Psyllid ID: psy9201

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260----
MLLPQEQKLLSIAPLAATTFTLLFSLSFMLFIIFLFSWGLPEFARFQLGLYLPFGDPPLHITLNQPEWGRESEQHAIGKMVTLVTHLDANNFLTSLQAQLYYVFRLSCTRLGQWAIGYVTADGDILQTIPQNKSLCQALLDGYREGLSGLIYSILRSYLYPDGRNVNPELSWEFISTPEDHIKVTQEQYELYCEMGSTFQLCKICAENDKDIRIEPCGHLLCTPCLTSWQVSNRSRILFYLFYFFSVKEIPLWTPTFVAKIRLH
cccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHccccccccccccEEEEcccccccHHHHHHHcEEEEEEcccccEEHHHHHcccccEEEEEcccccccEEEEEEEccccEEEEcccccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccccccccccccccccEEEcccccccHHHHHHHHccccccccccccccccEEEEEccccccHHHHccc
cccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHccEccccccccEEEEcccccccHHHHHHHHHEEEEEcccHHHHHHHHHHHHHHEEEEEcccccccEEEEEEcccccEEEEccccccHHHHHHHHHHccccccccccccccEccccccccccHHHHccccccccEEEcHHHHHHHHHccccHEEEEEEccccccEEEccccccccHHHHHHHHcccccccccEEEEEEEEcccccccccccEEEEcc
MLLPQEQKLLSIAPLAATTFTLLFSLSFMLFIIFLFswglpefarfqlglylpfgdpplhitlnqpewgreseqHAIGKMVTLVTHLDANNFLTSLQAQLYYVFRLSCTrlgqwaigyvtadgdilqtipQNKSLCQALLDGYREGLSGLIYSILRSYlypdgrnvnpelswefistpedhiKVTQEQYELYCEmgstfqlckicaendkdiriepcghllctpcltswqvsnrSRILFYLFYFFsvkeiplwtpTFVAKIRLH
MLLPQEQKLLSIAPLAATTFTLLFSLSFMLFIIFLFSWGLPEFARFQLGLYLPFGDPPLHITLNQPEWGRESEQHAIGKMVTLVTHLDANNFLTSLQAQLYYVFRLSCTRLGQWAIGYVTADGDILQTIPQNKSLCQALLDGYREGLSGLIYSILRSYLYPDGRNVNPELSWEFISTPEDHIKVTQEQYELYCEMGSTFQLCKICAENDKDIRIEPCGHLLCTPCLTSWQVSNRSRILFYLFYFFsvkeiplwTPTFVAKIRLH
MLLPQEQKLLSiaplaattftllfslsfmlfiiflfsWGLPEFARFQLGLYLPFGDPPLHITLNQPEWGRESEQHAIGKMVTLVTHLDANNFLTSLQAQLYYVFRLSCTRLGQWAIGYVTADGDILQTIPQNKSLCQALLDGYREGLSGLIYSILRSYLYPDGRNVNPELSWEFISTPEDHIKVTQEQYELYCEMGSTFQLCKICAENDKDIRIEPCGHLLCTPCLTSWQVSNRSRILFYLFYFFSVKEIPLWTPTFVAKIRLH
********LLSIAPLAATTFTLLFSLSFMLFIIFLFSWGLPEFARFQLGLYLPFGDPPLHITLNQPEWGRESEQHAIGKMVTLVTHLDANNFLTSLQAQLYYVFRLSCTRLGQWAIGYVTADGDILQTIPQNKSLCQALLDGYREGLSGLIYSILRSYLYPDGRNVNPELSWEFISTPEDHIKVTQEQYELYCEMGSTFQLCKICAENDKDIRIEPCGHLLCTPCLTSWQVSNRSRILFYLFYFFSVKEIPLWTPTFVAKI***
*******KLLSIAPLAATTFTLLFSLSFMLFIIFLFSWGLPEFARFQLGLYLPFGDPPLHITLNQPEWGRESEQHAIGKMVTLVTHLDANNFLTSLQAQLYYVFRLSCTRLGQWAIGYVTADGDILQTIPQNKSLCQALLDGYREGLSGLIYSILRSYLYPDGRNVNP***************************GSTFQLCKICAENDKDIRIEPCGHLLCTPCLTSWQVSNRSRILFYLFYFFSVKEIPLWTPTFVA*****
MLLPQEQKLLSIAPLAATTFTLLFSLSFMLFIIFLFSWGLPEFARFQLGLYLPFGDPPLHITLNQPEWGRESEQHAIGKMVTLVTHLDANNFLTSLQAQLYYVFRLSCTRLGQWAIGYVTADGDILQTIPQNKSLCQALLDGYREGLSGLIYSILRSYLYPDGRNVNPELSWEFISTPEDHIKVTQEQYELYCEMGSTFQLCKICAENDKDIRIEPCGHLLCTPCLTSWQVSNRSRILFYLFYFFSVKEIPLWTPTFVAKIRLH
MLLPQEQKLLSIAPLAATTFTLLFSLSFMLFIIFLFSWGLPEFARFQLGLYLPFGDPPLHITLNQPEWGRESEQHAIGKMVTLVTHLDANNFLTSLQAQLYYVFRLSCTRLGQWAIGYVTADGDILQTIPQNKSLCQALLDGYREGLSGLIYSILRSYLYPDGRNVNPELSWEFISTPEDHIKVTQEQYELYCEMGSTFQLCKICAENDKDIRIEPCGHLLCTPCLTSWQVSNRSRILFYLFYFFSVKEIPLWTPTFVAKIR**
ooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooo
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLLPQEQKLLSIAPLAATTFTLLFSLSFMLFIIFLFSWGLPEFARFQLGLYLPFGDPPLHITLNQPEWGRESEQHAIGKMVTLVTHLDANNFLTSLQAQLYYVFRLSCTRLGQWAIGYVTADGDILQTIPQNKSLCQALLDGYREGLSGLIYSILRSYLYPDGRNVNPELSWEFISTPEDHIKVTQEQYELYCEMGSTFQLCKICAENDKDIRIEPCGHLLCTPCLTSWQVSNRSRILFYLFYFFSVKEIPLWTPTFVAKIRLH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query264 2.2.26 [Sep-21-2011]
P22682 913 E3 ubiquitin-protein liga yes N/A 0.526 0.152 0.666 9e-55
P22681 906 E3 ubiquitin-protein liga yes N/A 0.526 0.153 0.666 2e-54
Q6GQL0 918 E3 ubiquitin-protein liga N/A N/A 0.530 0.152 0.662 2e-53
Q6DFR2 982 E3 ubiquitin-protein liga no N/A 0.462 0.124 0.742 2e-53
Q3TTA7 982 E3 ubiquitin-protein liga no N/A 0.462 0.124 0.727 9e-53
Q8K4S7 938 E3 ubiquitin-protein liga no N/A 0.530 0.149 0.65 1e-52
Q13191 982 E3 ubiquitin-protein liga no N/A 0.462 0.124 0.727 1e-52
Q6NRE7 764 E3 ubiquitin-protein liga N/A N/A 0.462 0.159 0.734 5e-52
Q9ULV8474 Signal transduction prote no N/A 0.484 0.270 0.550 7e-39
Q80XL1496 Signal transduction prote no N/A 0.462 0.245 0.575 1e-37
>sp|P22682|CBL_MOUSE E3 ubiquitin-protein ligase CBL OS=Mus musculus GN=Cbl PE=1 SV=3 Back     alignment and function desciption
 Score =  213 bits (543), Expect = 9e-55,   Method: Compositional matrix adjust.
 Identities = 106/159 (66%), Positives = 120/159 (75%), Gaps = 20/159 (12%)

Query: 84  VTHLDANNFLT--SLQAQLY--------YVFRLSCTRLGQWAIGYVTADGDILQTIPQNK 133
           VTH     FLT   ++A+L         Y+FRLSCTRLGQWAIGYVTADG+ILQTIP NK
Sbjct: 261 VTHPGYMAFLTYDEVKARLQKFIHKPGSYIFRLSCTRLGQWAIGYVTADGNILQTIPHNK 320

Query: 134 SLCQALLDGYREGLSGLIYSILRSYLYPDGRNVNPELSWEFISTPEDHIKVTQEQYELYC 193
            L QAL+DG+REG           YL+PDGRN NP+L+     TP+DHIKVTQEQYELYC
Sbjct: 321 PLFQALIDGFREGF----------YLFPDGRNQNPDLTGLCEPTPQDHIKVTQEQYELYC 370

Query: 194 EMGSTFQLCKICAENDKDIRIEPCGHLLCTPCLTSWQVS 232
           EMGSTFQLCKICAENDKD++IEPCGHL+CT CLTSWQ S
Sbjct: 371 EMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQES 409
Adapter protein that functions as a negative regulator of many signaling pathways that are triggered by activation of cell surface receptors. Acts as an E3 ubiquitin-protein ligase, which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes, and then transfers it to substrates promoting their degradation by the proteasome. Recognizes activated receptor tyrosine kinases, including KIT, FLT1, FGFR1, FGFR2, PDGFRA, PDGFRB, EGFR, CSF1R, EPHA8 and KDR and terminates signaling. Recognizes membrane-bound HCK and other kinases of the SRC family and mediates their ubiquitination and degradation. Participates in signal transduction in hematopoietic cells. Plays an important role in the regulation of osteoblast differentiation and apoptosis. Essential for osteoclastic bone resorption. The Tyr-737 phosphorylated form induces the activation and recruitment of phosphatidylinositol 3-kinase to the cell membrane in a signaling pathway that is critical for osteoclast function.
Mus musculus (taxid: 10090)
EC: 6EC: .EC: 3EC: .EC: 2EC: .EC: -
>sp|P22681|CBL_HUMAN E3 ubiquitin-protein ligase CBL OS=Homo sapiens GN=CBL PE=1 SV=2 Back     alignment and function description
>sp|Q6GQL0|CBLBA_XENLA E3 ubiquitin-protein ligase CBL-B-A OS=Xenopus laevis GN=cblb-a PE=2 SV=1 Back     alignment and function description
>sp|Q6DFR2|CBLB_XENTR E3 ubiquitin-protein ligase CBL-B OS=Xenopus tropicalis GN=cblb PE=2 SV=1 Back     alignment and function description
>sp|Q3TTA7|CBLB_MOUSE E3 ubiquitin-protein ligase CBL-B OS=Mus musculus GN=Cblb PE=1 SV=3 Back     alignment and function description
>sp|Q8K4S7|CBLB_RAT E3 ubiquitin-protein ligase CBL-B OS=Rattus norvegicus GN=Cblb PE=2 SV=1 Back     alignment and function description
>sp|Q13191|CBLB_HUMAN E3 ubiquitin-protein ligase CBL-B OS=Homo sapiens GN=CBLB PE=1 SV=2 Back     alignment and function description
>sp|Q6NRE7|CBLBB_XENLA E3 ubiquitin-protein ligase CBL-B-B OS=Xenopus laevis GN=cblb-b PE=2 SV=1 Back     alignment and function description
>sp|Q9ULV8|CBLC_HUMAN Signal transduction protein CBL-C OS=Homo sapiens GN=CBLC PE=1 SV=3 Back     alignment and function description
>sp|Q80XL1|CBLC_MOUSE Signal transduction protein CBL-C OS=Mus musculus GN=Cblc PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query264
427778813 457 Putative tyrosine kinase negative regula 0.526 0.304 0.761 1e-61
427797985 445 Putative tyrosine kinase negative regula 0.526 0.312 0.761 2e-61
241651245 459 E3 ubiquitin ligase, putative [Ixodes sc 0.526 0.302 0.754 3e-61
242015997 455 E3 ubiquitin-protein ligase CBL, putativ 0.462 0.268 0.848 3e-61
380028526 744 PREDICTED: E3 ubiquitin-protein ligase C 0.458 0.162 0.809 2e-59
328791675 745 PREDICTED: e3 ubiquitin-protein ligase C 0.458 0.162 0.809 2e-59
340709000 747 PREDICTED: e3 ubiquitin-protein ligase C 0.458 0.161 0.809 2e-59
350419425 745 PREDICTED: E3 ubiquitin-protein ligase C 0.458 0.162 0.809 3e-59
383864909 746 PREDICTED: E3 ubiquitin-protein ligase C 0.458 0.162 0.809 3e-59
391338049 797 PREDICTED: E3 ubiquitin-protein ligase C 0.458 0.151 0.824 6e-59
>gi|427778813|gb|JAA54858.1| Putative tyrosine kinase negative regulator cbl [Rhipicephalus pulchellus] Back     alignment and taxonomy information
 Score =  242 bits (617), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 128/159 (80%), Gaps = 20/159 (12%)

Query: 84  VTHLDANNFLT--SLQAQLY--------YVFRLSCTRLGQWAIGYVTADGDILQTIPQNK 133
           VTH     FLT   ++A+LY        YVFRLSCTRLGQWAIGYVTA+G+ILQTIPQNK
Sbjct: 246 VTHPGYVAFLTYDEVKARLYKYINKPGSYVFRLSCTRLGQWAIGYVTAEGNILQTIPQNK 305

Query: 134 SLCQALLDGYREGLSGLIYSILRSYLYPDGRNVNPELSWEFISTPEDHIKVTQEQYELYC 193
           SLCQALLDGYREG           YLYPDGRNVNP+LSW   +TPEDHIKVTQEQYELYC
Sbjct: 306 SLCQALLDGYREGF----------YLYPDGRNVNPDLSWAVQATPEDHIKVTQEQYELYC 355

Query: 194 EMGSTFQLCKICAENDKDIRIEPCGHLLCTPCLTSWQVS 232
           EMGSTFQLCKICAENDKDIRIEPCGHLLCTPCLTSWQ S
Sbjct: 356 EMGSTFQLCKICAENDKDIRIEPCGHLLCTPCLTSWQDS 394

Source: Rhipicephalus pulchellus

Species: Rhipicephalus pulchellus

Genus: Rhipicephalus

Family: Ixodidae

Order: Ixodida

Class: Arachnida

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|427797985|gb|JAA64444.1| Putative tyrosine kinase negative regulator cbl, partial [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|241651245|ref|XP_002410277.1| E3 ubiquitin ligase, putative [Ixodes scapularis] gi|215501581|gb|EEC11075.1| E3 ubiquitin ligase, putative [Ixodes scapularis] Back     alignment and taxonomy information
>gi|242015997|ref|XP_002428625.1| E3 ubiquitin-protein ligase CBL, putative [Pediculus humanus corporis] gi|212513288|gb|EEB15887.1| E3 ubiquitin-protein ligase CBL, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|380028526|ref|XP_003697949.1| PREDICTED: E3 ubiquitin-protein ligase CBL-like [Apis florea] Back     alignment and taxonomy information
>gi|328791675|ref|XP_395448.3| PREDICTED: e3 ubiquitin-protein ligase CBL-B-like [Apis mellifera] Back     alignment and taxonomy information
>gi|340709000|ref|XP_003393104.1| PREDICTED: e3 ubiquitin-protein ligase CBL-B-like isoform 1 [Bombus terrestris] Back     alignment and taxonomy information
>gi|350419425|ref|XP_003492177.1| PREDICTED: E3 ubiquitin-protein ligase CBL-B-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|383864909|ref|XP_003707920.1| PREDICTED: E3 ubiquitin-protein ligase CBL-B-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|391338049|ref|XP_003743374.1| PREDICTED: E3 ubiquitin-protein ligase CBL-B-like [Metaseiulus occidentalis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query264
FB|FBgn0020224 878 Cbl "Cbl" [Drosophila melanoga 0.473 0.142 0.777 1.2e-52
UNIPROTKB|E1BJS3 900 CBL "Uncharacterized protein" 0.458 0.134 0.748 5.8e-50
UNIPROTKB|P22681 906 CBL "E3 ubiquitin-protein liga 0.458 0.133 0.748 6e-50
UNIPROTKB|F1P861 908 CBL "Uncharacterized protein" 0.458 0.133 0.748 6.1e-50
MGI|MGI:88279 913 Cbl "Casitas B-lineage lymphom 0.458 0.132 0.748 6.3e-50
UNIPROTKB|D4A407 913 Cbl "Protein Cbl" [Rattus norv 0.458 0.132 0.748 6.3e-50
UNIPROTKB|F1SAH0 914 CBL "Uncharacterized protein" 0.458 0.132 0.748 6.3e-50
UNIPROTKB|F1NXW5 855 CBL "Uncharacterized protein" 0.458 0.141 0.740 9.5e-50
UNIPROTKB|G3N0D7 800 CBLB "Uncharacterized protein" 0.462 0.152 0.727 7.8e-49
UNIPROTKB|B5MC15 810 CBLB "Cas-Br-M (Murine) ecotro 0.462 0.150 0.727 8.5e-49
FB|FBgn0020224 Cbl "Cbl" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 551 (199.0 bits), Expect = 1.2e-52, P = 1.2e-52
 Identities = 105/135 (77%), Positives = 112/135 (82%)

Query:   102 YVFRLSCTRLGQWAIGYVTADGDILQTIPQNKSLCQALLDGYREGLSGLIYSILRSYLYP 161
             YVFRLSCTRLGQWAIGYVTA+G+ILQTIPQNKSLCQALLDG+REG           YLYP
Sbjct:   279 YVFRLSCTRLGQWAIGYVTAEGEILQTIPQNKSLCQALLDGHREGF----------YLYP 328

Query:   162 DGRNVNPELSWEFISTPEDHIKVTQEQYELYCEMGSTFQLCKICAENDKDIRIEPCGHLL 221
             DG+  NP+LS    S  EDHI VTQEQYELYCEMGSTFQLCKICAENDKDIRIEPCGHLL
Sbjct:   329 DGQAYNPDLSSAVQSPTEDHITVTQEQYELYCEMGSTFQLCKICAENDKDIRIEPCGHLL 388

Query:   222 CTPCLTSWQVSNRSR 236
             CTPCLTSWQV +  +
Sbjct:   389 CTPCLTSWQVDSEGQ 403
GO:0005737 "cytoplasm" evidence=IDA
GO:0001784 "phosphotyrosine binding" evidence=IEA;ISM
GO:0009950 "dorsal/ventral axis specification" evidence=IMP
GO:0007175 "negative regulation of epidermal growth factor-activated receptor activity" evidence=IGI;IMP;TAS
GO:0008069 "dorsal/ventral axis specification, ovarian follicular epithelium" evidence=IMP
GO:0007173 "epidermal growth factor receptor signaling pathway" evidence=TAS
GO:0042059 "negative regulation of epidermal growth factor receptor signaling pathway" evidence=IMP;NAS
GO:0006508 "proteolysis" evidence=TAS
GO:0016874 "ligase activity" evidence=TAS
GO:0008270 "zinc ion binding" evidence=IEA
GO:0005509 "calcium ion binding" evidence=IEA
GO:0005634 "nucleus" evidence=IEA
GO:0004871 "signal transducer activity" evidence=IEA
GO:0030971 "receptor tyrosine kinase binding" evidence=IPI
GO:0007298 "border follicle cell migration" evidence=IMP
GO:0004842 "ubiquitin-protein ligase activity" evidence=IMP
GO:0006897 "endocytosis" evidence=IMP
GO:0007476 "imaginal disc-derived wing morphogenesis" evidence=IMP
GO:0005938 "cell cortex" evidence=IDA
GO:0048134 "germ-line cyst formation" evidence=IGI
GO:0042127 "regulation of cell proliferation" evidence=IGI
GO:0010941 "regulation of cell death" evidence=IDA
GO:0001754 "eye photoreceptor cell differentiation" evidence=IDA
GO:0007465 "R7 cell fate commitment" evidence=IDA
GO:0005515 "protein binding" evidence=IPI
GO:0080134 "regulation of response to stress" evidence=IMP
GO:0033500 "carbohydrate homeostasis" evidence=IMP
GO:0008340 "determination of adult lifespan" evidence=IMP
UNIPROTKB|E1BJS3 CBL "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P22681 CBL "E3 ubiquitin-protein ligase CBL" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1P861 CBL "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:88279 Cbl "Casitas B-lineage lymphoma" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|D4A407 Cbl "Protein Cbl" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1SAH0 CBL "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1NXW5 CBL "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|G3N0D7 CBLB "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|B5MC15 CBLB "Cas-Br-M (Murine) ecotropic retroviral transforming sequence b, isoform CRA_a" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P22681CBL_HUMAN6, ., 3, ., 2, ., -0.66660.52650.1534yesN/A
P22682CBL_MOUSE6, ., 3, ., 2, ., -0.66660.52650.1522yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query264
cd0992097 cd09920, SH2_Cbl-b_TKB, Src homology 2 (SH2) domai 4e-33
pfam0276286 pfam02762, Cbl_N3, CBL proto-oncogene N-terminus, 3e-32
pfam0009740 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING 4e-06
pfam1392049 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RI 8e-06
cd0016245 cd00162, RING, RING-finger (Really Interesting New 1e-05
smart0018440 smart00184, RING, Ring finger 3e-05
pfam1392345 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RI 2e-04
PLN03208 193 PLN03208, PLN03208, E3 ubiquitin-protein ligase RM 9e-04
cd0992097 cd09920, SH2_Cbl-b_TKB, Src homology 2 (SH2) domai 0.004
>gnl|CDD|198176 cd09920, SH2_Cbl-b_TKB, Src homology 2 (SH2) domain found in the Cbl-b TKB domain Back     alignment and domain information 
 Score =  115 bits (291), Expect = 4e-33
 Identities = 61/99 (61%), Positives = 66/99 (66%), Gaps = 20/99 (20%)

Query: 84  VTHLDANNFLT--SLQAQLY--------YVFRLSCTRLGQWAIGYVTADGDILQTIPQNK 133
           VTH     FLT   ++A+L         YVFRLSCTRLGQWAIGYVTADG ILQTIPQNK
Sbjct: 8   VTHPGYMAFLTYDEVKARLQKFRDKPGSYVFRLSCTRLGQWAIGYVTADGKILQTIPQNK 67

Query: 134 SLCQALLDGYREGLSGLIYSILRSYLYPDGRNVNPELSW 172
           SLCQAL+DG REG           YLYPDGR  NP+LS 
Sbjct: 68  SLCQALIDGSREGF----------YLYPDGRLDNPDLSG 96

SH2 found in the Cbl-b TKB domain. The Cbl (for Casitas B-lineage lymphoma) family of E3 ubiquitin ligases contains three members Cbl, Cbl-b and Cbl-c. The founding member Cbl was discovered first as the oncogenic protein v-Cbl, a Gag-fusion transforming protein of Cas NS-1 retrovirus, which causes pre- and pro-B lymphomas in mice. The N-terminus of the Cbl proteins is composed of a tyrosine kinase-binding (TKB) domain, also called phosphotyrosine binding (PTB) domain, a short linker region and the RING-type zinc finger. In addition, Cbl and Cbl-b contain a leucine zipper motif and a proline-rich domain in the C-terminus. The TKB domain consists of a four-helix bundle (4H), a calcium-binding EF hand and a divergent SH2 domain. Cbl-b plays a role in early hematopoietic development and is a negative regulator of T-cell receptor, B-cell receptor and high affinity immunoglobulin epsilon receptor signal transduction pathways. It also negatively regulates insulin-like growth factor 1 signaling during muscle atrophy caused by unloading and is involved in EGFR ubiquitination and internalization. Diseases associated with defects in Cbl-b include: multiple sclerosis, autoimmune diseases, including type 1 diabetes, and a craniofacial phenotype. In general SH2 domains are involved in signal transduction. They typically bind pTyr-containing ligands via two surface pockets, a pTyr and hydrophobic binding pocket, allowing proteins with SH2 domains to localize to tyrosine phosphorylated sites. Length = 97
>gnl|CDD|190413 pfam02762, Cbl_N3, CBL proto-oncogene N-terminus, SH2-like domain Back     alignment and domain information
>gnl|CDD|215715 pfam00097, zf-C3HC4, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|222454 pfam13920, zf-C3HC4_3, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|238093 cd00162, RING, RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>gnl|CDD|214546 smart00184, RING, Ring finger Back     alignment and domain information
>gnl|CDD|206094 pfam13923, zf-C3HC4_2, Zinc finger, C3HC4 type (RING finger) Back     alignment and domain information
>gnl|CDD|178747 PLN03208, PLN03208, E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>gnl|CDD|198176 cd09920, SH2_Cbl-b_TKB, Src homology 2 (SH2) domain found in the Cbl-b TKB domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 264
KOG1785|consensus 563 100.0
PF0276286 Cbl_N3: CBL proto-oncogene N-terminus, SH2-like do 100.0
KOG0317|consensus293 99.65
KOG0823|consensus 230 99.48
PLN03208193 E3 ubiquitin-protein ligase RMA2; Provisional 99.28
PF1392050 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); 99.06
PF1522742 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 99.04
KOG0320|consensus187 99.03
PF1392339 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); 99.03
smart0050463 Ubox Modified RING finger domain. Modified RING fi 99.01
PF1363944 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 98.94
KOG0978|consensus698 98.93
PHA02929238 N1R/p28-like protein; Provisional 98.85
PF0009741 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); I 98.84
cd0016245 RING RING-finger (Really Interesting New Gene) dom 98.82
smart0018439 RING Ring finger. E3 ubiquitin-protein ligase acti 98.79
COG5574271 PEX10 RING-finger-containing E3 ubiquitin ligase [ 98.78
KOG2164|consensus 513 98.72
PHA02926242 zinc finger-like protein; Provisional 98.71
PF0456473 U-box: U-box domain; InterPro: IPR003613 Quality c 98.71
TIGR00599 397 rad18 DNA repair protein rad18. This family is bas 98.62
PF1463444 zf-RING_5: zinc-RING finger domain 98.59
KOG4628|consensus348 98.53
COG5243 491 HRD1 HRD ubiquitin ligase complex, ER membrane com 98.5
PF1267873 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 98.5
PF1344543 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A. 98.46
KOG4172|consensus62 98.4
COG5540374 RING-finger-containing ubiquitin ligase [Posttrans 98.34
KOG0287|consensus 442 98.32
KOG2177|consensus 386 98.27
COG5432 391 RAD18 RING-finger-containing E3 ubiquitin ligase [ 98.25
TIGR00570 309 cdk7 CDK-activating kinase assembly factor MAT1. A 98.2
KOG0802|consensus 543 98.18
PF1286185 zf-Apc11: Anaphase-promoting complex subunit 11 RI 98.13
PF1483565 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM 98.06
KOG4265|consensus349 97.87
KOG0824|consensus 324 97.85
KOG0311|consensus 381 97.82
KOG1039|consensus 344 97.65
KOG1002|consensus 791 97.59
KOG2879|consensus298 97.53
KOG0297|consensus 391 97.48
COG5152259 Uncharacterized conserved protein, contains RING a 97.39
KOG3039|consensus303 97.39
KOG4159|consensus 398 97.38
KOG4275|consensus350 97.2
KOG0828|consensus636 97.12
smart0074449 RINGv The RING-variant domain is a C4HC3 zinc-fing 97.1
KOG4692|consensus489 97.1
KOG0827|consensus 465 97.08
KOG1571|consensus355 97.04
COG52191525 Uncharacterized conserved protein, contains RING Z 97.04
PF1178957 zf-Nse: Zinc-finger of the MIZ type in Nse subunit 97.02
PF04641260 Rtf2: Rtf2 RING-finger 96.92
KOG1813|consensus313 96.72
PF1444755 Prok-RING_4: Prokaryotic RING finger family 4 96.67
KOG0804|consensus 493 96.52
KOG1734|consensus328 96.48
KOG1493|consensus84 96.35
COG5236 493 Uncharacterized conserved protein, contains RING Z 96.18
KOG4185|consensus 296 96.18
COG5222427 Uncharacterized conserved protein, contains RING Z 96.13
KOG0825|consensus 1134 96.09
KOG1001|consensus 674 96.02
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 96.01
KOG0826|consensus357 95.98
PF1457048 zf-RING_4: RING/Ubox like zinc-binding domain; PDB 95.86
KOG4739|consensus 233 95.73
KOG2660|consensus 331 95.66
KOG1645|consensus 463 95.61
COG519488 APC11 Component of SCF ubiquitin ligase and anapha 95.48
KOG1100|consensus207 95.39
KOG1814|consensus 445 94.64
KOG3800|consensus 300 94.63
PHA03096284 p28-like protein; Provisional 93.72
KOG1941|consensus518 93.6
PHA02862156 5L protein; Provisional 93.42
PF04757229 Pex2_Pex12: Pex2 / Pex12 amino terminal region; In 93.1
PHA02825162 LAP/PHD finger-like protein; Provisional 93.03
COG5220 314 TFB3 Cdk activating kinase (CAK)/RNA polymerase II 92.93
KOG4367|consensus 699 92.76
PF07800162 DUF1644: Protein of unknown function (DUF1644); In 92.61
KOG3002|consensus 299 92.46
KOG3970|consensus 299 92.41
PF10272358 Tmpp129: Putative transmembrane protein precursor; 92.36
KOG2930|consensus114 90.98
KOG2817|consensus394 90.73
PF05290140 Baculo_IE-1: Baculovirus immediate-early protein ( 90.63
PF1290647 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A. 90.49
KOG4445|consensus 368 90.31
KOG3039|consensus 303 90.27
COG5175 480 MOT2 Transcriptional repressor [Transcription] 89.74
KOG4362|consensus 684 89.46
PF10367109 Vps39_2: Vacuolar sorting protein 39 domain 2; Int 88.44
KOG2932|consensus 389 88.21
KOG3899|consensus381 88.03
PF05883134 Baculo_RING: Baculovirus U-box/Ring-like domain; I 87.97
KOG0298|consensus 1394 87.15
COG0068 750 HypF Hydrogenase maturation factor [Posttranslatio 86.0
KOG1940|consensus276 85.97
KOG2114|consensus933 84.38
KOG1952|consensus 950 83.45
KOG3161|consensus 861 82.76
KOG3113|consensus 293 82.69
COG5183 1175 SSM4 Protein involved in mRNA turnover and stabili 82.68
PF0874643 zf-RING-like: RING-like domain; InterPro: IPR01485 82.34
PF0385450 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc 82.07
KOG1428|consensus 3738 81.22
KOG1812|consensus 384 80.51
KOG2034|consensus911 80.09
>KOG1785|consensus Back     alignment and domain information 
Probab=100.00  E-value=6.2e-62  Score=461.63  Aligned_cols=169  Identities=61%  Similarity=1.019  Sum_probs=161.9

Q ss_pred             ccccceeEEeeccchhHHHHHH--HHHHH--------HhhhhhhhhhhcccccccccCCcceeeccCCCchHHHHHhccc
Q psy9201          74 QHAIGKMVTLVTHLDANNFLTS--LQAQL--------YYVFRLSCTRLGQWAIGYVTADGDILQTIPQNKSLCQALLDGY  143 (264)
Q Consensus        74 ~~~~~~~~l~v~~~~~~a~~ty--v~~~l--------s~~f~~s~~rlgqw~ig~vs~d~~~~qtIp~nksl~qALLdg~  143 (264)
                      -..-||+.|||+||||||||||  ||+||        |||||+|||||||||||||++||+|+||||+||+++|||+||.
T Consensus       244 tllkNWq~LavtHPGYmAFLTYDEVk~RLqk~~~KpGSYIFRlSCTRlGQWAIGYVt~dG~IlQTIP~NKpL~QaL~eG~  323 (563)
T KOG1785|consen  244 TLLKNWQTLAVTHPGYMAFLTYDEVKARLQKYIKKPGSYIFRLSCTRLGQWAIGYVTADGNILQTIPQNKPLFQALLEGH  323 (563)
T ss_pred             HHHHhhhhhhccCCceeEEeeHHHHHHHHHHHhcCCCceEEeeccCcccceeEEEEcCCCceeeccCCCcHHHHHHHhcc
Confidence            4567999999999999999999  99999        9999999999999999999999999999999999999999999


Q ss_pred             cccchhhHHHHHHHhcCCCCCCCCCCccccccCCCcccccccHHHHHHHHhhCCcccccccccccccCceeeCCCCeecH
Q psy9201         144 REGLSGLIYSILRSYLYPDGRNVNPELSWEFISTPEDHIKVTQEQYELYCEMGSTFQLCKICAENDKDIRIEPCGHLLCT  223 (264)
Q Consensus       144 Reg~s~i~~~ll~~yl~Pdgr~~npdls~l~~~~~e~~i~vtqEq~e~~~e~~st~elC~ICle~~kdpvitpCGH~FC~  223 (264)
                      |||+          |+||||++.|||++.+.+.+++++++|++||+++||+|+++|++|+||.|+.||+.+.||||.+|.
T Consensus       324 keGF----------YlyPdGr~~npdLt~l~~~~p~d~i~VtqEQyeLYceMgsTFeLCKICaendKdvkIEPCGHLlCt  393 (563)
T KOG1785|consen  324 KEGF----------YLYPDGRDQNPDLTGLCQPPPQDRIKVTQEQYELYCEMGSTFELCKICAENDKDVKIEPCGHLLCT  393 (563)
T ss_pred             ccce----------EECCCCccCCCChhhccCCCcccceeeeHHHHHHHHHccchHHHHHHhhccCCCcccccccchHHH
Confidence            9999          999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhHHHHhccC-CCcccccccccccccceec
Q psy9201         224 PCLTSWQVSN-RSRILFYLFYFFSVKEIPL  252 (264)
Q Consensus       224 ~CI~~wl~s~-~~~CP~CR~~i~~~~vipl  252 (264)
                      .|+..|..++ ..+||+||.+|+..+.+-+
T Consensus       394 ~CLa~WQ~sd~gq~CPFCRcEIKGte~vii  423 (563)
T KOG1785|consen  394 SCLAAWQDSDEGQTCPFCRCEIKGTEPVII  423 (563)
T ss_pred             HHHHhhcccCCCCCCCceeeEeccccceee
Confidence            9999999765 7899999999988764433

>PF02762 Cbl_N3: CBL proto-oncogene N-terminus, SH2-like domain; InterPro: IPR014742 Cbl (Casitas B-lineage lymphoma) is an adaptor protein that functions as a negative regulator of many signalling pathways that start from receptors at the cell surface Back     alignment and domain information
>KOG0317|consensus Back     alignment and domain information
>KOG0823|consensus Back     alignment and domain information
>PLN03208 E3 ubiquitin-protein ligase RMA2; Provisional Back     alignment and domain information
>PF13920 zf-C3HC4_3: Zinc finger, C3HC4 type (RING finger); PDB: 2YHN_B 2YHO_G 3T6P_A 2CSY_A 2VJE_B 2VJF_B 2HDP_B 2EA5_A 2ECG_A 3EB5_A Back     alignment and domain information
>PF15227 zf-C3HC4_4: zinc finger of C3HC4-type, RING; PDB: 2EGP_A 2ECV_A 2ECJ_A 2YSL_A 2YSJ_A Back     alignment and domain information
>KOG0320|consensus Back     alignment and domain information
>PF13923 zf-C3HC4_2: Zinc finger, C3HC4 type (RING finger); PDB: 3HCU_A 2ECI_A 2JMD_A 3HCS_B 3HCT_A 3ZTG_A 2YUR_A 3L11_A Back     alignment and domain information
>smart00504 Ubox Modified RING finger domain Back     alignment and domain information
>PF13639 zf-RING_2: Ring finger domain; PDB: 2KIZ_A 4EPO_C 1IYM_A 2EP4_A 2ECT_A 2JRJ_A 2ECN_A 2ECM_A 3NG2_A 2EA6_A Back     alignment and domain information
>KOG0978|consensus Back     alignment and domain information
>PHA02929 N1R/p28-like protein; Provisional Back     alignment and domain information
>PF00097 zf-C3HC4: Zinc finger, C3HC4 type (RING finger); InterPro: IPR018957 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>cd00162 RING RING-finger (Really Interesting New Gene) domain, a specialized type of Zn-finger of 40 to 60 residues that binds two atoms of zinc; defined by the 'cross-brace' motif C-X2-C-X(9-39)-C-X(1-3)- H-X(2-3)-(N/C/H)-X2-C-X(4-48)C-X2-C; probably involved in mediating protein-protein interactions; identified in a proteins with a wide range of functions such as viral replication, signal transduction, and development; has two variants, the C3HC4-type and a C3H2C3-type (RING-H2 finger), which have different cysteine/histidine pattern; a subset of RINGs are associated with B-Boxes (C-X2-H-X7-C-X7-C-X2-C-H-X2-H) Back     alignment and domain information
>smart00184 RING Ring finger Back     alignment and domain information
>COG5574 PEX10 RING-finger-containing E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2164|consensus Back     alignment and domain information
>PHA02926 zinc finger-like protein; Provisional Back     alignment and domain information
>PF04564 U-box: U-box domain; InterPro: IPR003613 Quality control of intracellular proteins is essential for cellular homeostasis Back     alignment and domain information
>TIGR00599 rad18 DNA repair protein rad18 Back     alignment and domain information
>PF14634 zf-RING_5: zinc-RING finger domain Back     alignment and domain information
>KOG4628|consensus Back     alignment and domain information
>COG5243 HRD1 HRD ubiquitin ligase complex, ER membrane component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF12678 zf-rbx1: RING-H2 zinc finger; InterPro: IPR024766 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>PF13445 zf-RING_UBOX: RING-type zinc-finger; PDB: 2CT2_A Back     alignment and domain information
>KOG4172|consensus Back     alignment and domain information
>COG5540 RING-finger-containing ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0287|consensus Back     alignment and domain information
>KOG2177|consensus Back     alignment and domain information
>COG5432 RAD18 RING-finger-containing E3 ubiquitin ligase [Signal transduction mechanisms] Back     alignment and domain information
>TIGR00570 cdk7 CDK-activating kinase assembly factor MAT1 Back     alignment and domain information
>KOG0802|consensus Back     alignment and domain information
>PF12861 zf-Apc11: Anaphase-promoting complex subunit 11 RING-H2 finger Back     alignment and domain information
>PF14835 zf-RING_6: zf-RING of BARD1-type protein; PDB: 1JM7_B Back     alignment and domain information
>KOG4265|consensus Back     alignment and domain information
>KOG0824|consensus Back     alignment and domain information
>KOG0311|consensus Back     alignment and domain information
>KOG1039|consensus Back     alignment and domain information
>KOG1002|consensus Back     alignment and domain information
>KOG2879|consensus Back     alignment and domain information
>KOG0297|consensus Back     alignment and domain information
>COG5152 Uncharacterized conserved protein, contains RING and CCCH-type Zn-fingers [General function prediction only] Back     alignment and domain information
>KOG3039|consensus Back     alignment and domain information
>KOG4159|consensus Back     alignment and domain information
>KOG4275|consensus Back     alignment and domain information
>KOG0828|consensus Back     alignment and domain information
>smart00744 RINGv The RING-variant domain is a C4HC3 zinc-finger like motif found in a number of cellular and viral proteins Back     alignment and domain information
>KOG4692|consensus Back     alignment and domain information
>KOG0827|consensus Back     alignment and domain information
>KOG1571|consensus Back     alignment and domain information
>COG5219 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>PF11789 zf-Nse: Zinc-finger of the MIZ type in Nse subunit; PDB: 2YU4_A 3HTK_C Back     alignment and domain information
>PF04641 Rtf2: Rtf2 RING-finger Back     alignment and domain information
>KOG1813|consensus Back     alignment and domain information
>PF14447 Prok-RING_4: Prokaryotic RING finger family 4 Back     alignment and domain information
>KOG0804|consensus Back     alignment and domain information
>KOG1734|consensus Back     alignment and domain information
>KOG1493|consensus Back     alignment and domain information
>COG5236 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG4185|consensus Back     alignment and domain information
>COG5222 Uncharacterized conserved protein, contains RING Zn-finger [General function prediction only] Back     alignment and domain information
>KOG0825|consensus Back     alignment and domain information
>KOG1001|consensus Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>KOG0826|consensus Back     alignment and domain information
>PF14570 zf-RING_4: RING/Ubox like zinc-binding domain; PDB: 1E4U_A 1UR6_B Back     alignment and domain information
>KOG4739|consensus Back     alignment and domain information
>KOG2660|consensus Back     alignment and domain information
>KOG1645|consensus Back     alignment and domain information
>COG5194 APC11 Component of SCF ubiquitin ligase and anaphase-promoting complex [Posttranslational modification, protein turnover, chaperones / Cell division and chromosome partitioning] Back     alignment and domain information
>KOG1100|consensus Back     alignment and domain information
>KOG1814|consensus Back     alignment and domain information
>KOG3800|consensus Back     alignment and domain information
>PHA03096 p28-like protein; Provisional Back     alignment and domain information
>KOG1941|consensus Back     alignment and domain information
>PHA02862 5L protein; Provisional Back     alignment and domain information
>PF04757 Pex2_Pex12: Pex2 / Pex12 amino terminal region; InterPro: IPR006845 This region is the N-terminal part of a number of peroxisomal biogenesis proteins, including Pex2, Pex10 and Pex12, which contain two predicted transmembrane segments Back     alignment and domain information
>PHA02825 LAP/PHD finger-like protein; Provisional Back     alignment and domain information
>COG5220 TFB3 Cdk activating kinase (CAK)/RNA polymerase II transcription initiation/nucleotide excision repair factor TFIIH, subunit TFB3 [Cell division and chromosome partitioning / Transcription / DNA replication, recombination, and repair] Back     alignment and domain information
>KOG4367|consensus Back     alignment and domain information
>PF07800 DUF1644: Protein of unknown function (DUF1644); InterPro: IPR012866 This family consists of sequences found in a number of hypothetical plant proteins of unknown function Back     alignment and domain information
>KOG3002|consensus Back     alignment and domain information
>KOG3970|consensus Back     alignment and domain information
>PF10272 Tmpp129: Putative transmembrane protein precursor; InterPro: IPR018801 This entry consists of proteins conserved from worms to humans Back     alignment and domain information
>KOG2930|consensus Back     alignment and domain information
>KOG2817|consensus Back     alignment and domain information
>PF05290 Baculo_IE-1: Baculovirus immediate-early protein (IE-0); InterPro: IPR007954 This entry contains the Baculovirus immediate-early protein IE-0 Back     alignment and domain information
>PF12906 RINGv: RING-variant domain; PDB: 2D8S_A 1VYX_A Back     alignment and domain information
>KOG4445|consensus Back     alignment and domain information
>KOG3039|consensus Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG4362|consensus Back     alignment and domain information
>PF10367 Vps39_2: Vacuolar sorting protein 39 domain 2; InterPro: IPR019453 This entry represents a domain found in the vacuolar sorting protein Vps39 and transforming growth factor beta receptor-associated protein Trap1 Back     alignment and domain information
>KOG2932|consensus Back     alignment and domain information
>KOG3899|consensus Back     alignment and domain information
>PF05883 Baculo_RING: Baculovirus U-box/Ring-like domain; InterPro: IPR008573 This family consists of several Baculovirus proteins of around 130 residues in length Back     alignment and domain information
>KOG0298|consensus Back     alignment and domain information
>COG0068 HypF Hydrogenase maturation factor [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG1940|consensus Back     alignment and domain information
>KOG2114|consensus Back     alignment and domain information
>KOG1952|consensus Back     alignment and domain information
>KOG3161|consensus Back     alignment and domain information
>KOG3113|consensus Back     alignment and domain information
>COG5183 SSM4 Protein involved in mRNA turnover and stability [RNA processing and modification] Back     alignment and domain information
>PF08746 zf-RING-like: RING-like domain; InterPro: IPR014857 This is a zinc finger domain that is related to the C3HC4 RING finger domain (IPR001841 from INTERPRO) Back     alignment and domain information
>PF03854 zf-P11: P-11 zinc finger; InterPro: IPR003224 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG1428|consensus Back     alignment and domain information
>KOG1812|consensus Back     alignment and domain information
>KOG2034|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query264
1fbv_A388 Structure Of A Cbl-Ubch7 Complex: Ring Domain Funct 2e-54
2y1m_A389 Structure Of Native C-Cbl Length = 389 3e-54
4a4c_A391 Structure Of Phosphotyr371-C-Cbl-Ubch5b-Zap-70 Comp 2e-53
4a4b_A391 Structure Of Modified Phosphotyr371-C-Cbl-Ubch5b-Za 4e-53
3vgo_A394 Crystal Structure Of The N-Terminal Fragment Of Cbl 7e-53
4a49_A84 Structure Of Phosphotyr371-C-Cbl-Ubch5b Complex Len 9e-26
2ldr_A82 Solution Structure Of Helix-Ring Domain Of Cbl-B In 1e-24
2k4d_A83 E2-C-Cbl Recognition Is Necessary But Not Sufficien 4e-24
1yvh_A329 Crystal Structure Of The C-Cbl Tkb Domain In Comple 1e-22
1b47_A304 Structure Of The N-Terminal Domain Of Cbl In Comple 1e-22
2cbl_A305 N-Terminal Domain Of Cbl In Complex With Its Bindin 2e-22
3pfv_A315 Crystal Structure Of Cbl-B Tkb Domain In Complex Wi 2e-21
3op0_A323 Crystal Structure Of Cbl-C (Cbl-3) Tkb Domain In Co 9e-18
>pdb|1FBV|A Chain A, Structure Of A Cbl-Ubch7 Complex: Ring Domain Function In Ubiquitin-Protein Ligases Length = 388 Back     alignment and structure 
Iteration: 1

 Score =  208 bits (530), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 106/159 (66%), Positives = 120/159 (75%), Gaps = 20/159 (12%)
Query: 84  VTHLDANNFLT--SLQAQLY--------YVFRLSCTRLGQWAIGYVTADGDILQTIPQNK 133
           VTH     FLT   ++A+L         Y+FRLSCTRLGQWAIGYVTADG+ILQTIP NK
Sbjct: 217 VTHPGYMAFLTYDEVKARLQKFIHKPGSYIFRLSCTRLGQWAIGYVTADGNILQTIPHNK 276
Query: 134 SLCQALLDGYREGLSGLIYSILRSYLYPDGRNVNPELSWEFISTPEDHIKVTQEQYELYC 193
            L QAL+DG+REG           YL+PDGRN NP+L+     TP+DHIKVTQEQYELYC
Sbjct: 277 PLFQALIDGFREGF----------YLFPDGRNQNPDLTGLCEPTPQDHIKVTQEQYELYC 326
Query: 194 EMGSTFQLCKICAENDKDIRIEPCGHLLCTPCLTSWQVS 232
           EMGSTFQLCKICAENDKD++IEPCGHL+CT CLTSWQ S
Sbjct: 327 EMGSTFQLCKICAENDKDVKIEPCGHLMCTSCLTSWQES 365
>pdb|2Y1M|A Chain A, Structure Of Native C-Cbl Length = 389 Back     alignment and structure
>pdb|4A4C|A Chain A, Structure Of Phosphotyr371-C-Cbl-Ubch5b-Zap-70 Complex Length = 391 Back     alignment and structure
>pdb|4A4B|A Chain A, Structure Of Modified Phosphotyr371-C-Cbl-Ubch5b-Zap-70 Complex Length = 391 Back     alignment and structure
>pdb|3VGO|A Chain A, Crystal Structure Of The N-Terminal Fragment Of Cbl-B Length = 394 Back     alignment and structure
>pdb|4A49|A Chain A, Structure Of Phosphotyr371-C-Cbl-Ubch5b Complex Length = 84 Back     alignment and structure
>pdb|2LDR|A Chain A, Solution Structure Of Helix-Ring Domain Of Cbl-B In The Tyr363 Phosphorylated Form Length = 82 Back     alignment and structure
>pdb|2K4D|A Chain A, E2-C-Cbl Recognition Is Necessary But Not Sufficient For Ubiquitination Activity Length = 83 Back     alignment and structure
>pdb|1YVH|A Chain A, Crystal Structure Of The C-Cbl Tkb Domain In Complex With The Aps Ptyr-618 Phosphopeptide Length = 329 Back     alignment and structure
>pdb|1B47|A Chain A, Structure Of The N-Terminal Domain Of Cbl In Complex With Its Binding Site In Zap-70 Length = 304 Back     alignment and structure
>pdb|2CBL|A Chain A, N-Terminal Domain Of Cbl In Complex With Its Binding Site On Zap-70 Length = 305 Back     alignment and structure
>pdb|3PFV|A Chain A, Crystal Structure Of Cbl-B Tkb Domain In Complex With Egfr Py1069 Peptide Length = 315 Back     alignment and structure
>pdb|3OP0|A Chain A, Crystal Structure Of Cbl-C (Cbl-3) Tkb Domain In Complex With Egfr Py1069 Peptide Length = 323 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query264
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 3e-43
3op0_A323 Signal transduction protein CBL-C; structural geno 1e-22
3bux_B329 E3 ubiquitin-protein ligase CBL; TKB, signal trans 7e-21
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 4e-06
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 2e-05
2ea5_A68 Cell growth regulator with ring finger domain prot 2e-05
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 2e-04
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 3e-04
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Length = 389 Back     alignment and structure
 Score =  150 bits (379), Expect = 3e-43
 Identities = 98/136 (72%), Positives = 109/136 (80%), Gaps = 10/136 (7%)

Query: 101 YYVFRLSCTRLGQWAIGYVTADGDILQTIPQNKSLCQALLDGYREGLSGLIYSILRSYLY 160
            Y+FRLSCTRLGQWAIGYVTADG+ILQTIP NK L QAL+DG+REG           YL+
Sbjct: 244 SYIFRLSCTRLGQWAIGYVTADGNILQTIPHNKPLFQALIDGFREGF----------YLF 293

Query: 161 PDGRNVNPELSWEFISTPEDHIKVTQEQYELYCEMGSTFQLCKICAENDKDIRIEPCGHL 220
           PDGRN NP+L+     TP+DHIKVTQEQYELYCEMGSTFQLCKICAENDKD++IEPCGHL
Sbjct: 294 PDGRNQNPDLTGLCEPTPQDHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHL 353

Query: 221 LCTPCLTSWQVSNRSR 236
           +CT CLTSWQ S    
Sbjct: 354 MCTSCLTSWQESEGQG 369
>3op0_A Signal transduction protein CBL-C; structural genomics, structural genomics consortium, SGC, SI transduction protein, SH3-binding protein; HET: PTR; 2.52A {Homo sapiens} Length = 323 Back     alignment and structure
>3bux_B E3 ubiquitin-protein ligase CBL; TKB, signal transduction, proto-oncogene, complex, ATP-binding, glycoprotein, kinase, membrane, nucleotide-binding; HET: PTR; 1.35A {Homo sapiens} SCOP: a.39.1.7 a.48.1.1 d.93.1.1 PDB: 1yvh_A* 3bun_B* 3buo_B* 3bum_B* 3buw_B* 3ob1_B* 3ob2_B* 3plf_B* 2cbl_A* 1b47_A 3pfv_A* Length = 329 Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 75 Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Length = 79 Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 68 Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 70 Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Length = 100 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query264
2y1n_A389 E3 ubiquitin-protein ligase; ligase-transferase co 100.0
3bux_B329 E3 ubiquitin-protein ligase CBL; TKB, signal trans 100.0
3op0_A323 Signal transduction protein CBL-C; structural geno 99.98
1t1h_A78 Gspef-atpub14, armadillo repeat containing protein 99.35
2ecy_A66 TNF receptor-associated factor 3; metal binding pr 99.34
2xeu_A64 Ring finger protein 4; transcription, zinc-finger, 99.34
3ng2_A71 RNF4, snurf, ring finger protein 4; ring domain, E 99.34
2ysl_A73 Tripartite motif-containing protein 31; ring-type 99.3
3lrq_A100 E3 ubiquitin-protein ligase TRIM37; structural gen 99.3
1g25_A65 CDK-activating kinase assembly factor MAT1; ring f 99.29
2djb_A72 Polycomb group ring finger protein 6; PCGF6, ring 99.28
2egp_A79 Tripartite motif-containing protein 34; ZF-C3HC4 d 99.27
2d8t_A71 Dactylidin, ring finger protein 146; RNF146, ring 99.25
2ct2_A88 Tripartite motif protein 32; zinc-finger protein H 99.25
2ecw_A85 Tripartite motif-containing protein 30; metal bind 99.25
2yur_A74 Retinoblastoma-binding protein 6; P53-associated c 99.24
4ayc_A138 E3 ubiquitin-protein ligase RNF8; DNA damage, K63 99.23
2ecv_A85 Tripartite motif-containing protein 5; metal bindi 99.23
3fl2_A124 E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA 99.22
1jm7_A112 BRCA1, breast cancer type 1 susceptibility protein 99.21
2csy_A81 Zinc finger protein 183-like 1; ring finger protei 99.21
3ztg_A92 E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mR 99.2
2ea6_A69 Ring finger protein 4; RNF4, RES4-26, ring domain, 99.19
2ecn_A70 Ring finger protein 141; RNF141, ring domain, zinc 99.19
1chc_A68 Equine herpes virus-1 ring domain; viral protein; 99.19
1z6u_A150 NP95-like ring finger protein isoform B; structura 99.18
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.18
1rmd_A116 RAG1; V(D)J recombination, antibody, MAD, ring fin 99.18
2ecm_A55 Ring finger and CHY zinc finger domain- containing 99.18
2ect_A78 Ring finger protein 126; metal binding protein, st 99.17
2ysj_A63 Tripartite motif-containing protein 31; ring-type 99.17
3hct_A118 TNF receptor-associated factor 6; cross-brace, bet 99.15
2y43_A99 E3 ubiquitin-protein ligase RAD18; DNA repair, met 99.15
2ecj_A58 Tripartite motif-containing protein 39; TRIM39, ri 99.15
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 99.15
1iym_A55 EL5; ring-H2 finger, ubiquitin ligase, DNA binding 99.14
2kr4_A85 Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ri 99.13
2kre_A100 Ubiquitin conjugation factor E4 B; U-box domain, E 99.13
2ckl_B165 Ubiquitin ligase protein RING2; BMI1, RING1B, poly 99.13
2ckl_A108 Polycomb group ring finger protein 4; BMI1, RING1B 99.12
3l11_A115 E3 ubiquitin-protein ligase RNF168; E3 ligase, rin 99.12
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 99.1
1x4j_A75 Ring finger protein 38; structural genomics, NPPSF 99.09
1wgm_A98 Ubiquitin conjugation factor E4A; ubiquitinating e 99.09
2l0b_A91 E3 ubiquitin-protein ligase praja-1; zinc finger, 99.08
4ap4_A133 E3 ubiquitin ligase RNF4; ligase-signalling protei 99.08
1v87_A114 Deltex protein 2; ring-H2 domain, zinc-binding dom 99.08
2ep4_A74 Ring finger protein 24; zinc binding, ubiquitin, E 99.08
4ic3_A74 E3 ubiquitin-protein ligase XIAP; ring domain, zin 99.04
2vje_A64 E3 ubiquitin-protein ligase MDM2; proto-oncogene, 99.03
3knv_A141 TNF receptor-associated factor 2; cross-brace, alt 99.03
1jm7_B117 BARD1, BRCA1-associated ring domain protein 1; rin 99.02
2vje_B63 MDM4 protein; proto-oncogene, phosphorylation, alt 99.01
2ecl_A81 Ring-box protein 2; RNF7, ring domian, zinc-bindin 98.99
2f42_A179 STIP1 homology and U-box containing protein 1; cha 98.98
3hcs_A170 TNF receptor-associated factor 6; cross-brace, bet 98.98
2yu4_A94 E3 SUMO-protein ligase NSE2; SP-ring domain, struc 98.98
1e4u_A78 Transcriptional repressor NOT4; gene regulation, t 98.97
1bor_A56 Transcription factor PML; proto-oncogene, nuclear 98.95
2ecg_A75 Baculoviral IAP repeat-containing protein 4; BIRC4 98.92
2yho_A79 E3 ubiquitin-protein ligase mylip; ligase, E2 liga 98.88
2ea5_A68 Cell growth regulator with ring finger domain prot 98.87
3dpl_R106 Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST 98.8
2bay_A61 PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin l 98.75
1wim_A94 KIAA0161 protein; ring finger domain, UBCM4-intera 98.64
3t6p_A345 Baculoviral IAP repeat-containing protein 2; ring, 98.61
3htk_C267 E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL- 98.59
4a0k_B117 E3 ubiquitin-protein ligase RBX1; ligase-DNA-bindi 98.57
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 98.56
3vk6_A101 E3 ubiquitin-protein ligase hakai; HYB, phosphotyr 98.18
2ct0_A74 Non-SMC element 1 homolog; ring domain, structural 98.11
1vyx_A60 ORF K3, K3RING; zinc-binding protein, ring domain, 97.92
3k1l_B381 Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A 97.6
3nw0_A238 Non-structural maintenance of chromosomes element 96.28
3m62_A968 Ubiquitin conjugation factor E4; armadillo-like re 95.04
2jun_A101 Midline-1; B-BOX, TRIM, ring finger, alternative s 94.27
2ko5_A99 Ring finger protein Z; lassa fever virus-Z, negati 91.45
4g9i_A 772 Hydrogenase maturation protein HYPF; zinc finger, 87.35
2cs3_A93 Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, s 85.91
>2y1n_A E3 ubiquitin-protein ligase; ligase-transferase complex, ubiquitin ring E3 ligase; HET: PTR; 2.00A {Homo sapiens} PDB: 2y1m_A* 4a4c_A* 4a4b_A* 1fbv_A* 3vgo_A 4a49_A* 2k4d_A 2ldr_A* Back     alignment and structure
Probab=100.00  E-value=5.7e-37  Score=292.50  Aligned_cols=173  Identities=62%  Similarity=1.006  Sum_probs=153.8

Q ss_pred             CCcccccceeEEeeccchhHHHHHH--HHHHH--------HhhhhhhhhhhcccccccccCCcceeeccCCCchHHHHHh
Q psy9201          71 ESEQHAIGKMVTLVTHLDANNFLTS--LQAQL--------YYVFRLSCTRLGQWAIGYVTADGDILQTIPQNKSLCQALL  140 (264)
Q Consensus        71 ~~~~~~~~~~~l~v~~~~~~a~~ty--v~~~l--------s~~f~~s~~rlgqw~ig~vs~d~~~~qtIp~nksl~qALL  140 (264)
                      |=....-+|+.+|++|||||||++|  |.++|        +||||+||||+|||++||+..++.++|+||+++++.++++
T Consensus       204 p~~~l~~~~~~~~~~hpg~~af~ty~ev~~~Lk~~~~~~GsYIfRls~trlGq~~LG~v~~~q~ivqti~~~ksl~~~l~  283 (389)
T 2y1n_A          204 PWSSLLRNWNSLAVTHPGYMAFLTYDEVKARLQKFIHKPGSYIFRLSCTRLGQWAIGYVTADGNILQTIPHNKPLFQALI  283 (389)
T ss_dssp             CGGGHHHHHHHHTTSCTTBCTTCCHHHHHHHHGGGTTSTTEEEEEECSSSTTSEEEEEECTTSCEEEECCCSSCHHHHHH
T ss_pred             cHHHHHHHHHHHHhcCCchhhcccHHHHHHHHHHhhccCCceEeccCcchHhHHHHHHHHHHHHHHHHHHhHHHHHHHHh
Confidence            5667788999999999999999999  99999        7899999999999999999999999999999999999999


Q ss_pred             ccccccchhhHHHHHHHhcCCCCCCCCCCccccccCCCcccccccHHHHHHHHhhCCcccccccccccccCceeeCCCCe
Q psy9201         141 DGYREGLSGLIYSILRSYLYPDGRNVNPELSWEFISTPEDHIKVTQEQYELYCEMGSTFQLCKICAENDKDIRIEPCGHL  220 (264)
Q Consensus       141 dg~Reg~s~i~~~ll~~yl~Pdgr~~npdls~l~~~~~e~~i~vtqEq~e~~~e~~st~elC~ICle~~kdpvitpCGH~  220 (264)
                      ++.++|.          |++|++++.++++.......+++++++++|+.+.+.++.++...|+||++..++++.+||||.
T Consensus       284 d~~~~g~----------yl~p~g~~~~p~l~~l~~~~~~~~i~ls~e~~~~~~e~~~~~~~C~ICle~~~~pv~lpCGH~  353 (389)
T 2y1n_A          284 DGFREGF----------YLFPDGRNQNPDLTGLCEPTPQDHIKVTQEQYELYCEMGSTFQLCKICAENDKDVKIEPCGHL  353 (389)
T ss_dssp             HHHHTTS----------SCEETTCSCCCCCTTTTC-------CCCHHHHHHHHHTTTSSSBCTTTSSSBCCEEEETTCCE
T ss_pred             hhcccCc----------cccCCCCcCCccccccccccccccccccHHHHHHHHhhcCCCCCCCccCcCCCCeEEeCCCCh
Confidence            9999998          899999999999998877777789999999999999988887789999999999999999999


Q ss_pred             ecHhhHHHHhccCCCcccccccccccccceecc
Q psy9201         221 LCTPCLTSWQVSNRSRILFYLFYFFSVKEIPLW  253 (264)
Q Consensus       221 FC~~CI~~wl~s~~~~CP~CR~~i~~~~vipl~  253 (264)
                      ||..|+.+|+.+...+||+||..+.....+.+.
T Consensus       354 FC~~Ci~~wl~~~~~~CP~CR~~i~~~~~i~v~  386 (389)
T 2y1n_A          354 MCTSCLTSWQESEGQGCPFCRCEIKGTEPIVVD  386 (389)
T ss_dssp             ECHHHHHHHHHHTCSBCTTTCCBCCEEEECSCC
T ss_pred             hhHHHHHHHHhcCCCCCCCCCCccCCceeEecC
Confidence            999999999985667999999999887655443
>3bux_B E3 ubiquitin-protein ligase CBL; TKB, signal transduction, proto-oncogene, complex, ATP-binding, glycoprotein, kinase, membrane, nucleotide-binding; HET: PTR; 1.35A {Homo sapiens} SCOP: a.39.1.7 a.48.1.1 d.93.1.1 PDB: 1yvh_A* 3bun_B* 3buo_B* 3bum_B* 3buw_B* 3ob1_B* 3ob2_B* 3plf_B* 2cbl_A* 1b47_A 3pfv_A* Back     alignment and structure
>3op0_A Signal transduction protein CBL-C; structural genomics, structural genomics consortium, SGC, SI transduction protein, SH3-binding protein; HET: PTR; 2.52A {Homo sapiens} Back     alignment and structure
>1t1h_A Gspef-atpub14, armadillo repeat containing protein; ubiquitin ligase, E3 ligase, U-BOX,; NMR {Arabidopsis thaliana} SCOP: g.44.1.2 Back     alignment and structure
>2ecy_A TNF receptor-associated factor 3; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2xeu_A Ring finger protein 4; transcription, zinc-finger, metal-binding; HET: SUC; 1.50A {Homo sapiens} Back     alignment and structure
>3ng2_A RNF4, snurf, ring finger protein 4; ring domain, E3 ligase, ubiquitylation, sumoylation, zinc-FI metal binding protein; 1.80A {Rattus norvegicus} Back     alignment and structure
>2ysl_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3lrq_A E3 ubiquitin-protein ligase TRIM37; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: MSE; 2.29A {Homo sapiens} Back     alignment and structure
>1g25_A CDK-activating kinase assembly factor MAT1; ring finger (C3HC4), metal binding protein; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2djb_A Polycomb group ring finger protein 6; PCGF6, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2egp_A Tripartite motif-containing protein 34; ZF-C3HC4 domain, tripartite motif protein 34, interferon- responsive finger protein 1; NMR {Homo sapiens} Back     alignment and structure
>2d8t_A Dactylidin, ring finger protein 146; RNF146, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ct2_A Tripartite motif protein 32; zinc-finger protein HT2A, TAT- interacting protein, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecw_A Tripartite motif-containing protein 30; metal binding protein, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2yur_A Retinoblastoma-binding protein 6; P53-associated cellular protein of testis, proliferation potential-related protein, protein P2P-R; NMR {Homo sapiens} Back     alignment and structure
>4ayc_A E3 ubiquitin-protein ligase RNF8; DNA damage, K63 chains; HET: CPQ; 1.90A {Homo sapiens} PDB: 4epo_C Back     alignment and structure
>2ecv_A Tripartite motif-containing protein 5; metal binding protein, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3fl2_A E3 ubiquitin-protein ligase UHRF1; cell cycle, DNA damage, DNA repair, ring finger domain, metal binding, DNA replication; 1.75A {Homo sapiens} Back     alignment and structure
>1jm7_A BRCA1, breast cancer type 1 susceptibility protein; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2csy_A Zinc finger protein 183-like 1; ring finger protein 161, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ztg_A E3 ubiquitin-protein ligase RBBP6; PACT, U-BOX, mRNA processing, mRNA splicing; NMR {Homo sapiens} Back     alignment and structure
>2ea6_A Ring finger protein 4; RNF4, RES4-26, ring domain, zinc- binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ecn_A Ring finger protein 141; RNF141, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1chc_A Equine herpes virus-1 ring domain; viral protein; NMR {Equid herpesvirus 1} SCOP: g.44.1.1 Back     alignment and structure
>1z6u_A NP95-like ring finger protein isoform B; structural genomics consortium, ligase, ubiquitin-protein ligase, cell cycle regulation, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>1rmd_A RAG1; V(D)J recombination, antibody, MAD, ring finger, zinc binuclear cluster, zinc finger, DNA-binding protein; 2.10A {Mus musculus} SCOP: g.37.1.1 g.44.1.1 Back     alignment and structure
>2ecm_A Ring finger and CHY zinc finger domain- containing protein 1; RCHY1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2jrj_A Back     alignment and structure
>2ect_A Ring finger protein 126; metal binding protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2ysj_A Tripartite motif-containing protein 31; ring-type zinc finger domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3hct_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 3hcu_A 2eci_A 2jmd_A Back     alignment and structure
>2y43_A E3 ubiquitin-protein ligase RAD18; DNA repair, metal-binding, translesion synthesis, UB conjugation pathway; 1.80A {Homo sapiens} Back     alignment and structure
>2ecj_A Tripartite motif-containing protein 39; TRIM39, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1iym_A EL5; ring-H2 finger, ubiquitin ligase, DNA binding protein; NMR {Oryza sativa} SCOP: g.44.1.1 Back     alignment and structure
>2kr4_A Ubiquitin conjugation factor E4 B; U-BOX, UFD2, ring, E3 ligase, UBL conjugation pathway; NMR {Mus musculus} Back     alignment and structure
>2kre_A Ubiquitin conjugation factor E4 B; U-box domain, E3 ubiquitin ligase, E4 polyubiquitin chain EL factor, phosphoprotein, UBL conjugation pathway; NMR {Homo sapiens} PDB: 3l1x_A 3l1z_B Back     alignment and structure
>2ckl_B Ubiquitin ligase protein RING2; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_C 2h0d_B Back     alignment and structure
>2ckl_A Polycomb group ring finger protein 4; BMI1, RING1B, polycomb, E3-ligase, nuclear protein, chromosomal protein, transcription regulation; 2.0A {Mus musculus} PDB: 3rpg_B 2h0d_A Back     alignment and structure
>3l11_A E3 ubiquitin-protein ligase RNF168; E3 ligase, ring domain, DNA damage, chromatin regulator, CHR protein, DNA repair, metal-binding, nucleus; 2.12A {Homo sapiens} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1x4j_A Ring finger protein 38; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wgm_A Ubiquitin conjugation factor E4A; ubiquitinating enzyme, KIAA0126, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.2 Back     alignment and structure
>2l0b_A E3 ubiquitin-protein ligase praja-1; zinc finger, NESG, structural genomics, PSI-2, protein struc initiative; NMR {Homo sapiens} Back     alignment and structure
>4ap4_A E3 ubiquitin ligase RNF4; ligase-signalling protein complex, chimera; 2.21A {Rattus norvegicus} Back     alignment and structure
>1v87_A Deltex protein 2; ring-H2 domain, zinc-binding domain, notch signaling, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.44.1.1 Back     alignment and structure
>2ep4_A Ring finger protein 24; zinc binding, ubiquitin, E3 enzyme, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>4ic3_A E3 ubiquitin-protein ligase XIAP; ring domain, zinc-finger, E3 ligase; 1.78A {Homo sapiens} PDB: 4ic2_A Back     alignment and structure
>2vje_A E3 ubiquitin-protein ligase MDM2; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_A* 2hdp_A Back     alignment and structure
>3knv_A TNF receptor-associated factor 2; cross-brace, alternative splicing, apoptosis, cytoplasm, metal-binding, UBL conjugation, zinc, zinc-finger; 1.90A {Homo sapiens} Back     alignment and structure
>1jm7_B BARD1, BRCA1-associated ring domain protein 1; ring finger, zinc-binding protein, heterodimer, ubiquitin ligase, antitumor; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2vje_B MDM4 protein; proto-oncogene, phosphorylation, alternative splicing, HOST-virus interaction, UBL conjugation pathway, zinc-finger, polymorphism; HET: FLC; 2.20A {Homo sapiens} PDB: 2vjf_B* Back     alignment and structure
>2ecl_A Ring-box protein 2; RNF7, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2f42_A STIP1 homology and U-box containing protein 1; chaperone; 2.50A {Danio rerio} PDB: 2c2v_S 2oxq_C Back     alignment and structure
>3hcs_A TNF receptor-associated factor 6; cross-brace, beta-BETA-alpha, coiled coil, cytoplasm, metal- binding, UBL conjugation, UBL conjugation pathway; 2.20A {Homo sapiens} Back     alignment and structure
>2yu4_A E3 SUMO-protein ligase NSE2; SP-ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1e4u_A Transcriptional repressor NOT4; gene regulation, transcriptional control; NMR {Homo sapiens} SCOP: g.44.1.1 PDB: 1ur6_B Back     alignment and structure
>1bor_A Transcription factor PML; proto-oncogene, nuclear bodies (PODS), leukemia, transcription regulation; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>2ecg_A Baculoviral IAP repeat-containing protein 4; BIRC4, ring domian, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yho_A E3 ubiquitin-protein ligase mylip; ligase, E2 ligase-E3 ligase complex, ring zinc-finger, UBL conjugation pathway; 2.10A {Homo sapiens} PDB: 2yhn_A Back     alignment and structure
>2ea5_A Cell growth regulator with ring finger domain protein 1; CGRRF1, ring domain, zinc-binding domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3dpl_R Ring-box protein 1; ubiquitin, NEDD8, cullin, HOST-virus interaction, receptor, UBL conjugation, UBL conjugation pathway, acetylation, cytoplasm; 2.60A {Homo sapiens} SCOP: g.44.1.1 PDB: 3dqv_R 3rtr_B 4f52_B 1u6g_B 2hye_D* 4a0c_D 4a0l_F* 1ldj_B 1ldk_C 2lgv_A Back     alignment and structure
>2bay_A PRE-mRNA splicing factor PRP19; U-BOX, ubiquitin ligase, E3 ligase; 1.50A {Saccharomyces cerevisiae} SCOP: g.44.1.2 PDB: 1n87_A Back     alignment and structure
>1wim_A KIAA0161 protein; ring finger domain, UBCM4-interacting protein 4, UIP4, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: g.44.1.1 Back     alignment and structure
>3t6p_A Baculoviral IAP repeat-containing protein 2; ring, BIR, CARD, UBA, apoptosis, ubiquitin ligase, SMAC/ ubiquitin, caspase, IAP family, SMAC mimetic; 1.90A {Homo sapiens} PDB: 1qbh_A 2l9m_A 3eb5_A 3eb6_A 4auq_B Back     alignment and structure
>3htk_C E3 SUMO-protein ligase MMS21; SUMO E3 ligase, SPL-ring, ring, ATP-binding, chromosomal protein, coiled coil, DNA damage; 2.31A {Saccharomyces cerevisiae} Back     alignment and structure
>4a0k_B E3 ubiquitin-protein ligase RBX1; ligase-DNA-binding protein-DNA complex, DNA-binding protein- complex; HET: DNA 3DR; 5.93A {Mus musculus} Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3vk6_A E3 ubiquitin-protein ligase hakai; HYB, phosphotyrosine binding domain; 1.90A {Mus musculus} Back     alignment and structure
>2ct0_A Non-SMC element 1 homolog; ring domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1vyx_A ORF K3, K3RING; zinc-binding protein, ring domain, cross-brace motif; NMR {Human herpesvirus 8} SCOP: g.44.1.3 Back     alignment and structure
>3k1l_B Fancl; UBC, ring, RWD, ligase; HET: MAL CIT; 3.20A {Drosophila melanogaster} Back     alignment and structure
>3nw0_A Non-structural maintenance of chromosomes element homolog; E3 ligase, Zn, metal binding protein; 2.92A {Homo sapiens} Back     alignment and structure
>3m62_A Ubiquitin conjugation factor E4; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} PDB: 3m63_A* 2qiz_A 2qj0_A Back     alignment and structure
>2jun_A Midline-1; B-BOX, TRIM, ring finger, alternative splicing, coiled coil, cytoplasm, cytoskeleton, disease mutation, ligase, metal-binding; NMR {Homo sapiens} Back     alignment and structure
>4g9i_A Hydrogenase maturation protein HYPF; zinc finger, ATP binding, carbamoyla transferase; 4.50A {Thermococcus kodakarensis} Back     alignment and structure
>2cs3_A Protein C14ORF4, MY039 protein; ZF-C3HC4 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: g.44.1.3 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 264
d3buxb388 d.93.1.1 (B:264-351) Cbl {Human (Homo sapiens) [Ta 4e-33
d1fbva479 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [Ta 1e-22
d1bora_56 g.44.1.1 (A:) Acute promyelocytic leukaemia proto- 7e-06
d1chca_68 g.44.1.1 (A:) Immediate early protein, IEEHV {Equi 5e-05
d1jm7a_103 g.44.1.1 (A:) brca1 RING domain {Human (Homo sapie 7e-04
d1rmda286 g.44.1.1 (A:1-86) V(D)J recombination activating p 0.001
>d3buxb3 d.93.1.1 (B:264-351) Cbl {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: SH2-like
superfamily: SH2 domain
family: SH2 domain
domain: Cbl
species: Human (Homo sapiens) [TaxId: 9606]

 Score =  113 bits (285), Expect = 4e-33
 Identities = 48/70 (68%), Positives = 55/70 (78%), Gaps = 10/70 (14%)

Query: 102 YVFRLSCTRLGQWAIGYVTADGDILQTIPQNKSLCQALLDGYREGLSGLIYSILRSYLYP 161
           Y+FRLSCTRLGQWAIGYVTADG+ILQTIP NK L QAL+DG+REG           YL+P
Sbjct: 28  YIFRLSCTRLGQWAIGYVTADGNILQTIPHNKPLFQALIDGFREGF----------YLFP 77

Query: 162 DGRNVNPELS 171
           DGRN NP+L+
Sbjct: 78  DGRNQNPDLT 87
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Length = 56 Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Length = 68 Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query264
d3buxb388 Cbl {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1fbva479 CBL {Human (Homo sapiens) [TaxId: 9606]} 99.72
d1rmda286 V(D)J recombination activating protein 1 (RAG1), d 99.38
d2baya156 Pre-mRNA splicing factor Prp19 {Baker's yeast (Sac 99.33
d2c2la280 STIP1 homology and U box-containing protein 1, STU 99.31
d1jm7a_103 brca1 RING domain {Human (Homo sapiens) [TaxId: 96 99.31
d1t1ha_78 E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsi 99.3
d1chca_68 Immediate early protein, IEEHV {Equine herpesvirus 99.24
d1g25a_65 TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9 99.24
d1ur6b_52 Not-4 N-terminal RING finger domain {Human (Homo s 99.19
d1bora_56 Acute promyelocytic leukaemia proto-oncoprotein PM 99.16
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 99.05
d1jm7b_97 bard1 RING domain {Human (Homo sapiens) [TaxId: 96 99.04
d1v87a_114 Deltex protein 2 RING-H2 domain {Mouse (Mus muscul 98.93
d3dplr188 RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase 98.92
d1wgma_98 Ubiquitin conjugation factor E4A {Human (Homo sapi 98.9
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 98.72
d1wima_94 UbcM4-interacting protein 4 (KIAA0161) {Human (Hom 98.16
d2cs3a180 Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [ 88.52
d1weoa_93 Cellulose synthase A catalytic subunit 7, IRX3 {Th 80.08
>d3buxb3 d.93.1.1 (B:264-351) Cbl {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: SH2-like
superfamily: SH2 domain
family: SH2 domain
domain: Cbl
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=2.6e-43  Score=265.88  Aligned_cols=77  Identities=71%  Similarity=1.229  Sum_probs=75.8

Q ss_pred             ccchhHHHHHH--HHHHH--------HhhhhhhhhhhcccccccccCCcceeeccCCCchHHHHHhccccccchhhHHHH
Q psy9201          85 THLDANNFLTS--LQAQL--------YYVFRLSCTRLGQWAIGYVTADGDILQTIPQNKSLCQALLDGYREGLSGLIYSI  154 (264)
Q Consensus        85 ~~~~~~a~~ty--v~~~l--------s~~f~~s~~rlgqw~ig~vs~d~~~~qtIp~nksl~qALLdg~Reg~s~i~~~l  154 (264)
                      +||||||||||  ||++|        |||||+|||||||||||||++||+|+||||+|||++|||+||.|||+       
T Consensus         1 tHPgY~AFlTYDevk~rL~~~~~kPGSYiFRlSCTrlGQWAIGyvt~dg~IlQTIp~nk~L~qaLidG~reGf-------   73 (88)
T d3buxb3           1 THPGYMAFLTYDEVKARLQKFIHKPGSYIFRLSCTRLGQWAIGYVTADGNILQTIPHNKPLFQALIDGFREGF-------   73 (88)
T ss_dssp             SCTTBCTTCCHHHHHHHHGGGTTSTTEEEEEECSSSTTSEEEEEECTTSCEEEECCSSCCHHHHHHHHHHHTS-------
T ss_pred             CCCceeEEEeHHHHHHHHHHHhcCCCceEEeeccccccceeeeeeccCCceeeeccCccHHHHHHHhccccee-------
Confidence            69999999999  99999        99999999999999999999999999999999999999999999999       


Q ss_pred             HHHhcCCCCCCCCCCcc
Q psy9201         155 LRSYLYPDGRNVNPELS  171 (264)
Q Consensus       155 l~~yl~Pdgr~~npdls  171 (264)
                         |+||+|++.|||++
T Consensus        74 ---ylyPdG~~~npdlt   87 (88)
T d3buxb3          74 ---YLFPDGRNQNPDLT   87 (88)
T ss_dssp             ---SCEETTCSCCCCCC
T ss_pred             ---EECCCCCCCCCCCC
Confidence               99999999999986
>d1fbva4 g.44.1.1 (A:356-434) CBL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rmda2 g.44.1.1 (A:1-86) V(D)J recombination activating protein 1 (RAG1), dimerization domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2baya1 g.44.1.2 (A:1-56) Pre-mRNA splicing factor Prp19 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2c2la2 g.44.1.2 (A:225-304) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jm7a_ g.44.1.1 (A:) brca1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t1ha_ g.44.1.2 (A:) E3 ubiquitin ligase PUB14 {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1chca_ g.44.1.1 (A:) Immediate early protein, IEEHV {Equine herpesvirus 1 [TaxId: 10326]} Back     information, alignment and structure
>d1g25a_ g.44.1.1 (A:) TFIIH Mat1 subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ur6b_ g.44.1.1 (B:) Not-4 N-terminal RING finger domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1bora_ g.44.1.1 (A:) Acute promyelocytic leukaemia proto-oncoprotein PML {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure
>d1jm7b_ g.44.1.1 (B:) bard1 RING domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v87a_ g.44.1.1 (A:) Deltex protein 2 RING-H2 domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3dplr1 g.44.1.1 (R:19-106) RIGG-box protein 1 (RBX1) of SCF ubiquitin ligase complex {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgma_ g.44.1.2 (A:) Ubiquitin conjugation factor E4A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1wima_ g.44.1.1 (A:) UbcM4-interacting protein 4 (KIAA0161) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cs3a1 g.44.1.3 (A:8-87) Protein c14orf4 (KIAA1865) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weoa_ g.44.1.1 (A:) Cellulose synthase A catalytic subunit 7, IRX3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure