Psyllid ID: psy9066
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 275 | ||||||
| 383866053 | 563 | PREDICTED: potassium voltage-gated chann | 0.48 | 0.234 | 0.487 | 2e-38 | |
| 270004253 | 593 | hypothetical protein TcasGA2_TC003580 [T | 0.48 | 0.222 | 0.522 | 2e-37 | |
| 189235374 | 549 | PREDICTED: similar to Shaker CG12348-PC | 0.48 | 0.240 | 0.522 | 3e-37 | |
| 347963466 | 612 | AGAP000254-PB [Anopheles gambiae str. PE | 0.389 | 0.174 | 0.540 | 2e-36 | |
| 2959684 | 522 | potassium channel [Panulirus interruptus | 0.476 | 0.250 | 0.472 | 8e-36 | |
| 347963468 | 612 | AGAP000254-PA [Anopheles gambiae str. PE | 0.389 | 0.174 | 0.534 | 1e-35 | |
| 170046737 | 770 | voltage-gated potassium channel [Culex q | 0.389 | 0.138 | 0.537 | 5e-35 | |
| 307173075 | 523 | Potassium voltage-gated channel protein | 0.472 | 0.248 | 0.467 | 1e-34 | |
| 84993578 | 492 | potassium channel Kv1.1 [Nephila clavata | 0.52 | 0.290 | 0.460 | 2e-34 | |
| 312382560 | 247 | hypothetical protein AND_04719 [Anophele | 0.312 | 0.348 | 0.583 | 3e-34 |
| >gi|383866053|ref|XP_003708486.1| PREDICTED: potassium voltage-gated channel protein Shaker-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
Score = 165 bits (418), Expect = 2e-38, Method: Compositional matrix adjust.
Identities = 99/203 (48%), Positives = 111/203 (54%), Gaps = 71/203 (34%)
Query: 26 VVEAMWQMWGTNTRTELLFGIHIRPVGVWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFY 85
+ +A W W T T + +G + PVGVWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFY
Sbjct: 425 IPDAFW--WAVVTMTTVGYG-DMTPVGVWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFY 481
Query: 86 HRETDQEDMQSQNFNHVTSCPYLPGTLGEWLVDNSSSRSRKVAAATGLVHNDVGSSWEDM 145
HRETDQE+MQSQNFNHVTSCPYLPGTLG+
Sbjct: 482 HRETDQEEMQSQNFNHVTSCPYLPGTLGQ------------------------------- 510
Query: 146 QSQNFNHVTSCPYLPGTLGQHMKKSSLSESSSDMMELEEGLLFGRDYSTSLTNKKLLSNN 205
H+KKS +SESSSD+MELEEG+L T N
Sbjct: 511 --------------------HVKKSPMSESSSDIMELEEGILLPHPEITKKPN------- 543
Query: 206 NLSLCNPKHN------IMSIETD 222
CNP+HN MSIETD
Sbjct: 544 ----CNPRHNNNINPACMSIETD 562
|
Source: Megachile rotundata Species: Megachile rotundata Genus: Megachile Family: Megachilidae Order: Hymenoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|270004253|gb|EFA00701.1| hypothetical protein TcasGA2_TC003580 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|189235374|ref|XP_001809693.1| PREDICTED: similar to Shaker CG12348-PC [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
| >gi|347963466|ref|XP_003436950.1| AGAP000254-PB [Anopheles gambiae str. PEST] gi|333467186|gb|EGK96496.1| AGAP000254-PB [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|2959684|gb|AAC05909.1| potassium channel [Panulirus interruptus] | Back alignment and taxonomy information |
|---|
| >gi|347963468|ref|XP_310869.5| AGAP000254-PA [Anopheles gambiae str. PEST] gi|333467185|gb|EAA06439.5| AGAP000254-PA [Anopheles gambiae str. PEST] | Back alignment and taxonomy information |
|---|
| >gi|170046737|ref|XP_001850908.1| voltage-gated potassium channel [Culex quinquefasciatus] gi|167869408|gb|EDS32791.1| voltage-gated potassium channel [Culex quinquefasciatus] | Back alignment and taxonomy information |
|---|
| >gi|307173075|gb|EFN64205.1| Potassium voltage-gated channel protein Shaker [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|84993578|dbj|BAE75953.1| potassium channel Kv1.1 [Nephila clavata] | Back alignment and taxonomy information |
|---|
| >gi|312382560|gb|EFR27976.1| hypothetical protein AND_04719 [Anopheles darlingi] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 275 | ||||||
| FB|FBgn0003380 | 655 | Sh "Shaker" [Drosophila melano | 0.349 | 0.146 | 0.727 | 1.3e-33 | |
| UNIPROTKB|Q9YGX8 | 662 | KCNA4 "Uncharacterized protein | 0.338 | 0.140 | 0.577 | 5.5e-22 | |
| UNIPROTKB|I3L9C7 | 596 | KCNA4 "Uncharacterized protein | 0.338 | 0.156 | 0.567 | 9.2e-22 | |
| UNIPROTKB|P22459 | 653 | KCNA4 "Potassium voltage-gated | 0.338 | 0.142 | 0.567 | 1.1e-21 | |
| UNIPROTKB|F1SGM9 | 654 | LOC100037947 "Uncharacterized | 0.338 | 0.142 | 0.567 | 1.1e-21 | |
| MGI|MGI:96661 | 654 | Kcna4 "potassium voltage-gated | 0.338 | 0.142 | 0.567 | 1.1e-21 | |
| RGD|2952 | 655 | Kcna4 "potassium voltage-gated | 0.338 | 0.141 | 0.567 | 1.1e-21 | |
| UNIPROTKB|P15385 | 655 | Kcna4 "Potassium voltage-gated | 0.338 | 0.141 | 0.567 | 1.1e-21 | |
| UNIPROTKB|Q05037 | 660 | KCNA4 "Potassium voltage-gated | 0.338 | 0.140 | 0.567 | 1.2e-21 | |
| UNIPROTKB|F1MFZ3 | 661 | KCNA4 "Potassium voltage-gated | 0.338 | 0.140 | 0.567 | 1.2e-21 |
| FB|FBgn0003380 Sh "Shaker" [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 372 (136.0 bits), Expect = 1.3e-33, P = 1.3e-33
Identities = 72/99 (72%), Positives = 81/99 (81%)
Query: 26 VVEAMWQMWGTNTRTELLFGIHIRPVGVWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFY 85
+ +A W W T T + +G + PVGVWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFY
Sbjct: 429 IPDAFW--WAVVTMTTVGYG-DMTPVGVWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFY 485
Query: 86 HRETDQEDMQSQNFNHVTSCPYLPGTLGEWLVDNSSSRS 124
HRETDQE+MQSQNFNHVTSCPYLPGTLG+ + +S S S
Sbjct: 486 HRETDQEEMQSQNFNHVTSCPYLPGTLGQHMKKSSLSES 524
|
|
| UNIPROTKB|Q9YGX8 KCNA4 "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|I3L9C7 KCNA4 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P22459 KCNA4 "Potassium voltage-gated channel subfamily A member 4" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SGM9 LOC100037947 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:96661 Kcna4 "potassium voltage-gated channel, shaker-related subfamily, member 4" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|2952 Kcna4 "potassium voltage-gated channel, shaker-related subfamily, member 4" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P15385 Kcna4 "Potassium voltage-gated channel subfamily A member 4" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q05037 KCNA4 "Potassium voltage-gated channel subfamily A member 4" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MFZ3 KCNA4 "Potassium voltage-gated channel subfamily A member 4" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
No hit with e-value below 0.005
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 275 | |||
| KOG1545|consensus | 507 | 99.83 | ||
| KOG3713|consensus | 477 | 99.74 | ||
| KOG4390|consensus | 632 | 99.53 | ||
| KOG1419|consensus | 654 | 99.51 | ||
| PRK10537 | 393 | voltage-gated potassium channel; Provisional | 99.51 | |
| PF01007 | 336 | IRK: Inward rectifier potassium channel; InterPro: | 99.31 | |
| PF07885 | 79 | Ion_trans_2: Ion channel; InterPro: IPR013099 This | 99.29 | |
| PLN03192 | 823 | Voltage-dependent potassium channel; Provisional | 99.06 | |
| KOG1418|consensus | 433 | 98.69 | ||
| KOG1420|consensus | 1103 | 98.63 | ||
| KOG0498|consensus | 727 | 98.42 | ||
| KOG4404|consensus | 350 | 97.79 | ||
| KOG3684|consensus | 489 | 97.6 | ||
| KOG3827|consensus | 400 | 97.56 | ||
| KOG1418|consensus | 433 | 97.35 | ||
| KOG0501|consensus | 971 | 97.28 | ||
| KOG4404|consensus | 350 | 97.27 | ||
| PF00520 | 200 | Ion_trans: Ion transport protein calcium channel s | 96.95 | |
| KOG3193|consensus | 1087 | 96.43 | ||
| KOG0500|consensus | 536 | 95.12 | ||
| PF00060 | 148 | Lig_chan: Ligand-gated ion channel; InterPro: IPR0 | 92.45 | |
| KOG0499|consensus | 815 | 83.39 |
| >KOG1545|consensus | Back alignment and domain information |
|---|
Probab=99.83 E-value=2.8e-22 Score=192.92 Aligned_cols=92 Identities=55% Similarity=0.911 Sum_probs=81.2
Q ss_pred eeEEeeec--ccccchHHHHHHHhhhhceeeceeecCcceecCcchhHHHHHHHHHHHHHHHhhHHHHHHHHHHHHHHhh
Q psy9066 12 ELLFGIHI--RLTQDLVVEAMWQMWGTNTRTELLFGIHIRPVGVWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRET 89 (275)
Q Consensus 12 ~LLfGt~g--~~~f~Si~DAfW~ywavVTmTTVGYG~DI~P~T~~GRI~til~il~GI~ifAl~vgvI~s~f~~~y~r~k 89 (275)
+++|.... ...|.||+|||| |++||||||||| |++|.|+.|||++.+|+++||+++|+|+++|+++|+++|+|++
T Consensus 378 avYFAEade~~S~F~SIPdaFW--wavVTMTTVGYG-Dm~P~TvgGKIVGslCAiaGVLTiALPVPVIVsNFnyFYhrEt 454 (507)
T KOG1545|consen 378 AVYFAEADEPESHFSSIPDAFW--WAVVTMTTVGYG-DMVPVTVGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRET 454 (507)
T ss_pred eeeeeecCCCccCCCcCcccce--EEEEEEEeeccc-cceecccCceehhhHHhhhhheEecccccEEEecccceeeccc
Confidence 34444443 456799999999 999999999999 9999999999999999999999999999999999999999999
Q ss_pred hhHHHhhhcCCCEEeCCCC
Q psy9066 90 DQEDMQSQNFNHVTSCPYL 108 (275)
Q Consensus 90 r~ek~~~~l~nHvIiCGy~ 108 (275)
+.+++ .+ ..|+..|+.+
T Consensus 455 e~ee~-~~-~~~~~~~~~~ 471 (507)
T KOG1545|consen 455 EGEEQ-AQ-YLHVDSCQDI 471 (507)
T ss_pred cchhh-hc-ccccccCCCC
Confidence 98874 33 7788888885
|
|
| >KOG3713|consensus | Back alignment and domain information |
|---|
| >KOG4390|consensus | Back alignment and domain information |
|---|
| >KOG1419|consensus | Back alignment and domain information |
|---|
| >PRK10537 voltage-gated potassium channel; Provisional | Back alignment and domain information |
|---|
| >PF01007 IRK: Inward rectifier potassium channel; InterPro: IPR013521 Potassium channels are the most diverse group of the ion channel family [, ] | Back alignment and domain information |
|---|
| >PF07885 Ion_trans_2: Ion channel; InterPro: IPR013099 This entry includes the two membrane helix type ion channels found in bacteria [] | Back alignment and domain information |
|---|
| >PLN03192 Voltage-dependent potassium channel; Provisional | Back alignment and domain information |
|---|
| >KOG1418|consensus | Back alignment and domain information |
|---|
| >KOG1420|consensus | Back alignment and domain information |
|---|
| >KOG0498|consensus | Back alignment and domain information |
|---|
| >KOG4404|consensus | Back alignment and domain information |
|---|
| >KOG3684|consensus | Back alignment and domain information |
|---|
| >KOG3827|consensus | Back alignment and domain information |
|---|
| >KOG1418|consensus | Back alignment and domain information |
|---|
| >KOG0501|consensus | Back alignment and domain information |
|---|
| >KOG4404|consensus | Back alignment and domain information |
|---|
| >PF00520 Ion_trans: Ion transport protein calcium channel signature potassium channel signature sodium channel signature; InterPro: IPR005821 This group of proteins is found in sodium, potassium, and calcium ion channels proteins | Back alignment and domain information |
|---|
| >KOG3193|consensus | Back alignment and domain information |
|---|
| >KOG0500|consensus | Back alignment and domain information |
|---|
| >PF00060 Lig_chan: Ligand-gated ion channel; InterPro: IPR001320 The ability of synapses to modify their synaptic strength in response to activity is a fundamental property of the nervous system and may be an essential component of learning and memory | Back alignment and domain information |
|---|
| >KOG0499|consensus | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 275 | ||||
| 3lut_B | 499 | A Structural Model For The Full-Length Shaker Potas | 5e-21 | ||
| 2a79_B | 499 | Mammalian Shaker Kv1.2 Potassium Channel- Beta Subu | 5e-21 | ||
| 2r9r_B | 514 | Shaker Family Voltage Dependent Potassium Channel ( | 3e-20 | ||
| 3lnm_B | 514 | F233w Mutant Of The Kv2.1 Paddle-Kv1.2 Chimera Chan | 4e-20 |
| >pdb|3LUT|B Chain B, A Structural Model For The Full-Length Shaker Potassium Channel Kv1.2 Length = 499 | Back alignment and structure |
|
| >pdb|2A79|B Chain B, Mammalian Shaker Kv1.2 Potassium Channel- Beta Subunit Complex Length = 499 | Back alignment and structure |
| >pdb|2R9R|B Chain B, Shaker Family Voltage Dependent Potassium Channel (Kv1.2-Kv2.1 Paddle Chimera Channel) In Association With Beta Subunit Length = 514 | Back alignment and structure |
| >pdb|3LNM|B Chain B, F233w Mutant Of The Kv2.1 Paddle-Kv1.2 Chimera Channel Length = 514 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 275 | |||
| 2r9r_B | 514 | Paddle chimera voltage gated potassium channel KV; | 1e-22 | |
| 3beh_A | 355 | MLL3241 protein; transmembrane protein, membrane p | 7e-17 | |
| 3pjs_K | 166 | KCSA, voltage-gated potassium channel; ION channel | 4e-16 | |
| 3eff_K | 139 | Voltage-gated potassium channel; FULL length KCSA, | 3e-15 | |
| 2a9h_A | 155 | Voltage-gated potassium channel; potassium channel | 3e-14 | |
| 2ih3_C | 122 | Voltage-gated potassium channel; ION channel D-ami | 6e-14 | |
| 2k1e_A | 103 | Water soluble analogue of potassium channel, KCSA; | 3e-13 | |
| 1orq_C | 223 | Potassium channel; voltage-dependent, KVAP, FAB co | 2e-12 |
| >2r9r_B Paddle chimera voltage gated potassium channel KV; voltage sensor, voltage dependent, ION CH shaker, membrane protein, eukaryotic; HET: NAP PGW; 2.40A {Rattus norvegicus} PDB: 3lnm_B* 3lut_B* 2a79_B* Length = 514 | Back alignment and structure |
|---|
Score = 95.9 bits (238), Expect = 1e-22
Identities = 64/196 (32%), Positives = 86/196 (43%), Gaps = 61/196 (31%)
Query: 28 EAMWQMWGTNTRTELLFGIHIRPVGVWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHR 87
+A W W + T + +G + P + GKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHR
Sbjct: 378 DAFW--WAVVSMTTVGYG-DMVPTTIGGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHR 434
Query: 88 ETDQEDMQSQNFNHVTSCPYLPGTLGEWLVDNSSSRSRKVAAATGLVHNDVGSSWEDMQS 147
ET+ E+
Sbjct: 435 ETEGEEQAQY-------------------------------------------------- 444
Query: 148 QNFNHVTSCPYLPGTLGQHMKKSSLSESSSDMMELEEGLLFGRDYSTSLTNKKLLSNNNL 207
VTS P +P + +S+ + S SD ME++EG+ + S ++ L N
Sbjct: 445 ---LQVTSSPKIPSSPDLKKSRSASTISKSDYMEIQEGV----NNSNEDFREENLKTANS 497
Query: 208 SLCNPKH-NIMSIETD 222
+L N + NI + TD
Sbjct: 498 TLANTNYVNITKMLTD 513
|
| >3beh_A MLL3241 protein; transmembrane protein, membrane protein; HET: LDA; 3.10A {Mesorhizobium loti} PDB: 2zd9_A* Length = 355 | Back alignment and structure |
|---|
| >3pjs_K KCSA, voltage-gated potassium channel; ION channel, conducts K+ IONS, cell membrane, transport PROT; 3.80A {Streptomyces lividans} PDB: 1f6g_A Length = 166 | Back alignment and structure |
|---|
| >3eff_K Voltage-gated potassium channel; FULL length KCSA, bulge helix, cell membrane, ION transport, ionic channel, membrane, transmembrane; 3.80A {Streptomyces lividans} Length = 139 | Back alignment and structure |
|---|
| >2a9h_A Voltage-gated potassium channel; potassium channel, KCSA, structure, membrane protein, metal transport; HET: PCA; NMR {Streptomyces lividans} SCOP: f.14.1.1 Length = 155 | Back alignment and structure |
|---|
| >2ih3_C Voltage-gated potassium channel; ION channel D-amino acid semi-synthetic, membrane protein; HET: 1EM; 1.72A {Streptomyces lividans} PDB: 2ih1_C* 1r3j_C* 1k4d_C* 1r3i_C* 1k4c_C* 1r3k_C* 1r3l_C* 2bob_C* 2boc_C* 2hvj_C* 2hvk_C* 2itc_C 2itd_C 3gb7_C* 3iga_C* 1jvm_A 1s5h_C* 3ifx_A* 1j95_A 2jk5_C* ... Length = 122 | Back alignment and structure |
|---|
| >2k1e_A Water soluble analogue of potassium channel, KCSA; homotetramer, ION transport, ionic channel, membrane, transmembrane, transport; NMR {Escherichia coli} PDB: 2kb1_A Length = 103 | Back alignment and structure |
|---|
| >1orq_C Potassium channel; voltage-dependent, KVAP, FAB complex, MEM protein; 3.20A {Aeropyrum pernix} SCOP: f.14.1.1 PDB: 2a0l_A Length = 223 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 275 | |||
| 1xl4_A | 301 | Inward rectifier potassium channel; integral membr | 99.83 | |
| 1p7b_A | 333 | Integral membrane channel and cytosolic domains; t | 99.83 | |
| 2qks_A | 321 | KIR3.1-prokaryotic KIR channel chimera; G-protein | 99.8 | |
| 2r9r_B | 514 | Paddle chimera voltage gated potassium channel KV; | 99.79 | |
| 3sya_A | 340 | G protein-activated inward rectifier potassium CH; | 99.7 | |
| 3spc_A | 343 | Inward-rectifier K+ channel KIR2.2; PIP, membrane | 99.67 | |
| 4h33_A | 137 | LMO2059 protein; bilayers, KVLM, lipidic cubic pha | 99.56 | |
| 2a9h_A | 155 | Voltage-gated potassium channel; potassium channel | 99.53 | |
| 2ih3_C | 122 | Voltage-gated potassium channel; ION channel D-ami | 99.52 | |
| 4gx0_A | 565 | TRKA domain protein; membrane protein, ION channel | 99.52 | |
| 2k1e_A | 103 | Water soluble analogue of potassium channel, KCSA; | 99.5 | |
| 3eff_K | 139 | Voltage-gated potassium channel; FULL length KCSA, | 99.49 | |
| 1lnq_A | 336 | MTHK channels, potassium channel related protein; | 99.46 | |
| 2q67_A | 114 | Potassium channel protein; inverted teepee, helix | 99.4 | |
| 3ldc_A | 82 | Calcium-gated potassium channel MTHK; transmembran | 99.37 | |
| 3vou_A | 148 | ION transport 2 domain protein, voltage-gated SOD | 99.36 | |
| 1orq_C | 223 | Potassium channel; voltage-dependent, KVAP, FAB co | 99.35 | |
| 3ouf_A | 97 | Potassium channel protein; ION channel, membrane, | 99.34 | |
| 3beh_A | 355 | MLL3241 protein; transmembrane protein, membrane p | 99.34 | |
| 3pjs_K | 166 | KCSA, voltage-gated potassium channel; ION channel | 99.32 | |
| 3um7_A | 309 | Potassium channel subfamily K member 4; potassium | 99.22 | |
| 3um7_A | 309 | Potassium channel subfamily K member 4; potassium | 99.09 | |
| 3ukm_A | 280 | Potassium channel subfamily K member 1; membrane p | 99.07 | |
| 3ukm_A | 280 | Potassium channel subfamily K member 1; membrane p | 99.03 | |
| 3rvy_A | 285 | ION transport protein; tetrameric ION channel, vol | 98.62 | |
| 3agw_A | 208 | KIR3.2, G protein-activated inward rectifier potas | 96.06 | |
| 1n9p_A | 207 | GIRK1, G protein-activated inward rectifier potass | 95.96 | |
| 2gix_A | 208 | Inward rectifier potassium channel 2; cytoplasmic | 95.63 | |
| 4dxw_A | 229 | Navrh, ION transport protein; tetrameric, voltage- | 95.28 | |
| 1u4f_A | 270 | Inward rectifier potassium channel 2; cytoplasmic | 94.3 | |
| 2xky_I | 309 | Inward rectifier potassium channel 2; ION channel, | 93.77 | |
| 3kg2_A | 823 | Glutamate receptor 2; ION channel, membrane protei | 93.57 |
| >1xl4_A Inward rectifier potassium channel; integral membrane protein, ION channel, inwardly rectifying channel, metal transport; 2.60A {Magnetospirillum magnetotacticum} SCOP: b.1.18.16 f.14.1.1 PDB: 1xl6_A* 2wlh_A 2wli_B 2wlj_A* 2wlk_A* 2wlm_A 2wlo_A 2wln_A 3zrs_A 2wli_A 2x6c_A* 2x6b_A* 2x6a_A* | Back alignment and structure |
|---|
Probab=99.83 E-value=1.6e-22 Score=185.81 Aligned_cols=154 Identities=14% Similarity=0.179 Sum_probs=120.6
Q ss_pred cccchHHHHHHHhhhhceeeceeecCcceecCcchhHHHHHHHHHHHHHHHhhHHHHHHHHHHHHHHhhhhHHHhhhcCC
Q psy9066 21 LTQDLVVEAMWQMWGTNTRTELLFGIHIRPVGVWGKIVGSLCAIAGVLTIALPVPVIVSNFNYFYHRETDQEDMQSQNFN 100 (275)
Q Consensus 21 ~~f~Si~DAfW~ywavVTmTTVGYG~DI~P~T~~GRI~til~il~GI~ifAl~vgvI~s~f~~~y~r~kr~ek~~~~l~n 100 (275)
..+.+++|||| |+++|+|||||| |++|.|+.||++++++++.|++++|++++.+++.|.+. + ++ .+..+
T Consensus 78 ~~~~s~~~a~y--fs~vT~tTvGYG-Di~P~t~~gr~~~~~~~l~G~~~~a~~~g~v~~~~~~~---~---~r--~~fs~ 146 (301)
T 1xl4_A 78 ARPGSFTDAFF--FSVQTMATIGYG-KLIPIGPLANTLVTLEALCGMLGLAVAASLIYARFTRP---T---AG--VLFSS 146 (301)
T ss_dssp SCTTCHHHHHH--HHHHHHTTCCCS-SSCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHTCC---C---CC--EEECS
T ss_pred CCcCCHHHHHH--HhhhheeccCCC-CCcCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhH---H---hh--hccCC
Confidence 34689999999 999999999999 99999999999999999999999999999998877531 1 11 45789
Q ss_pred CEEeCCCCCCCCCcccccCCCCchhhhH-hhhcccccCCCCchhhhcccccccc----cCCCC--CCCcc-cccccCCCC
Q psy9066 101 HVTSCPYLPGTLGEWLVDNSSSRSRKVA-AATGLVHNDVGSSWEDMQSQNFNHV----TSCPY--LPGTL-GQHMKKSSL 172 (275)
Q Consensus 101 HvIiCGy~~g~lge~I~~~~~s~~~~ea-~a~~Lv~~di~~~~e~~q~~~f~~~----s~~p~--l~~~~-~~~~~~s~~ 172 (275)
|.++||+++..+-.....+.+.+...++ ....|....+..|+|.+ ++++++ +..|. +||++ |.|+++||+
T Consensus 147 ~~vI~~~~g~~~l~~R~~n~r~~~li~a~vr~~l~~~~~t~eGe~~--~~~~~L~l~~~~~~~l~~p~~v~H~Id~~SPL 224 (301)
T 1xl4_A 147 RMVISDFEGKPTLMMRLANLRIEQIIEADVHLVLVRSEISQEGMVF--RRFHDLTLTRSRSPIFSLSWTVMHPIDHHSPI 224 (301)
T ss_dssp CEEEEEETTEEEEEEEEEECSSSCEEEEEEEEEEEEEEECTTSCEE--EEEEECCCSCCEEEEECSEEEEEEECCTTCTT
T ss_pred eEEEecCCCcceeeeeccccccceEEccEEEEEEEEeeEcCCCcEE--EEEeccccccCCeEEEEeeEEEEEecCCCCCc
Confidence 9999999854444444444334345555 44456666777777776 777765 55676 77888 999999999
Q ss_pred CCCcchhhhhhhccc
Q psy9066 173 SESSSDMMELEEGLL 187 (275)
Q Consensus 173 ~~~~~~~~e~~e~~~ 187 (275)
.+-+.|.|+.++.|+
T Consensus 225 ~~~s~~~L~~~~~ei 239 (301)
T 1xl4_A 225 YGETDETLRNSHSEF 239 (301)
T ss_dssp TTCCHHHHHHHTCEE
T ss_pred ccCCHhHHhcCCeEE
Confidence 999999888877654
|
| >1p7b_A Integral membrane channel and cytosolic domains; transmembrane helices, ION conduction, immunoglobulin fold, assembly; 3.65A {Burkholderia pseudomallei} SCOP: b.1.18.16 f.14.1.1 PDB: 2wll_B* 2wll_A* | Back alignment and structure |
|---|
| >2qks_A KIR3.1-prokaryotic KIR channel chimera; G-protein gated inward rectifier, potassium channel selectivity filter, metal transport; HET: BNG; 2.20A {Burkholderia xenovorans} | Back alignment and structure |
|---|
| >2r9r_B Paddle chimera voltage gated potassium channel KV; voltage sensor, voltage dependent, ION CH shaker, membrane protein, eukaryotic; HET: NAP PGW; 2.40A {Rattus norvegicus} PDB: 3lnm_B* 3lut_B* 2a79_B* | Back alignment and structure |
|---|
| >3sya_A G protein-activated inward rectifier potassium CH; ION channel, potassium channel, inward rectification, sodium PIP2 binding, G protein binding; HET: PIO; 2.98A {Mus musculus} PDB: 3syo_A 3syc_A 3syp_A 3syq_A* | Back alignment and structure |
|---|
| >3spc_A Inward-rectifier K+ channel KIR2.2; PIP, membrane protein, lipid, receptor, metal transport; HET: P8P; 2.45A {Gallus gallus} PDB: 3jyc_A* 3spi_A* 3sph_A* 3spj_A 3spg_A* | Back alignment and structure |
|---|
| >4h33_A LMO2059 protein; bilayers, KVLM, lipidic cubic phase (LCP), pore module, ION membrane protein; HET: OLC; 3.10A {Listeria monocytogenes} PDB: 4h37_A | Back alignment and structure |
|---|
| >2a9h_A Voltage-gated potassium channel; potassium channel, KCSA, structure, membrane protein, metal transport; HET: PCA; NMR {Streptomyces lividans} SCOP: f.14.1.1 | Back alignment and structure |
|---|
| >2ih3_C Voltage-gated potassium channel; ION channel D-amino acid semi-synthetic, membrane protein; HET: 1EM; 1.72A {Streptomyces lividans} PDB: 2ih1_C* 1r3j_C* 1k4d_C* 1r3i_C* 1k4c_C* 1r3k_C* 1r3l_C* 2bob_C* 2boc_C* 2hvj_C* 2hvk_C* 2itc_C 2itd_C 3gb7_C* 3iga_C* 1jvm_A 1s5h_C* 3ifx_A* 1j95_A 2jk5_C* ... | Back alignment and structure |
|---|
| >4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* | Back alignment and structure |
|---|
| >2k1e_A Water soluble analogue of potassium channel, KCSA; homotetramer, ION transport, ionic channel, membrane, transmembrane, transport; NMR {Escherichia coli} PDB: 2kb1_A | Back alignment and structure |
|---|
| >3eff_K Voltage-gated potassium channel; FULL length KCSA, bulge helix, cell membrane, ION transport, ionic channel, membrane, transmembrane; 3.80A {Streptomyces lividans} | Back alignment and structure |
|---|
| >1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A | Back alignment and structure |
|---|
| >2q67_A Potassium channel protein; inverted teepee, helix bundle, tetramer, central cavity, ION metal transport, membrane protein; 2.30A {Bacillus cereus} PDB: 2q68_A 2q6a_A 2q69_A 2ahy_A 2ahz_A | Back alignment and structure |
|---|
| >3ldc_A Calcium-gated potassium channel MTHK; transmembrane, ION channel, open conformation, IO transport; 1.45A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3lde_A 4hyo_A 4hz3_D 3r65_A 3ous_A 3ldd_A | Back alignment and structure |
|---|
| >3vou_A ION transport 2 domain protein, voltage-gated SOD channel; 4-helical bundle, ION channel, membrane, transport protein; 3.20A {Bacillus weihenstephanensis} | Back alignment and structure |
|---|
| >1orq_C Potassium channel; voltage-dependent, KVAP, FAB complex, MEM protein; 3.20A {Aeropyrum pernix} SCOP: f.14.1.1 PDB: 2a0l_A | Back alignment and structure |
|---|
| >3ouf_A Potassium channel protein; ION channel, membrane, membrane protein; 1.55A {Bacillus cereus} PDB: 3t4z_A 3tcu_A 3t1c_A 3tet_A 3t4d_A 3t2m_A 3e86_A 3e83_A 3e89_A 3e8b_A 3e8f_A 3e8g_A 3e8h_A 3k0d_A 3k0g_A 3k06_A 3k08_A 3k04_A 3k03_A | Back alignment and structure |
|---|
| >3beh_A MLL3241 protein; transmembrane protein, membrane protein; HET: LDA; 3.10A {Mesorhizobium loti} PDB: 2zd9_A* | Back alignment and structure |
|---|
| >3pjs_K KCSA, voltage-gated potassium channel; ION channel, conducts K+ IONS, cell membrane, transport PROT; 3.80A {Streptomyces lividans} PDB: 1f6g_A | Back alignment and structure |
|---|
| >3um7_A Potassium channel subfamily K member 4; potassium ION channel, metal transport; 3.31A {Homo sapiens} | Back alignment and structure |
|---|
| >3um7_A Potassium channel subfamily K member 4; potassium ION channel, metal transport; 3.31A {Homo sapiens} | Back alignment and structure |
|---|
| >3ukm_A Potassium channel subfamily K member 1; membrane protein, eukaryotic, two-pore DO potassium channel, K2P channel, membrane; HET: UND; 3.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3ukm_A Potassium channel subfamily K member 1; membrane protein, eukaryotic, two-pore DO potassium channel, K2P channel, membrane; HET: UND; 3.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3rvy_A ION transport protein; tetrameric ION channel, voltage-gated sodium-selective ION C membrane, metal transport; HET: PX4; 2.70A {Arcobacter butzleri} PDB: 3rvz_A* 4ekw_A* 3rw0_A* | Back alignment and structure |
|---|
| >3agw_A KIR3.2, G protein-activated inward rectifier potassium CH; cytoplasmic assembly, ION channel, beta-barrel, transport PR; 2.20A {Mus musculus} PDB: 3at8_A 3at9_A 3ata_A 3atb_A 3atd_A 3ate_A 3atf_A 2e4f_A 3auw_B 3auw_A | Back alignment and structure |
|---|
| >1n9p_A GIRK1, G protein-activated inward rectifier potassium CH; beta barrel, cytoplasmic domain, inward rectifier potassium channel, metal transport; 1.80A {Mus musculus} SCOP: b.1.18.16 PDB: 3k6n_A 1u4e_A | Back alignment and structure |
|---|
| >2gix_A Inward rectifier potassium channel 2; cytoplasmic domains of KIR2.1, andersen'S mutation, metal transport; 2.02A {Mus musculus} | Back alignment and structure |
|---|
| >4dxw_A Navrh, ION transport protein; tetrameric, voltage-gated sodium channel, sodium selective, gated ION channel; HET: BNG PX4; 3.05A {Alpha proteobacterium HIMB114} | Back alignment and structure |
|---|
| >1u4f_A Inward rectifier potassium channel 2; cytoplasmic domain, KIR2.1, IRK1, inwardly rectifying K channel, rectification, allergen; 2.41A {Mus musculus} | Back alignment and structure |
|---|
| >2xky_I Inward rectifier potassium channel 2; ION channel, metal transport, membrane protein; 17.20A {Mus musculus} | Back alignment and structure |
|---|
| >3kg2_A Glutamate receptor 2; ION channel, membrane protein, cell membrane, glycoprotein, transport, membrane, postsynaptic cell membrane, editing; HET: ZK1 NAG BMA; 3.60A {Rattus norvegicus} | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 275 | ||||
| d1r3jc_ | 103 | f.14.1.1 (C:) Potassium channel protein {Streptomy | 0.002 |
| >d1r3jc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} Length = 103 | Back information, alignment and structure |
|---|
class: Membrane and cell surface proteins and peptides fold: Voltage-gated potassium channels superfamily: Voltage-gated potassium channels family: Voltage-gated potassium channels domain: Potassium channel protein species: Streptomyces coelicolor [TaxId: 1902]
Score = 34.9 bits (80), Expect = 0.002
Identities = 15/54 (27%), Positives = 26/54 (48%), Gaps = 3/54 (5%)
Query: 28 EAMWQMWGTNTRTELLFGIHIRPVGVWGKIVGSLCAIAGVLTIALPVPVIVSNF 81
A+W W T T + +G PV +WG+ V + +AG+ + L + + F
Sbjct: 43 RALW--WSVETATTVGYGDLY-PVTLWGRCVAVVVMVAGITSFGLVTAALATWF 93
|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 275 | |||
| d1r3jc_ | 103 | Potassium channel protein {Streptomyces coelicolor | 99.63 | |
| d1p7ba2 | 116 | Inward rectifier potassium channel Kirbac1.1 {Burk | 99.42 | |
| d1xl4a2 | 116 | Inward rectifier potassium channel kirbac3.1 {Magn | 99.41 | |
| d1lnqa2 | 80 | Potassium channel-related protein MthK {Archaeon M | 99.18 | |
| d2h8pc1 | 57 | Potassium channel protein {Streptomyces coelicolor | 97.96 | |
| d1p7ba1 | 158 | Inward rectifier potassium channel Kirbac1.1 {Burk | 97.31 | |
| d1xl4a1 | 161 | Inward rectifier potassium channel kirbac3.1 {Magn | 96.81 | |
| d1n9pa_ | 202 | G protein-gated inward rectifier Girk1 {Mouse (Mus | 95.96 |
| >d1r3jc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
class: Membrane and cell surface proteins and peptides fold: Voltage-gated potassium channels superfamily: Voltage-gated potassium channels family: Voltage-gated potassium channels domain: Potassium channel protein species: Streptomyces coelicolor [TaxId: 1902]
Probab=99.63 E-value=1.1e-16 Score=123.50 Aligned_cols=59 Identities=25% Similarity=0.564 Sum_probs=55.4
Q ss_pred ccchHHHHHHHhhhhceeeceeecCcceecCcchhHHHHHHHHHHHHHHHhhHHHHHHHHHH
Q psy9066 22 TQDLVVEAMWQMWGTNTRTELLFGIHIRPVGVWGKIVGSLCAIAGVLTIALPVPVIVSNFNY 83 (275)
Q Consensus 22 ~f~Si~DAfW~ywavVTmTTVGYG~DI~P~T~~GRI~til~il~GI~ifAl~vgvI~s~f~~ 83 (275)
.+.+++||+| |+++|+|||||| |++|.|..||++++++++.|+++++++++.+.+.+..
T Consensus 37 ~~~s~~~aly--~~~vT~tTvGYG-Di~P~t~~gr~~~~~~~~~Gi~~~~~~~~~i~~~~~~ 95 (103)
T d1r3jc_ 37 QLITYPRALW--WSVETATTVGYG-DLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVG 95 (103)
T ss_dssp CCCSHHHHHH--HHHHHHTTCCCS-SSCCCSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred ccCchhhhhh--hheeeecccccC-ccccCChhHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence 4578999999 999999999999 9999999999999999999999999999999887764
|
| >d1p7ba2 f.14.1.1 (A:36-151) Inward rectifier potassium channel Kirbac1.1 {Burkholderia pseudomallei [TaxId: 28450]} | Back information, alignment and structure |
|---|
| >d1xl4a2 f.14.1.1 (A:23-138) Inward rectifier potassium channel kirbac3.1 {Magnetospirillum magnetotacticum [TaxId: 188]} | Back information, alignment and structure |
|---|
| >d1lnqa2 f.14.1.1 (A:19-98) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d2h8pc1 f.14.1.1 (C:22-78) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1p7ba1 b.1.18.16 (A:152-309) Inward rectifier potassium channel Kirbac1.1 {Burkholderia pseudomallei [TaxId: 28450]} | Back information, alignment and structure |
|---|
| >d1xl4a1 b.1.18.16 (A:139-299) Inward rectifier potassium channel kirbac3.1 {Magnetospirillum magnetotacticum [TaxId: 188]} | Back information, alignment and structure |
|---|
| >d1n9pa_ b.1.18.16 (A:) G protein-gated inward rectifier Girk1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|