Psyllid ID: psy9251

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-
MARSQFQDRSSILPHHEVSHNLTIIYEDTQCIAWEEMYHKVAPFHYKLVPKYNVPNMNYLIAENKTLYGHLLLVAGKITKMMNLTDGYRIHVNNGPLAEQFYDWLYLDIFADKRLGWPPGK
cccccccccccccccccccccccEEEEcccEEEEEccccccccEEEEEcccccccccccccccHHHHHHHHHHHHHHHHHHcccccccEEEEEcccccccEEcEEEEEEEccccccccccc
cHHHHHHHHHHHHHccccccccEEEEEcccEEEEEccccccccEEEEEEcccccccHHHccHHHHHHHHHHHHHHHHHHHHccccccEEEEEEcccccccEEEEEEEEEEccccccccccc
marsqfqdrssilphhevshnlTIIYEDTQCIAWEEMYhkvapfhyklvpkynvpnmnYLIAENKTLYGHLLLVAGKITKMmnltdgyrihvnngplaeqFYDWLYLDIfadkrlgwppgk
marsqfqdrssilphhevshnlTIIYEDTQCIAWEEMYHKVAPFHYKLVPKYNVPNMNYLIAENKTLYGHLLLVAGKITKMMNLTDGYRIHVNNGPLAEQFYDWLYLDIFADKRLGWPPGK
MARSQFQDRSSILPHHEVSHNLTIIYEDTQCIAWEEMYHKVAPFHYKLVPKYNVPNMNYLIAENKTLYGHLLLVAGKITKMMNLTDGYRIHVNNGPLAEQFYDWLYLDIFADKRLGWPPGK
***************HEVSHNLTIIYEDTQCIAWEEMYHKVAPFHYKLVPKYNVPNMNYLIAENKTLYGHLLLVAGKITKMMNLTDGYRIHVNNGPLAEQFYDWLYLDIFADKRLGW****
****************EVSHNLTIIYEDTQCIAWEEMYHKVAPFHYKLVPKYNVPNMNYLIAENKTLYGHLLLVAGKITKMMNLTDGYRIHVNNGPLAEQFYDWLYLDIFADKRLGWPP**
*********SSILPHHEVSHNLTIIYEDTQCIAWEEMYHKVAPFHYKLVPKYNVPNMNYLIAENKTLYGHLLLVAGKITKMMNLTDGYRIHVNNGPLAEQFYDWLYLDIFADKRLGWPPGK
******QDRSSILPHHEVSHNLTIIYEDTQCIAWEEMYHKVAPFHYKLVPKYNVPNMNYLIAENKTLYGHLLLVAGKITKMMNLTDGYRIHVNNGPLAEQFYDWLYLDIFADKRLGWP*G*
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MARSQFQDRSSILPHHEVSHNLTIIYEDTQCIAWEEMYHKVAPFHYKLVPKYNVPNMNYLIAENKTLYGHLLLVAGKITKMMNLTDGYRIHVNNGPLAEQFYDWLYLDIFADKRLGWPPGK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query121 2.2.26 [Sep-21-2011]
Q8SQ21163 Histidine triad nucleotid yes N/A 0.793 0.588 0.391 2e-16
Q9D0S9163 Histidine triad nucleotid yes N/A 0.793 0.588 0.371 4e-16
Q9BX68163 Histidine triad nucleotid yes N/A 0.793 0.588 0.381 6e-16
P32084114 Uncharacterized HIT-like yes N/A 0.793 0.842 0.371 6e-14
P53795130 Histidine triad nucleotid yes N/A 0.793 0.738 0.319 2e-12
P73481114 Uncharacterized HIT-like N/A N/A 0.801 0.850 0.346 3e-12
P62958126 Histidine triad nucleotid no N/A 0.793 0.761 0.329 6e-12
Q5RF69126 Histidine triad nucleotid no N/A 0.793 0.761 0.319 6e-12
P80912126 Histidine triad nucleotid no N/A 0.793 0.761 0.319 7e-12
P62959126 Histidine triad nucleotid no N/A 0.793 0.761 0.309 1e-11
>sp|Q8SQ21|HINT2_BOVIN Histidine triad nucleotide-binding protein 2, mitochondrial OS=Bos taurus GN=HINT2 PE=2 SV=1 Back     alignment and function desciption
 Score = 84.3 bits (207), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 61/97 (62%), Gaps = 1/97 (1%)

Query: 24  IIYEDTQCIAWEEMYHKVAPFHYKLVPKYNVPNMNYLIAENKTLYGHLLLVAGKITKMMN 83
           I+YED QC+A+ ++  + AP H+ ++PK  +P ++    E++ L GHLLLVA +  K   
Sbjct: 68  ILYEDQQCLAFRDVAPQ-APVHFLVIPKKPIPRISQAEEEDQQLLGHLLLVAKETAKAEG 126

Query: 84  LTDGYRIHVNNGPLAEQFYDWLYLDIFADKRLGWPPG 120
           L DGYR+ +N+G L  Q    L++ +   ++L WPPG
Sbjct: 127 LGDGYRLVINDGKLGAQSVYHLHIHVLGGRQLQWPPG 163
Hydrolase probably involved in steroid biosynthesis. May play a role in apoptosis. Has adenosine phosphoramidase activity.
Bos taurus (taxid: 9913)
EC: 3EC: .EC: -EC: .EC: -EC: .EC: -
>sp|Q9D0S9|HINT2_MOUSE Histidine triad nucleotide-binding protein 2, mitochondrial OS=Mus musculus GN=Hint2 PE=2 SV=1 Back     alignment and function description
>sp|Q9BX68|HINT2_HUMAN Histidine triad nucleotide-binding protein 2, mitochondrial OS=Homo sapiens GN=HINT2 PE=1 SV=1 Back     alignment and function description
>sp|P32084|Y1390_SYNE7 Uncharacterized HIT-like protein Synpcc7942_1390 OS=Synechococcus elongatus (strain PCC 7942) GN=Synpcc7942_1390 PE=4 SV=1 Back     alignment and function description
>sp|P53795|HINT_CAEEL Histidine triad nucleotide-binding protein 1 OS=Caenorhabditis elegans GN=hint-1 PE=4 SV=1 Back     alignment and function description
>sp|P73481|YHIT_SYNY3 Uncharacterized HIT-like protein slr1234 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr1234 PE=4 SV=1 Back     alignment and function description
>sp|P62958|HINT1_BOVIN Histidine triad nucleotide-binding protein 1 OS=Bos taurus GN=HINT1 PE=1 SV=2 Back     alignment and function description
>sp|Q5RF69|HINT1_PONAB Histidine triad nucleotide-binding protein 1 OS=Pongo abelii GN=HINT1 PE=2 SV=3 Back     alignment and function description
>sp|P80912|HINT1_RABIT Histidine triad nucleotide-binding protein 1 OS=Oryctolagus cuniculus GN=HINT1 PE=1 SV=2 Back     alignment and function description
>sp|P62959|HINT1_RAT Histidine triad nucleotide-binding protein 1 OS=Rattus norvegicus GN=Hint1 PE=1 SV=5 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query121
108803584126 histidine triad (HIT) protein [Rubrobact 0.793 0.761 0.422 4e-16
147907158126 histidine triad nucleotide binding prote 0.793 0.761 0.422 1e-15
395855681163 PREDICTED: histidine triad nucleotide-bi 0.793 0.588 0.412 2e-15
351707031163 Histidine triad nucleotide-binding prote 0.793 0.588 0.402 2e-15
403306650 241 PREDICTED: histidine triad nucleotide-bi 0.793 0.398 0.402 2e-15
334333156160 PREDICTED: histidine triad nucleotide-bi 0.793 0.6 0.412 2e-15
354485765163 PREDICTED: histidine triad nucleotide-bi 0.793 0.588 0.402 3e-15
56752751127 SJCHGC07198 protein [Schistosoma japonic 0.793 0.755 0.391 4e-15
296190249163 PREDICTED: histidine triad nucleotide-bi 0.793 0.588 0.391 4e-15
226471068156 histidine triad nucleotide binding prote 0.793 0.615 0.391 5e-15
>gi|108803584|ref|YP_643521.1| histidine triad (HIT) protein [Rubrobacter xylanophilus DSM 9941] gi|108764827|gb|ABG03709.1| histidine triad (HIT) protein [Rubrobacter xylanophilus DSM 9941] Back     alignment and taxonomy information
 Score = 88.6 bits (218), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 41/97 (42%), Positives = 60/97 (61%), Gaps = 1/97 (1%)

Query: 24  IIYEDTQCIAWEEMYHKVAPFHYKLVPKYNVPNMNYLIAENKTLYGHLLLVAGKITKMMN 83
           IIYED +C+A  ++  + AP H  +VP+  +P+++ L  E+  L GHL +VA K+ +   
Sbjct: 31  IIYEDDRCVALRDINPQ-APTHVLIVPRKPIPSLDDLTEEDAPLVGHLFVVARKVAEQEG 89

Query: 84  LTDGYRIHVNNGPLAEQFYDWLYLDIFADKRLGWPPG 120
           L  GYR   NNGP A Q  D L+L +   +R+GWPPG
Sbjct: 90  LDRGYRTVFNNGPDANQTVDHLHLHLLGGRRMGWPPG 126

Source: Rubrobacter xylanophilus DSM 9941

Species: Rubrobacter xylanophilus

Genus: Rubrobacter

Family: Rubrobacteraceae

Order: Rubrobacterales

Class: Actinobacteria

Phylum: Actinobacteria

Superkingdom: Bacteria
>gi|147907158|ref|NP_001087193.1| histidine triad nucleotide binding protein 1 [Xenopus laevis] gi|51873772|gb|AAH78475.1| MGC85233 protein [Xenopus laevis] Back     alignment and taxonomy information
>gi|395855681|ref|XP_003800279.1| PREDICTED: histidine triad nucleotide-binding protein 2, mitochondrial [Otolemur garnettii] Back     alignment and taxonomy information
>gi|351707031|gb|EHB09950.1| Histidine triad nucleotide-binding protein 2 [Heterocephalus glaber] Back     alignment and taxonomy information
>gi|403306650|ref|XP_003943836.1| PREDICTED: histidine triad nucleotide-binding protein 2, mitochondrial [Saimiri boliviensis boliviensis] Back     alignment and taxonomy information
>gi|334333156|ref|XP_001378136.2| PREDICTED: histidine triad nucleotide-binding protein 2, mitochondrial-like [Monodelphis domestica] Back     alignment and taxonomy information
>gi|354485765|ref|XP_003505052.1| PREDICTED: histidine triad nucleotide-binding protein 2, mitochondrial-like [Cricetulus griseus] gi|344251771|gb|EGW07875.1| Histidine triad nucleotide-binding protein 2 [Cricetulus griseus] Back     alignment and taxonomy information
>gi|56752751|gb|AAW24587.1| SJCHGC07198 protein [Schistosoma japonicum] Back     alignment and taxonomy information
>gi|296190249|ref|XP_002743114.1| PREDICTED: histidine triad nucleotide-binding protein 2, mitochondrial [Callithrix jacchus] Back     alignment and taxonomy information
>gi|226471068|emb|CAX70615.1| histidine triad nucleotide binding protein 1 [Schistosoma japonicum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query121
UNIPROTKB|Q8SQ21163 HINT2 "Histidine triad nucleot 0.793 0.588 0.391 4.7e-16
UNIPROTKB|F1STB2163 HINT2 "Uncharacterized protein 0.793 0.588 0.391 4.7e-16
UNIPROTKB|E2RF32163 HINT2 "Uncharacterized protein 0.793 0.588 0.381 7.7e-16
MGI|MGI:1916167163 Hint2 "histidine triad nucleot 0.793 0.588 0.371 9.8e-16
UNIPROTKB|Q9BX68163 HINT2 "Histidine triad nucleot 0.793 0.588 0.381 1.3e-15
RGD|1308910163 Hint2 "histidine triad nucleot 0.793 0.588 0.371 1.6e-15
ZFIN|ZDB-GENE-040927-8126 hint1 "histidine triad nucleot 0.793 0.761 0.371 8.8e-15
UNIPROTKB|Q9I882126 chPKCI "Protein kinase C inhib 0.793 0.761 0.360 3e-14
UNIPROTKB|Q78DM8126 quPKCI "Protein kinase C inhib 0.793 0.761 0.360 3e-14
UNIPROTKB|Q9I839126 duPKCI "Protein kinase C inhib 0.793 0.761 0.360 3e-14
UNIPROTKB|Q8SQ21 HINT2 "Histidine triad nucleotide-binding protein 2, mitochondrial" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
 Score = 200 (75.5 bits), Expect = 4.7e-16, P = 4.7e-16
 Identities = 38/97 (39%), Positives = 61/97 (62%)

Query:    24 IIYEDTQCIAWEEMYHKVAPFHYKLVPKYNVPNMNYLIAENKTLYGHLLLVAGKITKMMN 83
             I+YED QC+A+ ++  + AP H+ ++PK  +P ++    E++ L GHLLLVA +  K   
Sbjct:    68 ILYEDQQCLAFRDVAPQ-APVHFLVIPKKPIPRISQAEEEDQQLLGHLLLVAKETAKAEG 126

Query:    84 LTDGYRIHVNNGPLAEQFYDWLYLDIFADKRLGWPPG 120
             L DGYR+ +N+G L  Q    L++ +   ++L WPPG
Sbjct:   127 LGDGYRLVINDGKLGAQSVYHLHIHVLGGRQLQWPPG 163
GO:0005739 "mitochondrion" evidence=ISS
GO:0016787 "hydrolase activity" evidence=IEA
GO:0006915 "apoptotic process" evidence=IEA
GO:0006694 "steroid biosynthetic process" evidence=IEA
UNIPROTKB|F1STB2 HINT2 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|E2RF32 HINT2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1916167 Hint2 "histidine triad nucleotide binding protein 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q9BX68 HINT2 "Histidine triad nucleotide-binding protein 2, mitochondrial" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1308910 Hint2 "histidine triad nucleotide binding protein 2" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040927-8 hint1 "histidine triad nucleotide binding protein 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q9I882 chPKCI "Protein kinase C inhibitor" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q78DM8 quPKCI "Protein kinase C inhibitor" [Coturnix japonica (taxid:93934)] Back     alignment and assigned GO terms
UNIPROTKB|Q9I839 duPKCI "Protein kinase C inhibitor" [Anas platyrhynchos (taxid:8839)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P32084Y1390_SYNE7No assigned EC number0.37110.79330.8421yesN/A
Q8K9I9YHIT_BUCAPNo assigned EC number0.30100.75200.7913yesN/A
O66536YHIT_AQUAENo assigned EC number0.33330.78510.7851yesN/A
P53795HINT_CAEELNo assigned EC number0.31950.79330.7384yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query121
cd01276104 cd01276, PKCI_related, Protein Kinase C Interactin 3e-13
pfam11969113 pfam11969, DcpS_C, Scavenger mRNA decapping enzyme 3e-07
PRK10687119 PRK10687, PRK10687, purine nucleoside phosphoramid 3e-05
pfam0123097 pfam01230, HIT, HIT domain 2e-04
>gnl|CDD|238607 cd01276, PKCI_related, Protein Kinase C Interacting protein related (PKCI): PKCI and related proteins belong to the ubiquitous HIT family of hydrolases that act on alpha-phosphates of ribonucleotides Back     alignment and domain information 
 Score = 60.7 bits (148), Expect = 3e-13
 Identities = 25/79 (31%), Positives = 46/79 (58%), Gaps = 2/79 (2%)

Query: 23  TIIYEDTQCIAWEEMYHKVAPFHYKLVPKYNVPNMNYLIAENKTLYGHLLLVAGKITKMM 82
             +YED + +A+ ++  + AP H  ++PK ++ +++    E++ L GHLL  A K+ K +
Sbjct: 15  KKVYEDDEVLAFHDINPQ-APVHILVIPKKHIASLSDATEEDEELLGHLLSAAAKVAKDL 73

Query: 83  NL-TDGYRIHVNNGPLAEQ 100
            +  DGYR+ +N G    Q
Sbjct: 74  GIAEDGYRLVINCGKDGGQ 92

The members of this subgroup have a conserved HxHxHxx motif (x is a hydrophobic residue) that is a signature for this family. No enzymatic activity has been reported however, for PKCI and its related members. Length = 104
>gnl|CDD|221348 pfam11969, DcpS_C, Scavenger mRNA decapping enzyme C-term binding Back     alignment and domain information
>gnl|CDD|182648 PRK10687, PRK10687, purine nucleoside phosphoramidase; Provisional Back     alignment and domain information
>gnl|CDD|216377 pfam01230, HIT, HIT domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 121
KOG3275|consensus127 100.0
PRK10687119 purine nucleoside phosphoramidase; Provisional 100.0
cd01276104 PKCI_related Protein Kinase C Interacting protein 100.0
COG0537138 Hit Diadenosine tetraphosphate (Ap4A) hydrolase an 99.98
cd01277103 HINT_subgroup HINT (histidine triad nucleotide-bin 99.97
PF0123098 HIT: HIT domain; InterPro: IPR001310 The Histidine 99.96
cd01275126 FHIT FHIT (fragile histidine family): FHIT protein 99.96
cd01278104 aprataxin_related aprataxin related: Aprataxin, a 99.95
cd0046886 HIT_like HIT family: HIT (Histidine triad) protein 99.94
PF11969116 DcpS_C: Scavenger mRNA decapping enzyme C-term bin 99.91
PRK11720346 galactose-1-phosphate uridylyltransferase; Provisi 99.91
TIGR00209347 galT_1 galactose-1-phosphate uridylyltransferase, 99.9
cd00608329 GalT Galactose-1-phosphate uridyl transferase (Gal 99.9
PLN02643336 ADP-glucose phosphorylase 99.87
KOG3379|consensus150 99.87
KOG4359|consensus166 99.72
PF02744166 GalP_UDP_tr_C: Galactose-1-phosphate uridyl transf 99.53
COG1085338 GalT Galactose-1-phosphate uridylyltransferase [En 99.35
KOG0562|consensus184 99.16
PF04677121 CwfJ_C_1: Protein similar to CwfJ C-terminus 1; In 99.07
KOG2958|consensus354 99.07
KOG2476|consensus 528 98.29
KOG3969|consensus310 98.25
PLN03103 403 GDP-L-galactose-hexose-1-phosphate guanyltransfera 97.79
PRK05471252 CDP-diacylglycerol pyrophosphatase; Provisional 97.44
KOG2477|consensus 628 97.43
COG5075305 Uncharacterized conserved protein [Function unknow 97.4
TIGR00672250 cdh CDP-diacylglycerol pyrophosphatase, bacterial 97.3
PF02611222 CDH: CDP-diacylglycerol pyrophosphatase; InterPro: 97.14
KOG2720|consensus 431 97.01
COG2134252 Cdh CDP-diacylglycerol pyrophosphatase [Lipid meta 96.73
COG4360 298 APA2 ATP adenylyltransferase (5',5'''-P-1,P-4-tetr 96.64
cd00608 329 GalT Galactose-1-phosphate uridyl transferase (Gal 96.55
PLN02643 336 ADP-glucose phosphorylase 96.11
TIGR00209 347 galT_1 galactose-1-phosphate uridylyltransferase, 95.53
PRK11720 346 galactose-1-phosphate uridylyltransferase; Provisi 95.45
COG1085 338 GalT Galactose-1-phosphate uridylyltransferase [En 93.0
PF01087183 GalP_UDP_transf: Galactose-1-phosphate uridyl tran 87.01
PF1431762 YcxB: YcxB-like protein 83.64
>KOG3275|consensus Back     alignment and domain information 
Probab=100.00  E-value=4.9e-40  Score=218.95  Aligned_cols=113  Identities=30%  Similarity=0.559  Sum_probs=109.0

Q ss_pred             CCCCceeccccCccCccEEEEcCcEEEEEeCCCCCCCeEEEEEecCCCCCcCCCChhHHHHHHHHHHHHHHHHHHcCCCC
Q psy9251           7 QDRSSILPHHEVSHNLTIIYEDTQCIAWEEMYHKVAPFHYKLVPKYNVPNMNYLIAENKTLYGHLLLVAGKITKMMNLTD   86 (121)
Q Consensus         7 ~~~~~~~~~~~~~~~~~iv~e~d~~va~~d~~~P~~~gH~LViPk~Hv~~~~~L~~~~~~~l~~l~~~~~~~~~~~~~~~   86 (121)
                      ...|.||+|+++++|+.+|||||.++||.|++ |.+|+|+|||||+|++.++.+.+.+.++|+.++.+++++++++|+.+
T Consensus        15 ~~~tIF~kIi~keIPa~ii~Edd~~lAF~Di~-Pqap~HfLvIPK~hi~~~s~aed~~~e~Lg~ll~~~k~vak~~Gl~~   93 (127)
T KOG3275|consen   15 AAPTIFCKIIRKEIPAKIIFEDDRCLAFHDIA-PQAPGHFLVIPKKHITQLSKAEDRDDELLGHLLPVAKKVAKALGLED   93 (127)
T ss_pred             CCCcEeeeeecccCCcceEeeccceEEEEecC-CCCCceEEEeecccccchhhcccCCHHHHHHHHHHHHHHHHHhCccc
Confidence            57899999999999999999999999999999 99999999999999888888888888899999999999999999999


Q ss_pred             ceEEEEecCCcCCCccceeeEEEecCCCCCCCCC
Q psy9251          87 GYRIHVNNGPLAEQFYDWLYLDIFADKRLGWPPG  120 (121)
Q Consensus        87 g~~~~~n~g~~agq~v~HlHlHIip~~~~~~~~~  120 (121)
                      |||+++|||..++|||+|+|+||+||.+++||||
T Consensus        94 gYrvv~NnG~~g~QsV~HvH~HvlgGrqm~WPpg  127 (127)
T KOG3275|consen   94 GYRVVQNNGKDGHQSVYHVHLHVLGGRQMQWPPG  127 (127)
T ss_pred             ceeEEEcCCcccceEEEEEEEEEeCCcccCCCCC
Confidence            9999999999999999999999999999999997

>PRK10687 purine nucleoside phosphoramidase; Provisional Back     alignment and domain information
>cd01276 PKCI_related Protein Kinase C Interacting protein related (PKCI): PKCI and related proteins belong to the ubiquitous HIT family of hydrolases that act on alpha-phosphates of ribonucleotides Back     alignment and domain information
>COG0537 Hit Diadenosine tetraphosphate (Ap4A) hydrolase and other HIT family hydrolases [Nucleotide transport and metabolism / Carbohydrate transport and metabolism / General function prediction only] Back     alignment and domain information
>cd01277 HINT_subgroup HINT (histidine triad nucleotide-binding protein) subgroup: Members of this CD belong to the superfamily of histidine triad hydrolases that act on alpha-phosphate of ribonucleotides Back     alignment and domain information
>PF01230 HIT: HIT domain; InterPro: IPR001310 The Histidine Triad (HIT) motif, His-x-His-x-His-x-x (x, a hydrophobic amino acid) was identified as being highly conserved in a variety of organisms [] Back     alignment and domain information
>cd01275 FHIT FHIT (fragile histidine family): FHIT proteins, related to the HIT family carry a motif HxHxH/Qxx (x, is a hydrophobic amino acid), On the basis of sequence, substrate specificity, structure, evolution and mechanism, HIT proteins are classified into three branches: the Hint branch, which consists of adenosine 5' -monophosphoramide hydrolases, the Fhit branch, that consists of diadenosine polyphosphate hydrolases, and the GalT branch consisting of specific nucloside monophosphate transferases Back     alignment and domain information
>cd01278 aprataxin_related aprataxin related: Aprataxin, a HINT family hydrolase is mutated in ataxia oculomotor apraxia syndrome Back     alignment and domain information
>cd00468 HIT_like HIT family: HIT (Histidine triad) proteins, named for a motif related to the sequence HxHxH/Qxx (x, a hydrophobic amino acid), are a superfamily of nucleotide hydrolases and transferases, which act on the alpha-phosphate of ribonucleotides Back     alignment and domain information
>PF11969 DcpS_C: Scavenger mRNA decapping enzyme C-term binding; PDB: 1VLR_B 1XMM_D 1XML_B 1ST0_A 3BLA_B 3BL9_B 3BL7_B 1ST4_B 1XQU_B Back     alignment and domain information
>PRK11720 galactose-1-phosphate uridylyltransferase; Provisional Back     alignment and domain information
>TIGR00209 galT_1 galactose-1-phosphate uridylyltransferase, family 1 Back     alignment and domain information
>cd00608 GalT Galactose-1-phosphate uridyl transferase (GalT): This enzyme plays a key role in galactose metabolism by catalysing the transfer of a uridine 5'-phosphoryl group from UDP-galactose 1-phosphate Back     alignment and domain information
>PLN02643 ADP-glucose phosphorylase Back     alignment and domain information
>KOG3379|consensus Back     alignment and domain information
>KOG4359|consensus Back     alignment and domain information
>PF02744 GalP_UDP_tr_C: Galactose-1-phosphate uridyl transferase, C-terminal domain; InterPro: IPR005850 Galactose-1-phosphate uridyl transferase catalyses the conversion of UDP-glucose and alpha-D-galactose 1-phosphate to alpha-D-glucose 1-phosphate and UDP-galactose during galactose metabolism Back     alignment and domain information
>COG1085 GalT Galactose-1-phosphate uridylyltransferase [Energy production and conversion] Back     alignment and domain information
>KOG0562|consensus Back     alignment and domain information
>PF04677 CwfJ_C_1: Protein similar to CwfJ C-terminus 1; InterPro: IPR006768 This group of sequences contain a conserved C-terminal domain which is found in the Schizosaccharomyces pombe (Fission yeast) protein Cwf19 (Q09909 from SWISSPROT) and its homologues Back     alignment and domain information
>KOG2958|consensus Back     alignment and domain information
>KOG2476|consensus Back     alignment and domain information
>KOG3969|consensus Back     alignment and domain information
>PLN03103 GDP-L-galactose-hexose-1-phosphate guanyltransferase; Provisional Back     alignment and domain information
>PRK05471 CDP-diacylglycerol pyrophosphatase; Provisional Back     alignment and domain information
>KOG2477|consensus Back     alignment and domain information
>COG5075 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>TIGR00672 cdh CDP-diacylglycerol pyrophosphatase, bacterial type Back     alignment and domain information
>PF02611 CDH: CDP-diacylglycerol pyrophosphatase; InterPro: IPR003763 The CDP-diacylglycerol pyrophosphatases 3 Back     alignment and domain information
>KOG2720|consensus Back     alignment and domain information
>COG2134 Cdh CDP-diacylglycerol pyrophosphatase [Lipid metabolism] Back     alignment and domain information
>COG4360 APA2 ATP adenylyltransferase (5',5'''-P-1,P-4-tetraphosphate phosphorylase II) [Nucleotide transport and metabolism] Back     alignment and domain information
>cd00608 GalT Galactose-1-phosphate uridyl transferase (GalT): This enzyme plays a key role in galactose metabolism by catalysing the transfer of a uridine 5'-phosphoryl group from UDP-galactose 1-phosphate Back     alignment and domain information
>PLN02643 ADP-glucose phosphorylase Back     alignment and domain information
>TIGR00209 galT_1 galactose-1-phosphate uridylyltransferase, family 1 Back     alignment and domain information
>PRK11720 galactose-1-phosphate uridylyltransferase; Provisional Back     alignment and domain information
>COG1085 GalT Galactose-1-phosphate uridylyltransferase [Energy production and conversion] Back     alignment and domain information
>PF01087 GalP_UDP_transf: Galactose-1-phosphate uridyl transferase, N-terminal domain; InterPro: IPR005849 Galactose-1-phosphate uridyl transferase catalyses the conversion of UDP-glucose and alpha-D-galactose 1-phosphate to alpha-D-glucose 1-phosphate and UDP-galactose during galactose metabolism Back     alignment and domain information
>PF14317 YcxB: YcxB-like protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query121
1rzy_A126 Crystal Structure Of Rabbit Hint Complexed With N- 5e-13
3o1x_A126 High Resolution Crystal Structure Of Histidine Tria 6e-13
3rhn_A115 Histidine Triad Nucleotide-Binding Protein (Hint) F 7e-13
1kpa_A126 Pkci-1-Zinc Length = 126 1e-12
1kpb_A125 Pkci-1-Apo Length = 125 1e-12
3tw2_A126 High Resolution Structure Of Human Histidine Triad 1e-12
4eqe_A128 Crystal Structure Of Histidine Triad Nucleotide-Bin 1e-12
3o1c_A126 High Resolution Crystal Structure Of Histidine Tria 8e-12
3o1z_A126 High Resolution Crystal Structure Of Histidine Tria 9e-12
3oj7_A117 Crystal Structure Of A Histidine Triad Family Prote 4e-08
>pdb|1RZY|A Chain A, Crystal Structure Of Rabbit Hint Complexed With N- Ethylsulfamoyladenosine Length = 126 Back     alignment and structure 
Iteration: 1

 Score = 69.3 bits (168), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 31/97 (31%), Positives = 57/97 (58%), Gaps = 1/97 (1%)
Query: 24  IIYEDTQCIAWEEMYHKVAPFHYKLVPKYNVPNMNYLIAENKTLYGHLLLVAGKITKMMN 83
           II+ED QC+A+ ++  + AP H+ ++PK ++  ++     +++L GHL++V  K    + 
Sbjct: 31  IIFEDDQCLAFHDISPQ-APTHFLVIPKKHISQISAAEDADESLLGHLMIVGKKCAADLG 89
Query: 84  LTDGYRIHVNNGPLAEQFYDWLYLDIFADKRLGWPPG 120
           L  GYR+ VN G    Q    ++L +   +++ WPPG
Sbjct: 90  LKKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMNWPPG 126
>pdb|3O1X|A Chain A, High Resolution Crystal Structure Of Histidine Triad Nucleotide- Binding Protein 1 (Hint1) C84a Mutant From Rabbit Complexed With Adenosine Length = 126 Back     alignment and structure
>pdb|3RHN|A Chain A, Histidine Triad Nucleotide-Binding Protein (Hint) From Rabbit Complexed With Gmp Length = 115 Back     alignment and structure
>pdb|1KPA|A Chain A, Pkci-1-Zinc Length = 126 Back     alignment and structure
>pdb|1KPB|A Chain A, Pkci-1-Apo Length = 125 Back     alignment and structure
>pdb|3TW2|A Chain A, High Resolution Structure Of Human Histidine Triad Nucleotide-binding Protein 1 (hhint1)/amp Complex In A Monoclinic Space Group Length = 126 Back     alignment and structure
>pdb|4EQE|A Chain A, Crystal Structure Of Histidine Triad Nucleotide-Binding Protein 1 (Hint1) From Human Complexed With Lys-Ams Length = 128 Back     alignment and structure
>pdb|3O1C|A Chain A, High Resolution Crystal Structure Of Histidine Triad Nucleotide- Binding Protein 1 (Hint1) C38a Mutant From Rabbit Complexed With Adenosine Length = 126 Back     alignment and structure
>pdb|3O1Z|A Chain A, High Resolution Crystal Structure Of Histidine Triad Nucleotide- Binding Protein 1 (Hint1) Double Cysteine Mutant From Rabbit Length = 126 Back     alignment and structure
>pdb|3OJ7|A Chain A, Crystal Structure Of A Histidine Triad Family Protein From Entamoeba Histolytica, Bound To Sulfate Length = 117 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query121
3o1c_A126 Histidine triad nucleotide-binding protein 1; hydr 2e-23
4egu_A119 Histidine triad (HIT) protein; structural genomics 5e-19
3oj7_A117 Putative histidine triad family protein; hydrolase 6e-19
3n1s_A119 HIT-like protein HINT; histidine triad nucleotide 2e-16
1xqu_A147 HIT family hydrolase; protein STRU initiative, PSI 7e-16
3o0m_A149 HIT family protein; ssgcid, NIH, niaid, SBRI, UW, 1e-14
3ksv_A149 Uncharacterized protein; HIT family, structural ge 5e-13
1y23_A145 HIT, histidine triad protein; HIT protein, PKCI-1, 2e-10
2eo4_A149 150AA long hypothetical histidine triad nucleotid 3e-10
3p0t_A138 Uncharacterized protein; ssgcid, HIT-like protein, 7e-10
3lb5_A161 HIT-like protein involved in cell-cycle regulatio; 2e-09
3r6f_A135 HIT family protein; structural genomics, seattle s 4e-09
3l7x_A173 SMU.412C, putative HIT-like protein involved in ce 6e-09
3imi_A147 HIT family protein; structural genomics, infectiou 7e-09
3sp4_A204 Aprataxin-like protein; HIT domain, zinc finger, D 1e-06
>3o1c_A Histidine triad nucleotide-binding protein 1; hydrolase, HINT protein, HIT protein, adenosine 5'- monophosphoramidase; HET: ADN; 1.08A {Oryctolagus cuniculus} PDB: 3llj_A* 1rzy_A* 3qgz_A* 3o1z_A 3o1x_A* 4eqe_A* 4eqg_A* 4eqh_A* 3tw2_A* 1kpb_A 1kpf_A* 1kpa_A 1kpc_A 1av5_A* 1kpe_A* 4rhn_A* 3rhn_A* 5rhn_A* 6rhn_A Length = 126 Back     alignment and structure
 Score = 86.8 bits (216), Expect = 2e-23
 Identities = 30/98 (30%), Positives = 55/98 (56%), Gaps = 1/98 (1%)

Query: 23  TIIYEDTQCIAWEEMYHKVAPFHYKLVPKYNVPNMNYLIAENKTLYGHLLLVAGKITKMM 82
            II+ED Q +A+ ++    AP H+ ++PK ++  ++     +++L GHL++V  K    +
Sbjct: 30  KIIFEDDQALAFHDI-SPQAPTHFLVIPKKHISQISAAEDADESLLGHLMIVGKKCAADL 88

Query: 83  NLTDGYRIHVNNGPLAEQFYDWLYLDIFADKRLGWPPG 120
            L  GYR+ VN G    Q    ++L +   +++ WPPG
Sbjct: 89  GLKKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMNWPPG 126
>4egu_A Histidine triad (HIT) protein; structural genomics, center for structural genomics of infec diseases, csgid, HIT domain, unknown function; HET: 5GP; 0.95A {Clostridium difficile} Length = 119 Back     alignment and structure
>3oj7_A Putative histidine triad family protein; hydrolase, structural genomics, seattle structural genomics for infectious disease, ssgcid; 1.40A {Entamoeba histolytica} PDB: 3omf_A* 3oxk_A* Length = 117 Back     alignment and structure
>3n1s_A HIT-like protein HINT; histidine triad nucleotide binding protein, GMP, hydro; HET: 5GP; 1.45A {Escherichia coli} PDB: 3n1t_A* Length = 119 Back     alignment and structure
>1xqu_A HIT family hydrolase; protein STRU initiative, PSI, southeast collaboratory for structural GEN secsg; 2.30A {Clostridium thermocellum} SCOP: d.13.1.1 Length = 147 Back     alignment and structure
>3o0m_A HIT family protein; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, hydrola structural genomics; HET: AMP; 1.90A {Mycobacterium smegmatis str} Length = 149 Back     alignment and structure
>3ksv_A Uncharacterized protein; HIT family, structural genomics, structural genomics of PATH protozoa consortium, SGPP, unknown function; 1.90A {Leishmania major} Length = 149 Back     alignment and structure
>1y23_A HIT, histidine triad protein; HIT protein, PKCI-1, cell-cycle regulation, NYSGXRC, structural genomics, protein structure initiative; 2.30A {Bacillus subtilis} SCOP: d.13.1.1 Length = 145 Back     alignment and structure
>2eo4_A 150AA long hypothetical histidine triad nucleotid protein; HIT family, structural genomics, NPPSFA; 1.80A {Sulfolobus tokodaii} Length = 149 Back     alignment and structure
>3p0t_A Uncharacterized protein; ssgcid, HIT-like protein, mycobacerium paratuberculosis, STR genomics; 1.90A {Mycobacterium avium subsp} Length = 138 Back     alignment and structure
>3lb5_A HIT-like protein involved in cell-cycle regulatio; niaid, seattle structural genomics center for infectious DIS ssgcid, histidine triad; 1.90A {Bartonella henselae} Length = 161 Back     alignment and structure
>3r6f_A HIT family protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, protozoan parasite; 1.85A {Encephalitozoon cuniculi} Length = 135 Back     alignment and structure
>3l7x_A SMU.412C, putative HIT-like protein involved in cell-cycle regulation; 1.70A {Streptococcus mutans} Length = 173 Back     alignment and structure
>3imi_A HIT family protein; structural genomics, infectious diseases for structural genomics of infectious diseases, unknown FUN csgid; 2.01A {Bacillus anthracis str} Length = 147 Back     alignment and structure
>3sp4_A Aprataxin-like protein; HIT domain, zinc finger, DNA-binding protein, DNA deadenylas hydrolase; 1.80A {Schizosaccharomyces pombe} PDB: 3spd_A* 3spl_A* 3szq_A* Length = 204 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query121
3o1c_A126 Histidine triad nucleotide-binding protein 1; hydr 100.0
3n1s_A119 HIT-like protein HINT; histidine triad nucleotide 100.0
3oj7_A117 Putative histidine triad family protein; hydrolase 100.0
4egu_A119 Histidine triad (HIT) protein; structural genomics 100.0
1xqu_A147 HIT family hydrolase; protein STRU initiative, PSI 100.0
3ksv_A149 Uncharacterized protein; HIT family, structural ge 100.0
3lb5_A161 HIT-like protein involved in cell-cycle regulatio; 99.98
3imi_A147 HIT family protein; structural genomics, infectiou 99.97
3o0m_A149 HIT family protein; ssgcid, NIH, niaid, SBRI, UW, 99.97
3l7x_A173 SMU.412C, putative HIT-like protein involved in ce 99.97
2eo4_A149 150AA long hypothetical histidine triad nucleotid 99.97
1y23_A145 HIT, histidine triad protein; HIT protein, PKCI-1, 99.97
3r6f_A135 HIT family protein; structural genomics, seattle s 99.97
3ano_A218 AP-4-A phosphorylase; diadenosine polyphosphate, H 99.96
3p0t_A138 Uncharacterized protein; ssgcid, HIT-like protein, 99.96
1fit_A147 FragIle histidine protein; FHIT, fragIle histidine 99.95
1ems_A440 Nitfhit, NIT-fragIle histidine triad fusion protei 99.94
2oik_A154 Histidine triad (HIT) protein; HIT-like fold, stru 99.93
1z84_A351 Galactose-1-phosphate uridyl transferase-like prot 99.92
1gup_A348 Galactose-1-phosphate uridylyltransferase; nucleot 99.91
3ohe_A137 Histidine triad (HIT) protein; structural genomics 99.87
3i24_A149 HIT family hydrolase; structural genomics, PSI-2, 99.86
3sp4_A204 Aprataxin-like protein; HIT domain, zinc finger, D 99.83
3nrd_A135 Histidine triad (HIT) protein; structural genomics 99.81
3i4s_A149 Histidine triad protein; hydrolase, phosphatase, H 99.77
3bl9_A301 Scavenger mRNA-decapping enzyme DCPS; ligand compl 99.39
1vlr_A350 MRNA decapping enzyme; 16740816, structural genomi 99.36
1z84_A 351 Galactose-1-phosphate uridyl transferase-like prot 98.7
2pof_A227 CDP-diacylglycerol pyrophosphatase; NYSGXRC, PFAM0 97.39
1gup_A 348 Galactose-1-phosphate uridylyltransferase; nucleot 96.29
>3o1c_A Histidine triad nucleotide-binding protein 1; hydrolase, HINT protein, HIT protein, adenosine 5'- monophosphoramidase; HET: ADN; 1.08A {Oryctolagus cuniculus} SCOP: d.13.1.1 PDB: 3llj_A* 1rzy_A* 3qgz_A* 3o1z_A 3o1x_A* 4eqe_A* 4eqg_A* 4eqh_A* 3tw2_A* 1kpb_A 1kpf_A* 1kpa_A 1kpc_A 1av5_A* 1kpe_A* 4rhn_A* 3rhn_A* 5rhn_A* 6rhn_A Back     alignment and structure
Probab=100.00  E-value=7.4e-41  Score=227.77  Aligned_cols=114  Identities=26%  Similarity=0.494  Sum_probs=109.7

Q ss_pred             CCCCCceeccccCccCccEEEEcCcEEEEEeCCCCCCCeEEEEEecCCCCCcCCCChhHHHHHHHHHHHHHHHHHHcCCC
Q psy9251           6 FQDRSSILPHHEVSHNLTIIYEDTQCIAWEEMYHKVAPFHYKLVPKYNVPNMNYLIAENKTLYGHLLLVAGKITKMMNLT   85 (121)
Q Consensus         6 ~~~~~~~~~~~~~~~~~~iv~e~d~~va~~d~~~P~~~gH~LViPk~Hv~~~~~L~~~~~~~l~~l~~~~~~~~~~~~~~   85 (121)
                      -.++|.||++++|++++++|||||.++||.|++ |.+|||+|||||+|++++.+|+++|..++++++.++++++++++.+
T Consensus        13 ~~~~CiFC~i~~~e~~~~iv~e~e~~~af~d~~-P~~pgH~LViPk~H~~~l~dL~~~e~~~l~~l~~~~~~~~~~~~~~   91 (126)
T 3o1c_A           13 PGGDTIFGKIIRKEIPAKIIFEDDQALAFHDIS-PQAPTHFLVIPKKHISQISAAEDADESLLGHLMIVGKKCAADLGLK   91 (126)
T ss_dssp             TTCSSHHHHHHHTSSCCCEEEECSSEEEEECSS-CSSSEEEEEEESSCCCCGGGCCGGGHHHHHHHHHHHHHHHHHTTCT
T ss_pred             CCCCCCcchhhcCCCcCCEEEECCCEEEEECCC-CCCCceEEEEechHhchHhhCchhHHHHHHHHHHHHHHHHHHhCCC
Confidence            367899999999999999999999999999999 9999999999999999999999999999999999999999988877


Q ss_pred             CceEEEEecCCcCCCccceeeEEEecCCCCCCCCC
Q psy9251          86 DGYRIHVNNGPLAEQFYDWLYLDIFADKRLGWPPG  120 (121)
Q Consensus        86 ~g~~~~~n~g~~agq~v~HlHlHIip~~~~~~~~~  120 (121)
                      +|||+++|+|+.+||+|+|+|+|||||++++||||
T Consensus        92 ~g~ni~~n~g~~agq~v~HlH~Hiipr~~~~~~~~  126 (126)
T 3o1c_A           92 KGYRMVVNEGSDGGQSVYHVHLHVLGGRQMNWPPG  126 (126)
T ss_dssp             TCEEEECCCHHHHTCCSSSCCEEEEESSCCCSSCC
T ss_pred             CCeEEEEecCCccCCccCEeEEEEeCCcccCCCCC
Confidence            89999999999999999999999999999999997
>3n1s_A HIT-like protein HINT; histidine triad nucleotide binding protein, GMP, hydro; HET: 5GP; 1.45A {Escherichia coli} SCOP: d.13.1.0 PDB: 3n1t_A* Back     alignment and structure
>3oj7_A Putative histidine triad family protein; hydrolase, structural genomics, seattle structural genomics for infectious disease, ssgcid; 1.40A {Entamoeba histolytica} SCOP: d.13.1.0 PDB: 3omf_A* 3oxk_A* Back     alignment and structure
>4egu_A Histidine triad (HIT) protein; structural genomics, center for structural genomics of infec diseases, csgid, HIT domain, unknown function; HET: 5GP; 0.95A {Clostridium difficile} Back     alignment and structure
>1xqu_A HIT family hydrolase; protein STRU initiative, PSI, southeast collaboratory for structural GEN secsg; 2.30A {Clostridium thermocellum} SCOP: d.13.1.1 Back     alignment and structure
>3ksv_A Uncharacterized protein; HIT family, structural genomics, structural genomics of PATH protozoa consortium, SGPP, unknown function; 1.90A {Leishmania major} SCOP: d.13.1.0 Back     alignment and structure
>3lb5_A HIT-like protein involved in cell-cycle regulatio; niaid, seattle structural genomics center for infectious DIS ssgcid, histidine triad; 1.90A {Bartonella henselae} Back     alignment and structure
>3imi_A HIT family protein; structural genomics, infectious diseases for structural genomics of infectious diseases, unknown FUN csgid; 2.01A {Bacillus anthracis str} SCOP: d.13.1.1 Back     alignment and structure
>3o0m_A HIT family protein; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, hydrola structural genomics; HET: AMP; 1.90A {Mycobacterium smegmatis str} Back     alignment and structure
>3l7x_A SMU.412C, putative HIT-like protein involved in cell-cycle regulation; 1.70A {Streptococcus mutans} Back     alignment and structure
>2eo4_A 150AA long hypothetical histidine triad nucleotid protein; HIT family, structural genomics, NPPSFA; 1.80A {Sulfolobus tokodaii} Back     alignment and structure
>1y23_A HIT, histidine triad protein; HIT protein, PKCI-1, cell-cycle regulation, NYSGXRC, structural genomics, protein structure initiative; 2.30A {Bacillus subtilis} SCOP: d.13.1.1 Back     alignment and structure
>3r6f_A HIT family protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, protozoan parasite; 1.85A {Encephalitozoon cuniculi} Back     alignment and structure
>3ano_A AP-4-A phosphorylase; diadenosine polyphosphate, HIT transferase; HET: PG4; 1.89A {Mycobacterium tuberculosis} Back     alignment and structure
>3p0t_A Uncharacterized protein; ssgcid, HIT-like protein, mycobacerium paratuberculosis, STR genomics; 1.90A {Mycobacterium avium subsp} Back     alignment and structure
>1fit_A FragIle histidine protein; FHIT, fragIle histidine triad protein, putative human tumor suppressor, advanced photon source, APS; HET: FRU; 1.85A {Homo sapiens} SCOP: d.13.1.1 PDB: 1fhi_A* 2fit_A* 3fit_A* 4fit_A 5fit_A* 6fit_A* 2fhi_A* Back     alignment and structure
>1ems_A Nitfhit, NIT-fragIle histidine triad fusion protein; WORM, nitrilase, nucleotide-binding protein, cancer; 2.80A {Caenorhabditis elegans} SCOP: d.13.1.1 d.160.1.1 Back     alignment and structure
>2oik_A Histidine triad (HIT) protein; HIT-like fold, structural genomics, joint center for structu genomics, JCSG; HET: MSE; 1.65A {Methylobacillus flagellatus} SCOP: d.13.1.1 Back     alignment and structure
>1z84_A Galactose-1-phosphate uridyl transferase-like protein; GALT, zinc, AMP, structural genomics, protein structure initiative, CESG; HET: AMP; 1.83A {Arabidopsis thaliana} SCOP: d.13.1.2 d.13.1.2 PDB: 1zwj_A 2q4h_A* 2q4l_A 2h39_A* Back     alignment and structure
>1gup_A Galactose-1-phosphate uridylyltransferase; nucleotidyltransferase, galactose metabolism; HET: GDU; 1.80A {Escherichia coli} SCOP: d.13.1.2 d.13.1.2 PDB: 1guq_A* 1hxq_A* 1hxp_A* Back     alignment and structure
>3ohe_A Histidine triad (HIT) protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; HET: MSE; 1.20A {Marinobacter aquaeolei} Back     alignment and structure
>3i24_A HIT family hydrolase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 1.50A {Vibrio fischeri ES114} Back     alignment and structure
>3sp4_A Aprataxin-like protein; HIT domain, zinc finger, DNA-binding protein, DNA deadenylas hydrolase; 1.80A {Schizosaccharomyces pombe} PDB: 3spd_A* 3spl_A* 3szq_A* Back     alignment and structure
>3nrd_A Histidine triad (HIT) protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.06A {Sinorhizobium meliloti} Back     alignment and structure
>3i4s_A Histidine triad protein; hydrolase, phosphatase, HIT superfamily, PSI-2, NYSGXRC, STR genomics, protein structure initiative; 1.75A {Bradyrhizobium japonicum} Back     alignment and structure
>3bl9_A Scavenger mRNA-decapping enzyme DCPS; ligand complex, cytoplasm, hydrolase, nonsense-mediated mRNA decay, nucleus, polymorphism, structural genomics; HET: DD2; 1.80A {Homo sapiens} SCOP: d.13.1.3 d.246.1.1 PDB: 3bl7_A* 3bla_A* Back     alignment and structure
>1vlr_A MRNA decapping enzyme; 16740816, structural genomics, JCSG, protein structure initiative, PSI, joint center for structural genomics; 1.83A {Mus musculus} SCOP: d.13.1.3 d.246.1.1 PDB: 1xmm_B* 1xml_B 1st0_B* 1st4_B* Back     alignment and structure
>1z84_A Galactose-1-phosphate uridyl transferase-like protein; GALT, zinc, AMP, structural genomics, protein structure initiative, CESG; HET: AMP; 1.83A {Arabidopsis thaliana} SCOP: d.13.1.2 d.13.1.2 PDB: 1zwj_A 2q4h_A* 2q4l_A 2h39_A* Back     alignment and structure
>2pof_A CDP-diacylglycerol pyrophosphatase; NYSGXRC, PFAM02611, PSI-2, phospholipid biosynthesis structural genomics, protein structure initiative; 1.40A {Escherichia coli} SCOP: d.13.1.4 Back     alignment and structure
>1gup_A Galactose-1-phosphate uridylyltransferase; nucleotidyltransferase, galactose metabolism; HET: GDU; 1.80A {Escherichia coli} SCOP: d.13.1.2 d.13.1.2 PDB: 1guq_A* 1hxq_A* 1hxp_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 121
d1kpfa_111 d.13.1.1 (A:) Protein kinase C inhibitor-1, PKCI-1 4e-16
d1xqua_113 d.13.1.1 (A:) Putative hydrolase {Clostridium ther 6e-06
d1emsa1160 d.13.1.1 (A:281-440) NIT-FHIT fusion protein, C-te 0.001
d1guqa2171 d.13.1.2 (A:178-348) Galactose-1-phosphate uridyly 0.001
>d1kpfa_ d.13.1.1 (A:) Protein kinase C inhibitor-1, PKCI-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 111 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: HIT-like
superfamily: HIT-like
family: HIT (HINT, histidine triad) family of protein kinase-interacting proteins
domain: Protein kinase C inhibitor-1, PKCI-1
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 66.7 bits (162), Expect = 4e-16
 Identities = 30/98 (30%), Positives = 57/98 (58%), Gaps = 1/98 (1%)

Query: 23  TIIYEDTQCIAWEEMYHKVAPFHYKLVPKYNVPNMNYLIAENKTLYGHLLLVAGKITKMM 82
            II+ED +C+A+ ++    AP H+ ++PK ++  ++    ++++L GHL++V  K    +
Sbjct: 15  KIIFEDDRCLAFHDIS-PQAPTHFLVIPKKHISQISVAEDDDESLLGHLMIVGKKCAADL 73

Query: 83  NLTDGYRIHVNNGPLAEQFYDWLYLDIFADKRLGWPPG 120
            L  GYR+ VN G    Q    ++L +   +++ WPPG
Sbjct: 74  GLNKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMHWPPG 111
>d1xqua_ d.13.1.1 (A:) Putative hydrolase {Clostridium thermocellum [TaxId: 1515]} Length = 113 Back     information, alignment and structure
>d1emsa1 d.13.1.1 (A:281-440) NIT-FHIT fusion protein, C-terminal domain {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 160 Back     information, alignment and structure
>d1guqa2 d.13.1.2 (A:178-348) Galactose-1-phosphate uridylyltransferase {Escherichia coli [TaxId: 562]} Length = 171 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query121
d1kpfa_111 Protein kinase C inhibitor-1, PKCI-1 {Human (Homo 100.0
d1xqua_113 Putative hydrolase {Clostridium thermocellum [TaxI 100.0
d1y23a_139 Hit {Bacillus subtilis [TaxId: 1423]} 100.0
d1emsa1160 NIT-FHIT fusion protein, C-terminal domain {Nemato 99.97
d1fita_146 FHIT (fragile histidine triad protein) {Human (Hom 99.95
d2oika1139 Histidine triad protein Mfla2506 {Methylobacillus 99.93
d1guqa2171 Galactose-1-phosphate uridylyltransferase {Escheri 99.93
d1z84a2156 Galactose-1-phosphate uridylyltransferase {Thale c 99.92
d1vlra1192 mRNA decapping enzyme DcpS C-terminal domain {Mous 99.68
d1z84a1173 Galactose-1-phosphate uridylyltransferase {Thale c 97.88
d2pofa1220 CDP-diacylglycerol pyrophosphatase CDH {Escherichi 97.35
d1guqa1176 Galactose-1-phosphate uridylyltransferase {Escheri 96.95
>d1kpfa_ d.13.1.1 (A:) Protein kinase C inhibitor-1, PKCI-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: HIT-like
superfamily: HIT-like
family: HIT (HINT, histidine triad) family of protein kinase-interacting proteins
domain: Protein kinase C inhibitor-1, PKCI-1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=1.5e-41  Score=225.47  Aligned_cols=111  Identities=27%  Similarity=0.557  Sum_probs=107.1

Q ss_pred             CCceeccccCccCccEEEEcCcEEEEEeCCCCCCCeEEEEEecCCCCCcCCCChhHHHHHHHHHHHHHHHHHHcCCCCce
Q psy9251           9 RSSILPHHEVSHNLTIIYEDTQCIAWEEMYHKVAPFHYKLVPKYNVPNMNYLIAENKTLYGHLLLVAGKITKMMNLTDGY   88 (121)
Q Consensus         9 ~~~~~~~~~~~~~~~iv~e~d~~va~~d~~~P~~~gH~LViPk~Hv~~~~~L~~~~~~~l~~l~~~~~~~~~~~~~~~g~   88 (121)
                      +|.||+|++|++|+.+|||||.++||.|++ |.++||+|||||+|++++.+|++++..++..+..+++++.++.+.++||
T Consensus         1 dCiFc~I~~~e~p~~ivyede~~~af~D~~-P~~~gH~LViPk~H~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~g~   79 (111)
T d1kpfa_           1 DTIFGKIIRKEIPAKIIFEDDRCLAFHDIS-PQAPTHFLVIPKKHISQISVAEDDDESLLGHLMIVGKKCAADLGLNKGY   79 (111)
T ss_dssp             CCHHHHHHTTSSCCCEEEECSSEEEEECSS-CSSSEEEEEEESSCCSCGGGCCGGGHHHHHHHHHHHHHHHHHTTCTTCE
T ss_pred             CCcccccccCCCCccEEEeCCCEEEEecCC-CCCCceEEEeecchhcchhhhhhHHHHHHHHHHHHHHHHHHHhCCCCCE
Confidence            699999999999999999999999999999 9999999999999999999999999889999999999998888777899


Q ss_pred             EEEEecCCcCCCccceeeEEEecCCCCCCCCC
Q psy9251          89 RIHVNNGPLAEQFYDWLYLDIFADKRLGWPPG  120 (121)
Q Consensus        89 ~~~~n~g~~agq~v~HlHlHIip~~~~~~~~~  120 (121)
                      |+.+|+|..+||+|+|+|+|||||++++||||
T Consensus        80 ~i~~n~g~~agq~V~HlH~Hiip~~~l~wppg  111 (111)
T d1kpfa_          80 RMVVNEGSDGGQSVYHVHLHVLGGRQMHWPPG  111 (111)
T ss_dssp             EEECCCHHHHTCCSSSCCEEEEESSCCCSSCC
T ss_pred             EEEEeCCccCCcccceeEEEEeCCCcCCCCcC
Confidence            99999999999999999999999999999998
>d1xqua_ d.13.1.1 (A:) Putative hydrolase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1y23a_ d.13.1.1 (A:) Hit {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1emsa1 d.13.1.1 (A:281-440) NIT-FHIT fusion protein, C-terminal domain {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1fita_ d.13.1.1 (A:) FHIT (fragile histidine triad protein) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2oika1 d.13.1.1 (A:6-144) Histidine triad protein Mfla2506 {Methylobacillus flagellatus [TaxId: 405]} Back     information, alignment and structure
>d1guqa2 d.13.1.2 (A:178-348) Galactose-1-phosphate uridylyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z84a2 d.13.1.2 (A:196-351) Galactose-1-phosphate uridylyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1vlra1 d.13.1.3 (A:146-337) mRNA decapping enzyme DcpS C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z84a1 d.13.1.2 (A:23-195) Galactose-1-phosphate uridylyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2pofa1 d.13.1.4 (A:31-250) CDP-diacylglycerol pyrophosphatase CDH {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1guqa1 d.13.1.2 (A:2-177) Galactose-1-phosphate uridylyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure