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-51
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 6e-44
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 8e-36
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 2e-18
3hra_A201 Ankyrin repeat family protein; structural protein; 4e-54
3hra_A201 Ankyrin repeat family protein; structural protein; 7e-54
3hra_A201 Ankyrin repeat family protein; structural protein; 6e-49
3hra_A201 Ankyrin repeat family protein; structural protein; 3e-38
3hra_A201 Ankyrin repeat family protein; structural protein; 8e-32
3hra_A201 Ankyrin repeat family protein; structural protein; 7e-23
3hra_A201 Ankyrin repeat family protein; structural protein; 1e-12
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 7e-54
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 3e-52
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 9e-47
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 9e-40
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 1e-32
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 6e-25
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 3e-07
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 7e-52
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 1e-49
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 1e-49
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 2e-46
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 1e-42
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 4e-37
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 9e-33
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 5e-32
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 3e-51
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 6e-50
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 6e-26
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 6e-51
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 6e-50
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 2e-45
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 4e-43
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 3e-40
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 1e-06
2rfa_A232 Transient receptor potential cation channel subfa 5e-49
2rfa_A232 Transient receptor potential cation channel subfa 6e-48
2rfa_A232 Transient receptor potential cation channel subfa 4e-38
2rfa_A232 Transient receptor potential cation channel subfa 1e-04
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-48
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 1e-48
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 3e-47
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 3e-44
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 3e-33
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 4e-21
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-47
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-45
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 2e-44
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 3e-35
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 1e-32
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 5e-47
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 3e-45
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 5e-35
3deo_A183 Signal recognition particle 43 kDa protein; chloro 6e-46
3deo_A183 Signal recognition particle 43 kDa protein; chloro 8e-45
3deo_A183 Signal recognition particle 43 kDa protein; chloro 6e-44
3deo_A183 Signal recognition particle 43 kDa protein; chloro 2e-41
3deo_A183 Signal recognition particle 43 kDa protein; chloro 6e-38
3deo_A183 Signal recognition particle 43 kDa protein; chloro 8e-36
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 3e-45
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 5e-41
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 1e-40
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 9e-40
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 4e-39
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 8e-39
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 1e-22
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-43
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 5e-43
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 4e-41
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 1e-40
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 5e-38
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 9e-35
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 2e-30
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 9e-08
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-42
1awc_B153 Protein (GA binding protein beta 1); complex (tran 6e-41
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-40
1awc_B153 Protein (GA binding protein beta 1); complex (tran 4e-37
1awc_B153 Protein (GA binding protein beta 1); complex (tran 2e-30
1awc_B153 Protein (GA binding protein beta 1); complex (tran 1e-22
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 7e-42
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 4e-41
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 4e-41
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 5e-39
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 2e-34
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 1e-28
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 3e-19
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 9e-07
2pnn_A273 Transient receptor potential cation channel subfa 7e-42
2pnn_A273 Transient receptor potential cation channel subfa 1e-39
2pnn_A273 Transient receptor potential cation channel subfa 3e-28
2pnn_A273 Transient receptor potential cation channel subfa 1e-20
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 1e-40
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 3e-38
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 2e-37
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 1e-32
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 3e-25
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 2e-22
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 2e-14
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 1e-40
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 2e-40
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 2e-40
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 3e-38
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 4e-36
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 2e-19
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 9e-13
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 2e-40
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 6e-39
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 7e-36
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 3e-34
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 4e-28
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 4e-25
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 3e-40
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 2e-39
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 3e-39
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 3e-36
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 3e-34
2etb_A256 Transient receptor potential cation channel subfam 9e-40
2etb_A256 Transient receptor potential cation channel subfam 1e-31
2etb_A256 Transient receptor potential cation channel subfam 2e-29
2etb_A256 Transient receptor potential cation channel subfam 2e-14
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 1e-39
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 1e-38
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 3e-38
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 9e-34
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 2e-32
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 6e-24
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 2e-35
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 6e-34
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 4e-33
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 1e-32
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 4e-25
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 6e-24
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 7e-10
3jxi_A260 Vanilloid receptor-related osmotically activated p 2e-34
3jxi_A260 Vanilloid receptor-related osmotically activated p 6e-24
3jxi_A260 Vanilloid receptor-related osmotically activated p 1e-13
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 2e-32
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 3e-32
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 1e-31
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 1e-29
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 5e-29
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 1e-22
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 1e-21
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 8e-32
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 8e-31
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 6e-30
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 8e-29
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 2e-28
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 2e-28
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 6e-24
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 9e-31
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 1e-29
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 5e-27
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 9e-27
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 7e-23
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 5e-12
1sw6_A327 Regulatory protein SWI6; transcription regulation, 1e-30
1sw6_A327 Regulatory protein SWI6; transcription regulation, 2e-26
1sw6_A327 Regulatory protein SWI6; transcription regulation, 5e-26
1sw6_A327 Regulatory protein SWI6; transcription regulation, 2e-22
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 7e-30
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 2e-28
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 1e-26
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 4e-26
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 2e-25
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 5e-24
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 5e-11
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 9e-16
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 4e-13
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-12
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 1e-11
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 3e-10
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 2e-09
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 2e-13
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 3e-11
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 7e-11
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 1e-10
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 3e-10
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 1e-09
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 1e-08
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 2e-13
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 8e-13
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 2e-12
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 1e-10
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 2e-10
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 2e-09
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 3e-06
1g8x_A1010 Myosin II heavy chain fused to alpha-actinin 3; mo 6e-11
1g8x_A1010 Myosin II heavy chain fused to alpha-actinin 3; mo 2e-09
1g8x_A1010 Myosin II heavy chain fused to alpha-actinin 3; mo 3e-07
1g8x_A1010 Myosin II heavy chain fused to alpha-actinin 3; mo 1e-05
1g8x_A1010 Myosin II heavy chain fused to alpha-actinin 3; mo 6e-05
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 9e-10
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 3e-09
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 6e-09
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 3e-08
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 2e-07
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 1e-06
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 4e-04
2zuo_A861 MVP, major vault protein; repeat domains, protein- 1e-09
2zuo_A861 MVP, major vault protein; repeat domains, protein- 4e-09
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 2e-09
3lvg_D190 LCB, clathrin light chain B; SELF assembly, coated 4e-04
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 1e-08
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 1e-08
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 2e-08
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 5e-07
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 6e-07
1i84_S 1184 Smooth muscle myosin heavy chain; muscle protein, 1e-06
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 5e-05
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 6e-05
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 1e-04
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 1e-04
1i84_S1184 Smooth muscle myosin heavy chain; muscle protein, 2e-04
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 4e-08
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 8e-08
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 1e-07
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 3e-07
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 1e-06
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 2e-06
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 2e-06
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 4e-06
2dfs_A1080 Myosin-5A; myosin-V, inhibited state, cryoelectron 1e-05
1f5n_A592 Interferon-induced guanylate-binding protein 1; GB 5e-07
1f5n_A592 Interferon-induced guanylate-binding protein 1; GB 4e-04
3vkg_A 3245 Dynein heavy chain, cytoplasmic; AAA+ protein, mol 2e-04
3nzj_F288 Proteasome component C1; ubiquitin, protein degrad 5e-04
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
 Score =  348 bits (895), Expect = e-115
 Identities = 122/337 (36%), Positives = 166/337 (49%), Gaps = 11/337 (3%)

Query: 2   DVDSETESNHDTALTLACAGGHEELVELLLSRGADIEHRDKKGFTPLILAATAGHDKVVD 61
                 ES   T L +A   GH  +V+ LL RGA     + K  TPL +AA AGH +V  
Sbjct: 6   SGGGGGESG-LTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAK 64

Query: 62  ILLNHKADMEAQSERTKDTPLSLACSGGRYEVVELLLTRGANKEHRNVSDYTPLSLAASG 121
            LL +KA + A+++    TPL  A   G   +V+LLL   AN      + +TPL +AA  
Sbjct: 65  YLLQNKAKVNAKAKD-DQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAARE 123

Query: 122 GYVNIIKLLLTHGAEINSRTGSKLGISPLMLAAMNGHTAAVKLLLDMGSDINAQIETNRN 181
           G+V  +  LL   A     T  K G +PL +AA  G     +LLL+  +  NA  + N  
Sbjct: 124 GHVETVLALLEKEASQACMT--KKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGK-NGL 180

Query: 182 TALTLACFQGRHEVVSLLLDRKANVEHRAKTGLTPLMEAASGGYVEVGRVLLDKGADVNA 241
           T L +A      ++V LLL R  +    A  G TPL  AA    VEV R LL  G   NA
Sbjct: 181 TPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANA 240

Query: 242 PPVPSSRD--TALTIAADKGHCRFVELLLSKGAQVEVKNKKGNSPLWLAANGGHLSVVEL 299
                S    T L +AA +GH   V LLLSK A   + NK G +PL L A  GH+ V ++
Sbjct: 241 E----SVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADV 296

Query: 300 LCKHGADIDSQDNRKVSCLMAAFRKGHVKAVRWMVNH 336
           L KHG  +D+      + L  A   G++K V++++ H
Sbjct: 297 LIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQH 333


>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 Back     alignment and structure
>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 Back     alignment and structure
>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 Back     alignment and structure
>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 Back     alignment and structure
>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 Back     alignment and structure
>1g8x_A Myosin II heavy chain fused to alpha-actinin 3; motor, lever ARM, protein engineering, structural protein; HET: ADP; 2.80A {Dictyostelium discoideum} SCOP: k.1.1.1 Length = 1010 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 Back     alignment and structure
>2zuo_A MVP, major vault protein; repeat domains, protein-protein complex, cytoplasm, ribonucleoprotein, structural protein; 3.50A {Rattus norvegicus} PDB: 2zv4_N 2zv5_a 2qzv_A Length = 861 Back     alignment and structure
>2zuo_A MVP, major vault protein; repeat domains, protein-protein complex, cytoplasm, ribonucleoprotein, structural protein; 3.50A {Rattus norvegicus} PDB: 2zv4_N 2zv5_a 2qzv_A Length = 861 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>3lvg_D LCB, clathrin light chain B; SELF assembly, coated PIT, cytoplasmic vesicle, membrane, Ca structural protein; 7.94A {Bos taurus} Length = 190 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>1i84_S Smooth muscle myosin heavy chain; muscle protein, myosin subfragment 2, heavy meromyosin, essential light chain, motor protein; HET: MLY; 20.00A {Gallus gallus} SCOP: i.15.1.1 PDB: 3j04_A 3dtp_B 3dtp_A Length = 1184 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>2dfs_A Myosin-5A; myosin-V, inhibited state, cryoelectron tomograp contractIle protein-transport protein complex; 24.00A {Gallus gallus} Length = 1080 Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Length = 592 Back     alignment and structure
>1f5n_A Interferon-induced guanylate-binding protein 1; GBP, GTP hydrolysis, GDP, GMP, dynamin related, large GTPase family. GMPPNP, GPPNHP.; HET: GNP; 1.70A {Homo sapiens} SCOP: a.114.1.1 c.37.1.8 PDB: 1dg3_A* 2b8w_A* 2b92_A* 2bc9_A* 2d4h_A* Length = 592 Back     alignment and structure
>3vkg_A Dynein heavy chain, cytoplasmic; AAA+ protein, molecular motor, microtubles, motor protein; HET: ADP SPM; 2.81A {Dictyostelium discoideum} PDB: 3vkh_A* 3vkh_C* Length = 3245 Back     alignment and structure
>3nzj_F Proteasome component C1; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 1z7q_G* 3nzw_F* 3nzx_F* 3un4_F* 3un8_F* 3bdm_F* 1fnt_G* 2zcy_F* Length = 288 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query596
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
1n11_A437 Ankyrin; clathrin, BAND 3, anion exchanger, struct 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
4g8k_A337 2-5A-dependent ribonuclease; ankyrin-repeat domain 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
1wdy_A285 2-5A-dependent ribonuclease; hydrolase, RNA-bindin 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
3utm_A351 Tankyrase-1; tankyrase, TNKS, ankryin repeat clust 100.0
2fo1_E373 LIN-12 protein; beta-barrel, protein-DNA complex, 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
3d9h_A285 CDNA FLJ77766, highly similar to HOMO sapiens anky 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
3ljn_A364 Hypothetical protein; ankyrin, structural genomics 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
2xai_A261 ASB-9, ankyrin repeat and SOCS box protein 9; tran 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
1yyh_A253 HN1;, notch 1, ankyrin domain; ankyrin repeats, ce 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
1k1a_A241 B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa 100.0
1oy3_D282 Transcription factor inhibitor I-kappa-B-beta; pro 100.0
3b7b_A237 Euchromatic histone-lysine N-methyltransferase 1; 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 100.0
3aji_A231 26S proteasome non-ATPase regulatory subunit 10; g 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
3eu9_A240 Huntingtin-interacting protein 14; epigenetics, an 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
4b93_B269 Ankyrin repeat domain-containing protein 27; endoc 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
3kea_A285 K1L; tropism, ANK repeat, viral protein; 2.30A {Va 100.0
2dzn_A228 Probable 26S proteasome regulatory subunit P28; an 100.0
1s70_B299 130 kDa myosin-binding subunit of smooth muscle my 100.0
2f8y_A223 Notch homolog 1, translocation-associated (drosoph 100.0
1sw6_A327 Regulatory protein SWI6; transcription regulation, 100.0
1sw6_A327 Regulatory protein SWI6; transcription regulation, 100.0
2rfa_A232 Transient receptor potential cation channel subfa 100.0
3hra_A201 Ankyrin repeat family protein; structural protein; 100.0
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 100.0
4gpm_A169 Engineered protein OR264; de novo protein, structu 100.0
2rfa_A232 Transient receptor potential cation channel subfa 99.98
2etb_A256 Transient receptor potential cation channel subfam 99.98
1ikn_D236 Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 99.97
3hra_A201 Ankyrin repeat family protein; structural protein; 99.97
4gpm_A169 Engineered protein OR264; de novo protein, structu 99.97
2pnn_A273 Transient receptor potential cation channel subfa 99.97
2pnn_A273 Transient receptor potential cation channel subfa 99.97
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.97
2etb_A256 Transient receptor potential cation channel subfam 99.97
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.96
3jxi_A260 Vanilloid receptor-related osmotically activated p 99.96
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.96
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.96
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.96
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.96
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.96
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.96
3v30_A172 DNA-binding protein rfxank; structural genomics co 99.96
2aja_A376 Ankyrin repeat family protein; NESG, Q5ZSV0, struc 99.96
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.95
4hbd_A276 KN motif and ankyrin repeat domain-containing Pro; 99.95
1ihb_A162 P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit 99.95
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.95
2y1l_E169 Darpin-8.4; hydrolase-inhibitor complex, DEVD darp 99.95
2rfm_A192 Putative ankyrin repeat protein TV1425; ANK repeat 99.95
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.95
3v31_A167 Ankyrin repeat family A protein 2; structural geno 99.95
3f6q_A179 Integrin-linked protein kinase; ILK, integrin-link 99.95
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.95
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.94
1awc_B153 Protein (GA binding protein beta 1); complex (tran 99.94
3twr_A165 Tankyrase-2; ankyrin repeat, protein-protein inter 99.94
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.93
2vge_A229 RELA-associated inhibitor; iaspp, nucleus, apoptos 99.93
1bd8_A156 P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr 99.93
1ycs_B239 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres 99.93
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.93
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.92
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.92
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.91
1d9s_A136 Cyclin-dependent kinase 4 inhibitor B; helix-turn- 99.91
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.91
3t8k_A186 Uncharacterized protein; structural genomics, PSI- 99.91
1bi7_B156 P16INK4A, MTS1, multiple tumor suppressor; cyclin 99.9
1n0r_A126 4ANK, 4 ankyrin repeats; structural protein; 1.50A 99.9
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.9
2jab_A136 H10-2-G3; HER2, darpin, ankyrin repeat protein, me 99.89
3c5r_A137 BARD-1, BRCA1-associated ring domain protein 1; an 99.87
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.87
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.87
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.87
3deo_A183 Signal recognition particle 43 kDa protein; chloro 99.87
3ui2_A244 Signal recognition particle 43 kDa protein, chlor; 99.86
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.86
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.86
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.85
3ehr_A222 Osteoclast-stimulating factor 1; beta barrel, heli 99.85
2b0o_E301 UPLC1; arfgap, structural genomics, structural gen 99.84
3aaa_C123 Myotrophin, protein V-1; actin capping protein, ba 99.84
1dcq_A278 PYK2-associated protein beta; zinc-binding module, 99.84
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.84
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.83
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.82
3lvq_E497 ARF-GAP with SH3 domain, ANK repeat and PH domain 99.82
3jue_A368 Arfgap with coiled-coil, ANK repeat and PH domain 99.81
1n0q_A93 3ANK, 3 ankyrin repeats; structural protein; 1.26A 99.81
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.8
2l6b_A115 NR1C; ankyrin, consensus, repeat protein, ising mo 99.76
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.72
2zgd_A110 3 repeat synthetic ankyrin; ankyrin repeat, hydrox 99.66
>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
Probab=100.00  E-value=6.5e-54  Score=456.65  Aligned_cols=329  Identities=33%  Similarity=0.414  Sum_probs=212.4

Q ss_pred             cCCCCCcHHHHHHhcCcHHHHHHHHHCCCCccccCCCCCcHHHHHHHcCCHHHHHHHHhCCCCccccccCCCChHHHHHH
Q psy904            7 TESNHDTALTLACAGGHEELVELLLSRGADIEHRDKKGFTPLILAATAGHDKVVDILLNHKADMEAQSERTKDTPLSLAC   86 (596)
Q Consensus         7 ~d~~g~t~L~~A~~~g~~~ivk~Ll~~g~~i~~~d~~g~t~L~~A~~~g~~eiv~~Ll~~~~~~~~~~~~~~~t~L~~A~   86 (596)
                      .+..|.||||+||..|++++|++|++.|++++..+..|.||||+|+..|+.+++++|+++|++++.. +..|.||||+|+
T Consensus        10 ~~~~g~t~L~~Aa~~g~~~~v~~Ll~~g~~~~~~~~~~~t~L~~A~~~g~~~~v~~Ll~~g~~~~~~-~~~g~t~L~~A~   88 (437)
T 1n11_A           10 GGESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAK-AKDDQTPLHCAA   88 (437)
T ss_dssp             -----CCHHHHHHHHTCHHHHHHHHHTTCCSCCSSSCCCCHHHHHHHHTCHHHHHHHHHHTCCSSCC-CTTSCCHHHHHH
T ss_pred             cCCCCCCHHHHHHHCCCHHHHHHHHHcCCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHhCCCCCCCC-CCCCCCHHHHHH
Confidence            4566778888888888888888888888777777777778888888888888888888777776553 456777777777


Q ss_pred             HCCcHHHHHHHHhCCCCccCCCCCCCcHHHHHHhcCCHHHHHHHHhCCCCccccCCCCCCCcHHHHHHHcCCHHHHHHHH
Q psy904           87 SGGRYEVVELLLTRGANKEHRNVSDYTPLSLAASGGYVNIIKLLLTHGAEINSRTGSKLGISPLMLAAMNGHTAAVKLLL  166 (596)
Q Consensus        87 ~~g~~eivk~LL~~g~~~~~~d~~g~t~L~~A~~~g~~eiv~~Ll~~g~~~~~~~~~~~g~t~L~~A~~~g~~eiv~~Ll  166 (596)
                      ..|+.++|++|+++|++++..+..|.||||+|+..|+.+++++|++.+.+++....  .|.||||+|+..|+.+++++|+
T Consensus        89 ~~g~~~~v~~Ll~~ga~~~~~~~~g~t~L~~A~~~g~~~~v~~Ll~~~~~~~~~~~--~g~t~L~~A~~~g~~~~v~~Ll  166 (437)
T 1n11_A           89 RIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTK--KGFTPLHVAAKYGKVRVAELLL  166 (437)
T ss_dssp             HHTCHHHHHHHHHHTCCTTCCCTTCCCHHHHHHHHTCHHHHHHHHHTTCCSCCCCT--TSCCHHHHHHHTTCHHHHHHHH
T ss_pred             HCCCHHHHHHHHhCCCCCCCCCCCCCcHHHHHHHcCCHHHHHHHHhCCCCCcCCCC--CCCCHHHHHHHcCCHHHHHHHH
Confidence            77777777777777777777777777777777777777777777776665544332  2555666666666655555555


Q ss_pred             hcCCCcccccccCCC---------------------------------cHHHHHHHcCCHHHHHHHHhcCCCcccccCCC
Q psy904          167 DMGSDINAQIETNRN---------------------------------TALTLACFQGRHEVVSLLLDRKANVEHRAKTG  213 (596)
Q Consensus       167 ~~~~~~~~~~~~~~~---------------------------------t~L~~A~~~~~~~ii~~Ll~~g~~~~~~~~~g  213 (596)
                      +.|++++.. +..|.                                 ||||+|+..++.+++++|++.|++++..+..|
T Consensus       167 ~~g~~~~~~-~~~g~t~L~~A~~~~~~~~v~~Ll~~g~~~~~~~~~g~t~L~~A~~~~~~~~~~~Ll~~g~~~~~~~~~g  245 (437)
T 1n11_A          167 ERDAHPNAA-GKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQG  245 (437)
T ss_dssp             HTTCCTTCC-CSSCCCHHHHHHHTTCHHHHHHHGGGTCCSCCCCTTCCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCTTC
T ss_pred             hCCCCCCCC-CCCCCCHHHHHHHcCCHHHHHHHHhCCCCCCCcCCCCCCHHHHHHHcCCHHHHHHHHHcCCCCCCCCCCC
Confidence            555554443 33444                                 45555555555555555555555555555555


Q ss_pred             ChHHHHHHhcCcHHHHHHHHhCCCCCCCCCCCCCCCcHHHHHHHcCcHHHHHHHHHCCCCCCCCCCCCChHHHHHHhcCc
Q psy904          214 LTPLMEAASGGYVEVGRVLLDKGADVNAPPVPSSRDTALTIAADKGHCRFVELLLSKGAQVEVKNKKGNSPLWLAANGGH  293 (596)
Q Consensus       214 ~t~L~~A~~~g~~~iv~~Ll~~g~~~~~~~~~~~g~t~L~~A~~~~~~~iv~~Ll~~g~di~~~d~~g~TpL~~A~~~g~  293 (596)
                      .||||+|+..|+.+++++|++.|++++.  .+..|.||||+|+..|+.+++++|+++|++++..|..|.||||+|+..|+
T Consensus       246 ~t~L~~A~~~g~~~~v~~Ll~~~~~~~~--~~~~g~t~L~~A~~~~~~~~~~~Ll~~g~~~~~~~~~g~t~L~~A~~~g~  323 (437)
T 1n11_A          246 VTPLHLAAQEGHAEMVALLLSKQANGNL--GNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGN  323 (437)
T ss_dssp             CCHHHHHHHTTCHHHHHHHHTTTCCTTC--CCTTCCCHHHHHHHHTCHHHHHHHHHHTCCTTCCCSSCCCHHHHHHHSSC
T ss_pred             CCHHHHHHHCCCHHHHHHHHhcCCCCCC--CCCCCCCHHHHHHHcCCHHHHHHHHhCCccCCCCCCCCCCHHHHHHHcCc
Confidence            5555555555555555555555555544  34455666666666666666666666666666666666666666666666


Q ss_pred             HHHHHHHHHCCCCcccCCCCCCCHHHHHHHcCCHHHHHHHHhCcCCCC
Q psy904          294 LSVVELLCKHGADIDSQDNRKVSCLMAAFRKGHVKAVRWMVNHVAQFP  341 (596)
Q Consensus       294 ~~iv~~Ll~~gad~~~~~~~g~t~L~~A~~~g~~~iv~~Ll~~~~~~~  341 (596)
                      .++|++|+++|++++.++..|.||||+|+..|+.++|++|+++|+++.
T Consensus       324 ~~~v~~Ll~~gad~n~~~~~g~t~L~~A~~~g~~~iv~~Ll~~ga~~~  371 (437)
T 1n11_A          324 IKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPN  371 (437)
T ss_dssp             SHHHHHHHHTTCCTTCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCSC
T ss_pred             HHHHHHHHhcCCCCCCCCCCCCCHHHHHHHCChHHHHHHHHHCcCCCC
Confidence            666666666666666666666666666666666666666666666544



>1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Back     alignment and structure
>2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Back     alignment and structure
>1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Back     alignment and structure
>3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Back     alignment and structure
>2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Back     alignment and structure
>1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Back     alignment and structure
>2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Back     alignment and structure
>3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Back     alignment and structure
>4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Back     alignment and structure
>2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} Back     alignment and structure
>1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Back     alignment and structure
>2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Back     alignment and structure
>3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Back     alignment and structure
>3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Back     alignment and structure
>1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Back     alignment and structure
>1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Back     alignment and structure
>1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Back     alignment and structure
>1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Back     alignment and structure
>3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Back     alignment and structure
>3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Back     alignment and structure
>2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Back     alignment and structure
>3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Back     alignment and structure
>1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A Back     alignment and structure
>1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure
>2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 596
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-59
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 4e-57
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 3e-45
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 6e-38
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 2e-21
d1n11a_408 d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta 5e-14
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 4e-42
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 4e-31
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 8e-27
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 2e-23
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 1e-20
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 4e-17
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 5e-12
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 2e-08
d1wdya_285 d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas 7e-06
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 4e-38
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 5e-37
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 3e-27
d2ajaa1346 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 2e-10
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 5e-32
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-29
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-21
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 5e-21
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 2e-20
d1uoha_223 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 0.004
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 5e-31
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 6e-30
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 6e-25
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 2e-16
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 4e-12
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 9e-11
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 2e-10
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 5e-08
d1oy3d_255 d.211.1.1 (D:) Transcription factor inhibitor I-ka 0.002
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 1e-24
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 8e-23
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 2e-21
d2fo1e1277 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele 2e-08
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 3e-24
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 9e-24
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 1e-23
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 9e-23
d1sw6a_301 d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker 2e-17
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 2e-23
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 4e-19
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 9e-14
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 5e-11
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 4e-08
d1s70b_291 d.211.1.1 (B:) Myosin phosphatase targeting subuni 8e-08
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 8e-23
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 1e-21
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 7e-19
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 5e-14
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 2e-11
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 5e-09
d1k1aa_228 d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 3e-07
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 1e-22
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 5e-21
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 1e-20
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 4e-14
d1ot8a_209 d.211.1.1 (A:) Neurogenic locus notch receptor dom 2e-06
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-20
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 7e-20
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 8e-15
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-10
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 3e-08
d1ixva_229 d.211.1.1 (A:) 26S proteasome non-ATPase regulator 1e-07
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 5e-16
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 3e-14
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 7e-13
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 1e-09
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 1e-05
d1iknd_221 d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien 2e-04
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 1e-13
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 7e-13
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 2e-10
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 2e-08
d1awcb_153 d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { 5e-04
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 2e-11
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 5e-11
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 2e-07
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 1e-05
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 2e-05
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 1e-04
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 1e-04
d1ihba_156 d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens 0.003
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 6e-11
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 8e-10
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 1e-09
d1dcqa1154 d.211.1.1 (A:369-522) Pyk2-associated protein beta 8e-04
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 1e-10
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 5e-09
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 1e-08
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 2e-07
d1ycsb1130 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) 0.001
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 3e-08
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 6e-08
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 8e-07
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 1e-06
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 0.001
d1bd8a_156 d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma 0.002
d1sa0e_138 a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus 9e-06
d1sa0e_138 a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus 0.003
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 1e-05
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 2e-05
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 3e-05
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 7e-05
d1bi7b_125 d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma 4e-04
d1f5na1300 a.114.1.1 (A:284-583) Interferon-induced guanylate 4e-04
d1myoa_118 d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) 0.003
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]
 Score =  202 bits (513), Expect = 2e-59
 Identities = 111/363 (30%), Positives = 160/363 (44%), Gaps = 38/363 (10%)

Query: 2   DVDSETESNHDTALTLACAGGHEELVELLLSRGADIEHRDKKGFTPLILAATAGHDKVVD 61
             +  +    +T L +A   GH E+ + LL   A +  + K   TPL  AA  GH  +V 
Sbjct: 25  SPN-VSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVK 83

Query: 62  ILLNHKAD--------------------------------MEAQSERTKDTPLSLACSGG 89
           +LL + A+                                 +A   +   TPL +A   G
Sbjct: 84  LLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYG 143

Query: 90  RYEVVELLLTRGANKEHRNVSDYTPLSLAASGGYVNIIKLLLTHGAEINSRTGSKLGISP 149
           +  V ELLL R A+      +  TPL +A     ++I+KLLL  G   +S   +  G +P
Sbjct: 144 KVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSP--AWNGYTP 201

Query: 150 LMLAAMNGHTAAVKLLLDMGSDINAQIETNRNTALTLACFQGRHEVVSLLLDRKANVEHR 209
           L +AA        + LL  G   NA+      T L LA  +G  E+V+LLL ++AN    
Sbjct: 202 LHIAAKQNQVEVARSLLQYGGSANAESVQG-VTPLHLAAQEGHAEMVALLLSKQANGNLG 260

Query: 210 AKTGLTPLMEAASGGYVEVGRVLLDKGADVNAPPVPSSRDTALTIAADKGHCRFVELLLS 269
            K+GLTPL   A  G+V V  VL+  G  V+A        T L +A+  G+ + V+ LL 
Sbjct: 261 NKSGLTPLHLVAQEGHVPVADVLIKHGVMVDAT--TRMGYTPLHVASHYGNIKLVKFLLQ 318

Query: 270 KGAQVEVKNKKGNSPLWLAANGGHLSVVELLCKHGADIDSQDNRKVSCLMAAFRKGHVKA 329
             A V  K K G SPL  AA  GH  +V LL K+GA  +   +   + L  A R G++  
Sbjct: 319 HQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGYISV 378

Query: 330 VRW 332
              
Sbjct: 379 TDV 381


>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1sa0e_ a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 138 Back     information, alignment and structure
>d1sa0e_ a.137.10.1 (E:) Stathmin 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 138 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 Back     information, alignment and structure
>d1f5na1 a.114.1.1 (A:284-583) Interferon-induced guanylate-binding protein 1 (GBP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 300 Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 118 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query596
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1n11a_408 Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 100.0
d1wdya_285 RNase L, 2-5a-dependent ribonuclease {Human (Homo 100.0
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 100.0
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1uoha_223 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d1oy3d_255 Transcription factor inhibitor I-kappa-B-beta, IKB 100.0
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 100.0
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 100.0
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 100.0
d1s70b_291 Myosin phosphatase targeting subunit 1, MYPT1 {Chi 100.0
d1ixva_229 26S proteasome non-ATPase regulatory subunit 10, g 99.98
d2fo1e1277 Lin-12 {Caenorhabditis elegans [TaxId: 6239]} 99.97
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.97
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.96
d1k1aa_228 bcl-3 {Human (Homo sapiens) [TaxId: 9606]} 99.96
d1ot8a_209 Neurogenic locus notch receptor domain {Fruit fly 99.96
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.96
d1iknd_221 I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 99.96
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.94
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.94
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.93
d2ajaa1346 Hypothetical protein LPG2416 {Legionella pneumophi 99.93
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.93
d1ihba_156 p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] 99.92
d1awcb_153 GA bindinig protein (GABP) beta 1 {Mouse (Mus musc 99.91
d1bd8a_156 Cell cycle inhibitor p19ink4D {Human (Homo sapiens 99.91
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.89
d1bi7b_125 Cell cycle inhibitor p16ink4A {Human (Homo sapiens 99.89
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.88
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.87
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.86
d1sw6a_301 Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch 99.86
d1myoa_118 Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] 99.85
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.85
d1ycsb1130 53BP2 {Human (Homo sapiens) [TaxId: 9606]} 99.84
d1dcqa1154 Pyk2-associated protein beta {Mouse (Mus musculus) 99.82
d1ansa_27 Neurotoxin III (ATX III) {Sea anemone (Anemonia su 93.68
>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: beta-hairpin-alpha-hairpin repeat
superfamily: Ankyrin repeat
family: Ankyrin repeat
domain: Ankyrin-R
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=1.4e-47  Score=400.84  Aligned_cols=318  Identities=36%  Similarity=0.467  Sum_probs=270.0

Q ss_pred             CcHHHHHHhcCcHHHHHHHHHCCCCccccCCCCCcHHHHHHHcCCHHHHHHHHhCCCCccccccCCCChHHHHHHHCCcH
Q psy904           12 DTALTLACAGGHEELVELLLSRGADIEHRDKKGFTPLILAATAGHDKVVDILLNHKADMEAQSERTKDTPLSLACSGGRY   91 (596)
Q Consensus        12 ~t~L~~A~~~g~~~ivk~Ll~~g~~i~~~d~~g~t~L~~A~~~g~~eiv~~Ll~~~~~~~~~~~~~~~t~L~~A~~~g~~   91 (596)
                      .||||+||..|++++|++|+++|+++|..|..|.||||+|+..|+.++|++|+++|++++.. +..|.||||+|+..|+.
T Consensus         1 ~TpL~~Aa~~g~~~~v~~Ll~~g~~in~~d~~g~TpL~~A~~~g~~~iv~~Ll~~gadi~~~-~~~g~t~L~~A~~~g~~   79 (408)
T d1n11a_           1 LTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAK-AKDDQTPLHCAARIGHT   79 (408)
T ss_dssp             CCHHHHHHHHTCHHHHHHHHHTTCCSCCSSSCCCCHHHHHHHHTCHHHHHHHHHHTCCSSCC-CTTSCCHHHHHHHHTCH
T ss_pred             CChHHHHHHCcCHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHcCCHHHHHHHHHCcCCCCCC-CCCCCCHHHHHHHcCCH
Confidence            38999999999999999999999999999999999999999999999999999999887664 46788999999988888


Q ss_pred             HHHHHHHhCCCC---------------------------------ccCCCCCCCcHHHHHHhcCCHHHHHHHHhCCCCcc
Q psy904           92 EVVELLLTRGAN---------------------------------KEHRNVSDYTPLSLAASGGYVNIIKLLLTHGAEIN  138 (596)
Q Consensus        92 eivk~LL~~g~~---------------------------------~~~~d~~g~t~L~~A~~~g~~eiv~~Ll~~g~~~~  138 (596)
                      +++++|+..+.+                                 ....+..+.++|+.|+..++.+++++|+++|.+++
T Consensus        80 ~~~~~Ll~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~a~~~~~~~~v~~ll~~~~~~~  159 (408)
T d1n11a_          80 NMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPN  159 (408)
T ss_dssp             HHHHHHHHHTCCTTCCCTTCCCHHHHHHHHTCHHHHHHHHHTTCCSCCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCTT
T ss_pred             HHHHHHHHhhhccccccccccchhhhhhhhcccccccccccccccccccccccchHHHHHHHcCCHHHHHHHHHcCCCCC
Confidence            888888754433                                 23345567788888888888888888888888777


Q ss_pred             ccCCCCCCCcHHHHHHHcCCHHHHHHHHhcCCCcccc--------------------------------cccCCCcHHHH
Q psy904          139 SRTGSKLGISPLMLAAMNGHTAAVKLLLDMGSDINAQ--------------------------------IETNRNTALTL  186 (596)
Q Consensus       139 ~~~~~~~g~t~L~~A~~~g~~eiv~~Ll~~~~~~~~~--------------------------------~~~~~~t~L~~  186 (596)
                      ....+  |.+||++|+..|+.+++++|+.+|++++..                                .+..+.|||+.
T Consensus       160 ~~~~~--~~~~L~~A~~~~~~~~~~~Ll~~g~~~~~~~~~~~t~l~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~t~l~~  237 (408)
T d1n11a_         160 AAGKN--GLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHL  237 (408)
T ss_dssp             CCCSS--CCCHHHHHHHTTCHHHHHHHGGGTCCSCCCCTTCCCHHHHHHHTTCHHHHHHHHHTTCCTTCCCTTCCCHHHH
T ss_pred             cCCCc--CchHHHHHHHcCCHHHHHHHHhcCCcccccCCCCCCcchhhhccchhhhhhhhhhccccccccCCCCCCHHHH
Confidence            66544  778888888888888888888887765432                                12345578888


Q ss_pred             HHHcCCHHHHHHHHhcCCCcccccCCCChHHHHHHhcCcHHHHHHHHhCCCCCCCCCCCCCCCcHHHHHHHcCcHHHHHH
Q psy904          187 ACFQGRHEVVSLLLDRKANVEHRAKTGLTPLMEAASGGYVEVGRVLLDKGADVNAPPVPSSRDTALTIAADKGHCRFVEL  266 (596)
Q Consensus       187 A~~~~~~~ii~~Ll~~g~~~~~~~~~g~t~L~~A~~~g~~~iv~~Ll~~g~~~~~~~~~~~g~t~L~~A~~~~~~~iv~~  266 (596)
                      |+..++.+++++++..+...+..+..|.|||+.|+..++.+++++|+++|++++.  .+..+.||||.++..++..++++
T Consensus       238 a~~~~~~~~~~~~~~~~~~~~~~~~~g~~~l~~a~~~~~~~i~~~Ll~~g~~~~~--~~~~~~t~L~~~~~~~~~~~~~~  315 (408)
T d1n11a_         238 AAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDA--TTRMGYTPLHVASHYGNIKLVKF  315 (408)
T ss_dssp             HHHTTCHHHHHHHHTTTCCTTCCCTTCCCHHHHHHHHTCHHHHHHHHHHTCCTTC--CCSSCCCHHHHHHHSSCSHHHHH
T ss_pred             HHHhCcHhHhhhhhccccccccccCCCCChhhhhhhcCcHHHHHHHHHCCCcccc--ccccccccchhhcccCcceeeee
Confidence            8888888889998888888888888999999999999999999999999998877  45678899999999999999999


Q ss_pred             HHHCCCCCCCCCCCCChHHHHHHhcCcHHHHHHHHHCCCCcccCCCCCCCHHHHHHHcCCHHHHHHHH
Q psy904          267 LLSKGAQVEVKNKKGNSPLWLAANGGHLSVVELLCKHGADIDSQDNRKVSCLMAAFRKGHVKAVRWMV  334 (596)
Q Consensus       267 Ll~~g~di~~~d~~g~TpL~~A~~~g~~~iv~~Ll~~gad~~~~~~~g~t~L~~A~~~g~~~iv~~Ll  334 (596)
                      |++.|++++.+|..|.||||+|+..|+.++|++|+++|||++.+|..|.||||+|+.+|+.++|++|.
T Consensus       316 ll~~g~~in~~d~~G~T~Lh~A~~~g~~~iv~~Ll~~GAd~n~~d~~G~t~L~~A~~~~~~~iv~~L~  383 (408)
T d1n11a_         316 LLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGYISVTDVLK  383 (408)
T ss_dssp             HHHTTCCTTCCCTTSCCHHHHHHHTTCHHHHHHHHHTTCCSCCCCSSSCCHHHHHHHTTCHHHHHHHH
T ss_pred             eccccccccccCCCCCCHHHHHHHcCCHHHHHHHHHCCCCCCCCCCCCCCHHHHHHHcCCHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999988664



>d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ansa_ g.11.1.1 (A:) Neurotoxin III (ATX III) {Sea anemone (Anemonia sulcata) [TaxId: 6108]} Back     information, alignment and structure