Psyllid ID: psy9252
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 346 | ||||||
| 158335323 | 116 | histidine triad family nucleotide-bindin | 0.315 | 0.939 | 0.381 | 6e-19 | |
| 359459118 | 116 | histidine triad family nucleotide-bindin | 0.315 | 0.939 | 0.372 | 1e-18 | |
| 313220436 | 133 | unnamed protein product [Oikopleura dioi | 0.320 | 0.834 | 0.401 | 4e-18 | |
| 313226888 | 133 | unnamed protein product [Oikopleura dioi | 0.320 | 0.834 | 0.401 | 5e-18 | |
| 47218227 | 126 | unnamed protein product [Tetraodon nigro | 0.315 | 0.865 | 0.381 | 8e-18 | |
| 390359368 | 175 | PREDICTED: histidine triad nucleotide-bi | 0.320 | 0.634 | 0.392 | 1e-17 | |
| 410900788 | 126 | PREDICTED: histidine triad nucleotide-bi | 0.315 | 0.865 | 0.363 | 1e-17 | |
| 428309764 | 113 | HIT family hydrolase, diadenosine tetrap | 0.315 | 0.964 | 0.4 | 2e-17 | |
| 348501588 | 126 | PREDICTED: histidine triad nucleotide-bi | 0.315 | 0.865 | 0.363 | 4e-17 | |
| 414075691 | 116 | histidine triad protein [Anabaena sp. 90 | 0.315 | 0.939 | 0.409 | 4e-17 |
| >gi|158335323|ref|YP_001516495.1| histidine triad family nucleotide-binding protein [Acaryochloris marina MBIC11017] gi|158305564|gb|ABW27181.1| histidine triad family nucleotide-binding protein [Acaryochloris marina MBIC11017] | Back alignment and taxonomy information |
|---|
Score = 101 bits (251), Expect = 6e-19, Method: Compositional matrix adjust.
Identities = 42/110 (38%), Positives = 72/110 (65%), Gaps = 1/110 (0%)
Query: 171 EKLYDKILRNKFKYKKVIYNDSLCWAYRELTKLAPVYINIIPKKNLTSLAEAQEEDAFLL 230
E ++ KI+R + ++Y D L A+R+++ AP++I +IPKK + L+EA+++D LL
Sbjct: 6 ETIFSKIIRREIP-ADIVYEDGLAIAFRDVSPQAPIHILVIPKKPIPRLSEAEQQDETLL 64
Query: 231 GHMFHLCQKFAFDLKMREGYRVVINNGHAGNHNLTHFNILLIGGRQMRYP 280
GH+ + Q+ A K+ +G+RVVINNG G + H ++ L+GGR + +P
Sbjct: 65 GHLLRVVQQVAVQEKLEQGFRVVINNGEDGGQTVEHLHLHLLGGRSLSWP 114
|
Source: Acaryochloris marina MBIC11017 Species: Acaryochloris marina Genus: Acaryochloris Family: Order: Chroococcales Class: Phylum: Cyanobacteria Superkingdom: Bacteria |
| >gi|359459118|ref|ZP_09247681.1| histidine triad family nucleotide-binding protein [Acaryochloris sp. CCMEE 5410] | Back alignment and taxonomy information |
|---|
| >gi|313220436|emb|CBY31289.1| unnamed protein product [Oikopleura dioica] | Back alignment and taxonomy information |
|---|
| >gi|313226888|emb|CBY22033.1| unnamed protein product [Oikopleura dioica] | Back alignment and taxonomy information |
|---|
| >gi|47218227|emb|CAF97091.1| unnamed protein product [Tetraodon nigroviridis] | Back alignment and taxonomy information |
|---|
| >gi|390359368|ref|XP_784457.3| PREDICTED: histidine triad nucleotide-binding protein 2, mitochondrial-like [Strongylocentrotus purpuratus] | Back alignment and taxonomy information |
|---|
| >gi|410900788|ref|XP_003963878.1| PREDICTED: histidine triad nucleotide-binding protein 1-like [Takifugu rubripes] | Back alignment and taxonomy information |
|---|
| >gi|428309764|ref|YP_007120741.1| HIT family hydrolase, diadenosine tetraphosphate hydrolase [Microcoleus sp. PCC 7113] gi|428251376|gb|AFZ17335.1| HIT family hydrolase, diadenosine tetraphosphate hydrolase [Microcoleus sp. PCC 7113] | Back alignment and taxonomy information |
|---|
| >gi|348501588|ref|XP_003438351.1| PREDICTED: histidine triad nucleotide-binding protein 1-like [Oreochromis niloticus] | Back alignment and taxonomy information |
|---|
| >gi|414075691|ref|YP_006995009.1| histidine triad protein [Anabaena sp. 90] gi|413969107|gb|AFW93196.1| histidine triad protein [Anabaena sp. 90] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 346 | ||||||
| UNIPROTKB|F1RKI3 | 126 | HINT1 "Uncharacterized protein | 0.315 | 0.865 | 0.354 | 5.1e-19 | |
| ZFIN|ZDB-GENE-070410-139 | 161 | hint2 "histidine triad nucleot | 0.271 | 0.583 | 0.382 | 8e-19 | |
| UNIPROTKB|P62958 | 126 | HINT1 "Histidine triad nucleot | 0.315 | 0.865 | 0.354 | 1.1e-18 | |
| UNIPROTKB|P49773 | 126 | HINT1 "Histidine triad nucleot | 0.315 | 0.865 | 0.345 | 2.8e-18 | |
| UNIPROTKB|P80912 | 126 | HINT1 "Histidine triad nucleot | 0.315 | 0.865 | 0.345 | 2.8e-18 | |
| MGI|MGI:1321133 | 126 | Hint1 "histidine triad nucleot | 0.315 | 0.865 | 0.345 | 3.6e-18 | |
| RGD|620960 | 126 | Hint1-ps1 "histidine triad nuc | 0.315 | 0.865 | 0.345 | 3.6e-18 | |
| UNIPROTKB|D4A269 | 126 | D4A269 "Uncharacterized protei | 0.315 | 0.865 | 0.345 | 3.6e-18 | |
| UNIPROTKB|Q5RF69 | 126 | HINT1 "Histidine triad nucleot | 0.315 | 0.865 | 0.336 | 9.5e-18 | |
| FB|FBgn0031459 | 150 | CG2862 [Drosophila melanogaste | 0.315 | 0.726 | 0.381 | 2.1e-17 |
| UNIPROTKB|F1RKI3 HINT1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Score = 228 (85.3 bits), Expect = 5.1e-19, P = 5.1e-19
Identities = 39/110 (35%), Positives = 74/110 (67%)
Query: 171 EKLYDKILRNKFKYKKVIYNDSLCWAYRELTKLAPVYINIIPKKNLTSLAEAQEEDAFLL 230
+ ++ KI+R + K+IY D C A+ +++ AP + +IPKK+++ ++ A+++D LL
Sbjct: 16 DTIFGKIIRKEIP-AKIIYEDDQCLAFHDISPQAPTHFLVIPKKHISQISAAEDDDESLL 74
Query: 231 GHMFHLCQKFAFDLKMREGYRVVINNGHAGNHNLTHFNILLIGGRQMRYP 280
GH+ + +K A DL +++GYR+V+N G G ++ H ++ ++GGRQM +P
Sbjct: 75 GHLMIVGKKCAADLGLKKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMNWP 124
|
|
| ZFIN|ZDB-GENE-070410-139 hint2 "histidine triad nucleotide binding protein 2" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P62958 HINT1 "Histidine triad nucleotide-binding protein 1" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P49773 HINT1 "Histidine triad nucleotide-binding protein 1" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P80912 HINT1 "Histidine triad nucleotide-binding protein 1" [Oryctolagus cuniculus (taxid:9986)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1321133 Hint1 "histidine triad nucleotide binding protein 1" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| RGD|620960 Hint1-ps1 "histidine triad nucleotide binding protein 1, pseudogene 1" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|D4A269 D4A269 "Uncharacterized protein" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q5RF69 HINT1 "Histidine triad nucleotide-binding protein 1" [Pongo abelii (taxid:9601)] | Back alignment and assigned GO terms |
|---|
| FB|FBgn0031459 CG2862 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 346 | |||
| cd01276 | 104 | cd01276, PKCI_related, Protein Kinase C Interactin | 4e-16 | |
| PRK10687 | 119 | PRK10687, PRK10687, purine nucleoside phosphoramid | 2e-11 | |
| pfam01230 | 97 | pfam01230, HIT, HIT domain | 2e-09 | |
| COG0537 | 138 | COG0537, Hit, Diadenosine tetraphosphate (Ap4A) hy | 2e-08 | |
| pfam11969 | 113 | pfam11969, DcpS_C, Scavenger mRNA decapping enzyme | 3e-07 | |
| cd01277 | 103 | cd01277, HINT_subgroup, HINT (histidine triad nucl | 4e-05 |
| >gnl|CDD|238607 cd01276, PKCI_related, Protein Kinase C Interacting protein related (PKCI): PKCI and related proteins belong to the ubiquitous HIT family of hydrolases that act on alpha-phosphates of ribonucleotides | Back alignment and domain information |
|---|
Score = 72.6 bits (179), Expect = 4e-16
Identities = 44/103 (42%), Positives = 64/103 (62%), Gaps = 2/103 (1%)
Query: 173 LYDKILRNKFKYKKVIYNDSLCWAYRELTKLAPVYINIIPKKNLTSLAEAQEEDAFLLGH 232
++ KI+R + KKV Y D A+ ++ APV+I +IPKK++ SL++A EED LLGH
Sbjct: 3 IFCKIIRGEIPAKKV-YEDDEVLAFHDINPQAPVHILVIPKKHIASLSDATEEDEELLGH 61
Query: 233 MFHLCQKFAFDLKMRE-GYRVVINNGHAGNHNLTHFNILLIGG 274
+ K A DL + E GYR+VIN G G + H ++ L+GG
Sbjct: 62 LLSAAAKVAKDLGIAEDGYRLVINCGKDGGQEVFHLHLHLLGG 104
|
The members of this subgroup have a conserved HxHxHxx motif (x is a hydrophobic residue) that is a signature for this family. No enzymatic activity has been reported however, for PKCI and its related members. Length = 104 |
| >gnl|CDD|182648 PRK10687, PRK10687, purine nucleoside phosphoramidase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|216377 pfam01230, HIT, HIT domain | Back alignment and domain information |
|---|
| >gnl|CDD|223611 COG0537, Hit, Diadenosine tetraphosphate (Ap4A) hydrolase and other HIT family hydrolases [Nucleotide transport and metabolism / Carbohydrate transport and metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|221348 pfam11969, DcpS_C, Scavenger mRNA decapping enzyme C-term binding | Back alignment and domain information |
|---|
| >gnl|CDD|238608 cd01277, HINT_subgroup, HINT (histidine triad nucleotide-binding protein) subgroup: Members of this CD belong to the superfamily of histidine triad hydrolases that act on alpha-phosphate of ribonucleotides | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 346 | |||
| PRK11720 | 346 | galactose-1-phosphate uridylyltransferase; Provisi | 100.0 | |
| TIGR00209 | 347 | galT_1 galactose-1-phosphate uridylyltransferase, | 100.0 | |
| cd00608 | 329 | GalT Galactose-1-phosphate uridyl transferase (Gal | 100.0 | |
| PLN02643 | 336 | ADP-glucose phosphorylase | 100.0 | |
| KOG3275|consensus | 127 | 99.97 | ||
| PRK10687 | 119 | purine nucleoside phosphoramidase; Provisional | 99.97 | |
| cd01276 | 104 | PKCI_related Protein Kinase C Interacting protein | 99.96 | |
| COG0537 | 138 | Hit Diadenosine tetraphosphate (Ap4A) hydrolase an | 99.95 | |
| cd01277 | 103 | HINT_subgroup HINT (histidine triad nucleotide-bin | 99.95 | |
| COG1085 | 338 | GalT Galactose-1-phosphate uridylyltransferase [En | 99.93 | |
| cd01278 | 104 | aprataxin_related aprataxin related: Aprataxin, a | 99.93 | |
| cd01275 | 126 | FHIT FHIT (fragile histidine family): FHIT protein | 99.93 | |
| PF01230 | 98 | HIT: HIT domain; InterPro: IPR001310 The Histidine | 99.89 | |
| cd00468 | 86 | HIT_like HIT family: HIT (Histidine triad) protein | 99.86 | |
| KOG2958|consensus | 354 | 99.85 | ||
| PF11969 | 116 | DcpS_C: Scavenger mRNA decapping enzyme C-term bin | 99.79 | |
| KOG3379|consensus | 150 | 99.74 | ||
| PF02744 | 166 | GalP_UDP_tr_C: Galactose-1-phosphate uridyl transf | 99.71 | |
| KOG4359|consensus | 166 | 99.56 | ||
| PF04677 | 121 | CwfJ_C_1: Protein similar to CwfJ C-terminus 1; In | 98.95 | |
| KOG0562|consensus | 184 | 98.84 | ||
| KOG2476|consensus | 528 | 98.16 | ||
| PF01087 | 183 | GalP_UDP_transf: Galactose-1-phosphate uridyl tran | 98.07 | |
| KOG3969|consensus | 310 | 97.11 | ||
| PLN03103 | 403 | GDP-L-galactose-hexose-1-phosphate guanyltransfera | 97.08 | |
| KOG2477|consensus | 628 | 96.74 | ||
| cd00608 | 329 | GalT Galactose-1-phosphate uridyl transferase (Gal | 96.42 | |
| COG4360 | 298 | APA2 ATP adenylyltransferase (5',5'''-P-1,P-4-tetr | 96.02 | |
| COG1085 | 338 | GalT Galactose-1-phosphate uridylyltransferase [En | 95.14 | |
| PLN02643 | 336 | ADP-glucose phosphorylase | 95.06 | |
| PRK11720 | 346 | galactose-1-phosphate uridylyltransferase; Provisi | 94.67 | |
| TIGR00209 | 347 | galT_1 galactose-1-phosphate uridylyltransferase, | 94.31 | |
| KOG2720|consensus | 431 | 94.17 | ||
| TIGR00672 | 250 | cdh CDP-diacylglycerol pyrophosphatase, bacterial | 93.99 | |
| PRK05471 | 252 | CDP-diacylglycerol pyrophosphatase; Provisional | 93.39 | |
| COG5075 | 305 | Uncharacterized conserved protein [Function unknow | 92.31 | |
| PF02611 | 222 | CDH: CDP-diacylglycerol pyrophosphatase; InterPro: | 91.5 | |
| COG2134 | 252 | Cdh CDP-diacylglycerol pyrophosphatase [Lipid meta | 82.89 |
| >PRK11720 galactose-1-phosphate uridylyltransferase; Provisional | Back alignment and domain information |
|---|
Probab=100.00 E-value=7.1e-38 Score=307.03 Aligned_cols=168 Identities=9% Similarity=0.042 Sum_probs=147.3
Q ss_pred HHHHHHhhhhhHhHHHhccCcCccEeec--------------CCCccccCCCCCchhHHHhhhhcccCchHHHHHHhhhc
Q psy9252 95 EVIRNCKHLDFDNFRKLGEQKLARYVLK--------------VHDRRRKYKNITQKTTVFDDSVISHGNEEEFMKRITLK 160 (346)
Q Consensus 95 ~~~~~~~~l~~dr~~~L~~~~~i~yV~~--------------pHGqiyaYp~Ip~k~~~~l~~~~sh~~~e~~~~~~~~~ 160 (346)
+-|++++.+|+|||++|+++ |+||++ |||||||+|+||+.++.+++++.+|+++
T Consensus 125 ~~i~~v~~~~~~r~~~l~~~--i~yv~iF~N~G~~~GaSl~HPH~Qi~a~p~vP~~~~~e~~~~~~y~~~---------- 192 (346)
T PRK11720 125 AALREVVDTWQEQTAELGKT--YPWVQVFENKGAAMGCSNPHPHGQIWANSFLPNEAEREDRLQRAYFAE---------- 192 (346)
T ss_pred HHHHHHHHHHHHHHHHHHhC--CcEEEEEeecCcccCcCCCCCceeeeeCCCCChHHHHHHHHHHHHHHH----------
Confidence 56899999999999999998 999999 9999999999999999999999888775
Q ss_pred cCCCCccCCCCCccccccccccCC-ccEEEECCeEEEEecCCCCCCceEEEEeccCCCCcccCCHHHHHHHHHHHHHH-H
Q psy9252 161 TVPGRLLYDHEKLYDKILRNKFKY-KKVIYNDSLCWAYRELTKLAPVYINIIPKKNLTSLAEAQEEDAFLLGHMFHLC-Q 238 (346)
Q Consensus 161 ~~~~~~~~~~~CVFCdIi~~E~~~-~rVVyEdE~fvAf~p~~P~sPGHvLVIPKRHV~sL~dLt~eE~~~La~Ll~va-~ 238 (346)
.+.|+||+|+++|.+. .||||||++|+||+|++|++|||+||+||+|++++.+|+++++..|+.+++.+ +
T Consensus 193 --------~g~Clfcdii~~E~~~~~RiV~End~fvAf~p~~p~~P~h~lIiPKrH~~~~~dl~dee~~~La~~lk~v~~ 264 (346)
T PRK11720 193 --------HGSPLLVDYVQRELADGERIVVETEHWLAVVPYWAAWPFETLLLPKAHVLRLTDLTDAQRDDLALALKKLTS 264 (346)
T ss_pred --------cCCeEHHHHHHhhhhcCCeEEEECCCEEEEeccccCCCCeEEEecccCCCChhhCCHHHHHHHHHHHHHHHH
Confidence 3789999999999773 59999999999999999999999999999999999999999999999988833 3
Q ss_pred HHHHHhCCCCCeEEEEecCCCCC--CccceeeEEEecC-----CCCCCCCC
Q psy9252 239 KFAFDLKMREGYRVVINNGHAGN--HNLTHFNILLIGG-----RQMRYPKY 282 (346)
Q Consensus 239 kVlk~lgL~~GYnm~~N~Gp~AG--qsV~HLHLHIIPr-----dkLkw~aG 282 (346)
++-+.++.+.+|||++|++|.+| ++++|+|+||+|+ .+++|.+|
T Consensus 265 ~l~~~~~~~~pyn~~~h~~p~~~~~~~~~H~HihiiPrl~Rs~~~~k~~aG 315 (346)
T PRK11720 265 RYDNLFQCSFPYSMGWHGAPFNGEENDHWQLHAHFYPPLLRSATVRKFMVG 315 (346)
T ss_pred HHHHHhCCCCCCceeEEecccCCCCCeeEEEEEEEeCCccCccccccceee
Confidence 33344443447999999999765 5789999999997 34666666
|
|
| >TIGR00209 galT_1 galactose-1-phosphate uridylyltransferase, family 1 | Back alignment and domain information |
|---|
| >cd00608 GalT Galactose-1-phosphate uridyl transferase (GalT): This enzyme plays a key role in galactose metabolism by catalysing the transfer of a uridine 5'-phosphoryl group from UDP-galactose 1-phosphate | Back alignment and domain information |
|---|
| >PLN02643 ADP-glucose phosphorylase | Back alignment and domain information |
|---|
| >KOG3275|consensus | Back alignment and domain information |
|---|
| >PRK10687 purine nucleoside phosphoramidase; Provisional | Back alignment and domain information |
|---|
| >cd01276 PKCI_related Protein Kinase C Interacting protein related (PKCI): PKCI and related proteins belong to the ubiquitous HIT family of hydrolases that act on alpha-phosphates of ribonucleotides | Back alignment and domain information |
|---|
| >COG0537 Hit Diadenosine tetraphosphate (Ap4A) hydrolase and other HIT family hydrolases [Nucleotide transport and metabolism / Carbohydrate transport and metabolism / General function prediction only] | Back alignment and domain information |
|---|
| >cd01277 HINT_subgroup HINT (histidine triad nucleotide-binding protein) subgroup: Members of this CD belong to the superfamily of histidine triad hydrolases that act on alpha-phosphate of ribonucleotides | Back alignment and domain information |
|---|
| >COG1085 GalT Galactose-1-phosphate uridylyltransferase [Energy production and conversion] | Back alignment and domain information |
|---|
| >cd01278 aprataxin_related aprataxin related: Aprataxin, a HINT family hydrolase is mutated in ataxia oculomotor apraxia syndrome | Back alignment and domain information |
|---|
| >cd01275 FHIT FHIT (fragile histidine family): FHIT proteins, related to the HIT family carry a motif HxHxH/Qxx (x, is a hydrophobic amino acid), On the basis of sequence, substrate specificity, structure, evolution and mechanism, HIT proteins are classified into three branches: the Hint branch, which consists of adenosine 5' -monophosphoramide hydrolases, the Fhit branch, that consists of diadenosine polyphosphate hydrolases, and the GalT branch consisting of specific nucloside monophosphate transferases | Back alignment and domain information |
|---|
| >PF01230 HIT: HIT domain; InterPro: IPR001310 The Histidine Triad (HIT) motif, His-x-His-x-His-x-x (x, a hydrophobic amino acid) was identified as being highly conserved in a variety of organisms [] | Back alignment and domain information |
|---|
| >cd00468 HIT_like HIT family: HIT (Histidine triad) proteins, named for a motif related to the sequence HxHxH/Qxx (x, a hydrophobic amino acid), are a superfamily of nucleotide hydrolases and transferases, which act on the alpha-phosphate of ribonucleotides | Back alignment and domain information |
|---|
| >KOG2958|consensus | Back alignment and domain information |
|---|
| >PF11969 DcpS_C: Scavenger mRNA decapping enzyme C-term binding; PDB: 1VLR_B 1XMM_D 1XML_B 1ST0_A 3BLA_B 3BL9_B 3BL7_B 1ST4_B 1XQU_B | Back alignment and domain information |
|---|
| >KOG3379|consensus | Back alignment and domain information |
|---|
| >PF02744 GalP_UDP_tr_C: Galactose-1-phosphate uridyl transferase, C-terminal domain; InterPro: IPR005850 Galactose-1-phosphate uridyl transferase catalyses the conversion of UDP-glucose and alpha-D-galactose 1-phosphate to alpha-D-glucose 1-phosphate and UDP-galactose during galactose metabolism | Back alignment and domain information |
|---|
| >KOG4359|consensus | Back alignment and domain information |
|---|
| >PF04677 CwfJ_C_1: Protein similar to CwfJ C-terminus 1; InterPro: IPR006768 This group of sequences contain a conserved C-terminal domain which is found in the Schizosaccharomyces pombe (Fission yeast) protein Cwf19 (Q09909 from SWISSPROT) and its homologues | Back alignment and domain information |
|---|
| >KOG0562|consensus | Back alignment and domain information |
|---|
| >KOG2476|consensus | Back alignment and domain information |
|---|
| >PF01087 GalP_UDP_transf: Galactose-1-phosphate uridyl transferase, N-terminal domain; InterPro: IPR005849 Galactose-1-phosphate uridyl transferase catalyses the conversion of UDP-glucose and alpha-D-galactose 1-phosphate to alpha-D-glucose 1-phosphate and UDP-galactose during galactose metabolism | Back alignment and domain information |
|---|
| >KOG3969|consensus | Back alignment and domain information |
|---|
| >PLN03103 GDP-L-galactose-hexose-1-phosphate guanyltransferase; Provisional | Back alignment and domain information |
|---|
| >KOG2477|consensus | Back alignment and domain information |
|---|
| >cd00608 GalT Galactose-1-phosphate uridyl transferase (GalT): This enzyme plays a key role in galactose metabolism by catalysing the transfer of a uridine 5'-phosphoryl group from UDP-galactose 1-phosphate | Back alignment and domain information |
|---|
| >COG4360 APA2 ATP adenylyltransferase (5',5'''-P-1,P-4-tetraphosphate phosphorylase II) [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >COG1085 GalT Galactose-1-phosphate uridylyltransferase [Energy production and conversion] | Back alignment and domain information |
|---|
| >PLN02643 ADP-glucose phosphorylase | Back alignment and domain information |
|---|
| >PRK11720 galactose-1-phosphate uridylyltransferase; Provisional | Back alignment and domain information |
|---|
| >TIGR00209 galT_1 galactose-1-phosphate uridylyltransferase, family 1 | Back alignment and domain information |
|---|
| >KOG2720|consensus | Back alignment and domain information |
|---|
| >TIGR00672 cdh CDP-diacylglycerol pyrophosphatase, bacterial type | Back alignment and domain information |
|---|
| >PRK05471 CDP-diacylglycerol pyrophosphatase; Provisional | Back alignment and domain information |
|---|
| >COG5075 Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF02611 CDH: CDP-diacylglycerol pyrophosphatase; InterPro: IPR003763 The CDP-diacylglycerol pyrophosphatases 3 | Back alignment and domain information |
|---|
| >COG2134 Cdh CDP-diacylglycerol pyrophosphatase [Lipid metabolism] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 346 | ||||
| 3o1x_A | 126 | High Resolution Crystal Structure Of Histidine Tria | 5e-19 | ||
| 1rzy_A | 126 | Crystal Structure Of Rabbit Hint Complexed With N- | 6e-19 | ||
| 1kpa_A | 126 | Pkci-1-Zinc Length = 126 | 1e-18 | ||
| 1kpb_A | 125 | Pkci-1-Apo Length = 125 | 1e-18 | ||
| 3tw2_A | 126 | High Resolution Structure Of Human Histidine Triad | 1e-18 | ||
| 4eqe_A | 128 | Crystal Structure Of Histidine Triad Nucleotide-Bin | 1e-18 | ||
| 3rhn_A | 115 | Histidine Triad Nucleotide-Binding Protein (Hint) F | 2e-18 | ||
| 3o1z_A | 126 | High Resolution Crystal Structure Of Histidine Tria | 5e-18 | ||
| 3o1c_A | 126 | High Resolution Crystal Structure Of Histidine Tria | 7e-18 | ||
| 3oj7_A | 117 | Crystal Structure Of A Histidine Triad Family Prote | 8e-09 | ||
| 1xqu_A | 147 | Hit Family Hydrolase From Clostridium Thermocellum | 2e-07 | ||
| 3n1s_A | 119 | Crystal Structure Of Wild Type Echint Gmp Complex L | 4e-07 | ||
| 3n1t_A | 119 | Crystal Structure Of The H101a Mutant Echint Gmp Co | 5e-07 | ||
| 4egu_A | 119 | 0.95a Resolution Structure Of A Histidine Triad Pro | 7e-06 |
| >pdb|3O1X|A Chain A, High Resolution Crystal Structure Of Histidine Triad Nucleotide- Binding Protein 1 (Hint1) C84a Mutant From Rabbit Complexed With Adenosine Length = 126 | Back alignment and structure |
|
| >pdb|1RZY|A Chain A, Crystal Structure Of Rabbit Hint Complexed With N- Ethylsulfamoyladenosine Length = 126 | Back alignment and structure |
| >pdb|1KPA|A Chain A, Pkci-1-Zinc Length = 126 | Back alignment and structure |
| >pdb|1KPB|A Chain A, Pkci-1-Apo Length = 125 | Back alignment and structure |
| >pdb|3TW2|A Chain A, High Resolution Structure Of Human Histidine Triad Nucleotide-binding Protein 1 (hhint1)/amp Complex In A Monoclinic Space Group Length = 126 | Back alignment and structure |
| >pdb|4EQE|A Chain A, Crystal Structure Of Histidine Triad Nucleotide-Binding Protein 1 (Hint1) From Human Complexed With Lys-Ams Length = 128 | Back alignment and structure |
| >pdb|3RHN|A Chain A, Histidine Triad Nucleotide-Binding Protein (Hint) From Rabbit Complexed With Gmp Length = 115 | Back alignment and structure |
| >pdb|3O1Z|A Chain A, High Resolution Crystal Structure Of Histidine Triad Nucleotide- Binding Protein 1 (Hint1) Double Cysteine Mutant From Rabbit Length = 126 | Back alignment and structure |
| >pdb|3O1C|A Chain A, High Resolution Crystal Structure Of Histidine Triad Nucleotide- Binding Protein 1 (Hint1) C38a Mutant From Rabbit Complexed With Adenosine Length = 126 | Back alignment and structure |
| >pdb|3OJ7|A Chain A, Crystal Structure Of A Histidine Triad Family Protein From Entamoeba Histolytica, Bound To Sulfate Length = 117 | Back alignment and structure |
| >pdb|1XQU|A Chain A, Hit Family Hydrolase From Clostridium Thermocellum Cth-393 Length = 147 | Back alignment and structure |
| >pdb|3N1S|A Chain A, Crystal Structure Of Wild Type Echint Gmp Complex Length = 119 | Back alignment and structure |
| >pdb|3N1T|A Chain A, Crystal Structure Of The H101a Mutant Echint Gmp Complex Length = 119 | Back alignment and structure |
| >pdb|4EGU|A Chain A, 0.95a Resolution Structure Of A Histidine Triad Protein From Clostridium Difficile Length = 119 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 346 | |||
| 3o1c_A | 126 | Histidine triad nucleotide-binding protein 1; hydr | 4e-23 | |
| 4egu_A | 119 | Histidine triad (HIT) protein; structural genomics | 4e-21 | |
| 3oj7_A | 117 | Putative histidine triad family protein; hydrolase | 7e-21 | |
| 3n1s_A | 119 | HIT-like protein HINT; histidine triad nucleotide | 1e-20 | |
| 1xqu_A | 147 | HIT family hydrolase; protein STRU initiative, PSI | 2e-20 | |
| 3ksv_A | 149 | Uncharacterized protein; HIT family, structural ge | 3e-15 | |
| 3o0m_A | 149 | HIT family protein; ssgcid, NIH, niaid, SBRI, UW, | 4e-15 | |
| 3lb5_A | 161 | HIT-like protein involved in cell-cycle regulatio; | 5e-13 | |
| 1y23_A | 145 | HIT, histidine triad protein; HIT protein, PKCI-1, | 2e-12 | |
| 2eo4_A | 149 | 150AA long hypothetical histidine triad nucleotid | 9e-12 | |
| 3p0t_A | 138 | Uncharacterized protein; ssgcid, HIT-like protein, | 2e-11 | |
| 3imi_A | 147 | HIT family protein; structural genomics, infectiou | 1e-10 | |
| 3r6f_A | 135 | HIT family protein; structural genomics, seattle s | 1e-09 | |
| 3l7x_A | 173 | SMU.412C, putative HIT-like protein involved in ce | 7e-09 | |
| 3sp4_A | 204 | Aprataxin-like protein; HIT domain, zinc finger, D | 2e-06 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-04 |
| >3o1c_A Histidine triad nucleotide-binding protein 1; hydrolase, HINT protein, HIT protein, adenosine 5'- monophosphoramidase; HET: ADN; 1.08A {Oryctolagus cuniculus} PDB: 3llj_A* 1rzy_A* 3qgz_A* 3o1z_A 3o1x_A* 4eqe_A* 4eqg_A* 4eqh_A* 3tw2_A* 1kpb_A 1kpf_A* 1kpa_A 1kpc_A 1av5_A* 1kpe_A* 4rhn_A* 3rhn_A* 5rhn_A* 6rhn_A Length = 126 | Back alignment and structure |
|---|
Score = 91.8 bits (229), Expect = 4e-23
Identities = 36/108 (33%), Positives = 70/108 (64%), Gaps = 1/108 (0%)
Query: 173 LYDKILRNKFKYKKVIYNDSLCWAYRELTKLAPVYINIIPKKNLTSLAEAQEEDAFLLGH 232
++ KI+R + K + + D A+ +++ AP + +IPKK+++ ++ A++ D LLGH
Sbjct: 18 IFGKIIRKEIPAKII-FEDDQALAFHDISPQAPTHFLVIPKKHISQISAAEDADESLLGH 76
Query: 233 MFHLCQKFAFDLKMREGYRVVINNGHAGNHNLTHFNILLIGGRQMRYP 280
+ + +K A DL +++GYR+V+N G G ++ H ++ ++GGRQM +P
Sbjct: 77 LMIVGKKCAADLGLKKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMNWP 124
|
| >4egu_A Histidine triad (HIT) protein; structural genomics, center for structural genomics of infec diseases, csgid, HIT domain, unknown function; HET: 5GP; 0.95A {Clostridium difficile} Length = 119 | Back alignment and structure |
|---|
| >3oj7_A Putative histidine triad family protein; hydrolase, structural genomics, seattle structural genomics for infectious disease, ssgcid; 1.40A {Entamoeba histolytica} PDB: 3omf_A* 3oxk_A* Length = 117 | Back alignment and structure |
|---|
| >3n1s_A HIT-like protein HINT; histidine triad nucleotide binding protein, GMP, hydro; HET: 5GP; 1.45A {Escherichia coli} PDB: 3n1t_A* Length = 119 | Back alignment and structure |
|---|
| >1xqu_A HIT family hydrolase; protein STRU initiative, PSI, southeast collaboratory for structural GEN secsg; 2.30A {Clostridium thermocellum} SCOP: d.13.1.1 Length = 147 | Back alignment and structure |
|---|
| >3ksv_A Uncharacterized protein; HIT family, structural genomics, structural genomics of PATH protozoa consortium, SGPP, unknown function; 1.90A {Leishmania major} Length = 149 | Back alignment and structure |
|---|
| >3o0m_A HIT family protein; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, hydrola structural genomics; HET: AMP; 1.90A {Mycobacterium smegmatis str} Length = 149 | Back alignment and structure |
|---|
| >3lb5_A HIT-like protein involved in cell-cycle regulatio; niaid, seattle structural genomics center for infectious DIS ssgcid, histidine triad; 1.90A {Bartonella henselae} Length = 161 | Back alignment and structure |
|---|
| >1y23_A HIT, histidine triad protein; HIT protein, PKCI-1, cell-cycle regulation, NYSGXRC, structural genomics, protein structure initiative; 2.30A {Bacillus subtilis} SCOP: d.13.1.1 Length = 145 | Back alignment and structure |
|---|
| >2eo4_A 150AA long hypothetical histidine triad nucleotid protein; HIT family, structural genomics, NPPSFA; 1.80A {Sulfolobus tokodaii} Length = 149 | Back alignment and structure |
|---|
| >3p0t_A Uncharacterized protein; ssgcid, HIT-like protein, mycobacerium paratuberculosis, STR genomics; 1.90A {Mycobacterium avium subsp} Length = 138 | Back alignment and structure |
|---|
| >3imi_A HIT family protein; structural genomics, infectious diseases for structural genomics of infectious diseases, unknown FUN csgid; 2.01A {Bacillus anthracis str} Length = 147 | Back alignment and structure |
|---|
| >3r6f_A HIT family protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, protozoan parasite; 1.85A {Encephalitozoon cuniculi} Length = 135 | Back alignment and structure |
|---|
| >3l7x_A SMU.412C, putative HIT-like protein involved in cell-cycle regulation; 1.70A {Streptococcus mutans} Length = 173 | Back alignment and structure |
|---|
| >3sp4_A Aprataxin-like protein; HIT domain, zinc finger, DNA-binding protein, DNA deadenylas hydrolase; 1.80A {Schizosaccharomyces pombe} PDB: 3spd_A* 3spl_A* 3szq_A* Length = 204 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 346 | |||
| 1z84_A | 351 | Galactose-1-phosphate uridyl transferase-like prot | 100.0 | |
| 1gup_A | 348 | Galactose-1-phosphate uridylyltransferase; nucleot | 100.0 | |
| 3o1c_A | 126 | Histidine triad nucleotide-binding protein 1; hydr | 100.0 | |
| 3n1s_A | 119 | HIT-like protein HINT; histidine triad nucleotide | 100.0 | |
| 3oj7_A | 117 | Putative histidine triad family protein; hydrolase | 100.0 | |
| 4egu_A | 119 | Histidine triad (HIT) protein; structural genomics | 99.98 | |
| 1xqu_A | 147 | HIT family hydrolase; protein STRU initiative, PSI | 99.97 | |
| 3o0m_A | 149 | HIT family protein; ssgcid, NIH, niaid, SBRI, UW, | 99.96 | |
| 3imi_A | 147 | HIT family protein; structural genomics, infectiou | 99.96 | |
| 3lb5_A | 161 | HIT-like protein involved in cell-cycle regulatio; | 99.96 | |
| 3ksv_A | 149 | Uncharacterized protein; HIT family, structural ge | 99.96 | |
| 3l7x_A | 173 | SMU.412C, putative HIT-like protein involved in ce | 99.96 | |
| 3ano_A | 218 | AP-4-A phosphorylase; diadenosine polyphosphate, H | 99.95 | |
| 2eo4_A | 149 | 150AA long hypothetical histidine triad nucleotid | 99.95 | |
| 3r6f_A | 135 | HIT family protein; structural genomics, seattle s | 99.95 | |
| 1y23_A | 145 | HIT, histidine triad protein; HIT protein, PKCI-1, | 99.95 | |
| 3p0t_A | 138 | Uncharacterized protein; ssgcid, HIT-like protein, | 99.94 | |
| 2oik_A | 154 | Histidine triad (HIT) protein; HIT-like fold, stru | 99.9 | |
| 1fit_A | 147 | FragIle histidine protein; FHIT, fragIle histidine | 99.9 | |
| 1ems_A | 440 | Nitfhit, NIT-fragIle histidine triad fusion protei | 99.88 | |
| 3ohe_A | 137 | Histidine triad (HIT) protein; structural genomics | 99.75 | |
| 3i24_A | 149 | HIT family hydrolase; structural genomics, PSI-2, | 99.75 | |
| 3sp4_A | 204 | Aprataxin-like protein; HIT domain, zinc finger, D | 99.73 | |
| 3nrd_A | 135 | Histidine triad (HIT) protein; structural genomics | 99.66 | |
| 3i4s_A | 149 | Histidine triad protein; hydrolase, phosphatase, H | 99.56 | |
| 3bl9_A | 301 | Scavenger mRNA-decapping enzyme DCPS; ligand compl | 98.95 | |
| 1vlr_A | 350 | MRNA decapping enzyme; 16740816, structural genomi | 98.9 | |
| 1z84_A | 351 | Galactose-1-phosphate uridyl transferase-like prot | 98.62 | |
| 1gup_A | 348 | Galactose-1-phosphate uridylyltransferase; nucleot | 96.16 | |
| 2pof_A | 227 | CDP-diacylglycerol pyrophosphatase; NYSGXRC, PFAM0 | 93.42 |
| >1z84_A Galactose-1-phosphate uridyl transferase-like protein; GALT, zinc, AMP, structural genomics, protein structure initiative, CESG; HET: AMP; 1.83A {Arabidopsis thaliana} SCOP: d.13.1.2 d.13.1.2 PDB: 1zwj_A 2q4h_A* 2q4l_A 2h39_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=5.7e-37 Score=298.58 Aligned_cols=167 Identities=17% Similarity=0.142 Sum_probs=149.0
Q ss_pred CCCCCC---CCcHHHHHHHHhhhhhHhHHHhccCcCccEeec--------------CCCccccCCCCCchhHHHhhhhcc
Q psy9252 84 PPGHPG---GDTLEEVIRNCKHLDFDNFRKLGEQKLARYVLK--------------VHDRRRKYKNITQKTTVFDDSVIS 146 (346)
Q Consensus 84 ~~~~~~---~~~~~~~~~~~~~l~~dr~~~L~~~~~i~yV~~--------------pHGqiyaYp~Ip~k~~~~l~~~~s 146 (346)
+|-|.+ --| .|-|+.++++|.+|+++|+++++++||++ |||||||||+||+.++.+++++..
T Consensus 130 sp~H~~~l~~ls-~~e~~~vi~~~~~~~~~L~~~~~~~yv~iF~N~G~~aGaSl~HpH~QI~a~~~~p~~~~~e~~~~~~ 208 (351)
T 1z84_A 130 SPVHSIQLSDID-PVGIGDILIAYKKRINQIAQHDSINYIQVFKNQGASAGASMSHSHSQMMALPVVPPTVSSRLDGTKD 208 (351)
T ss_dssp CSSSSCCGGGSC-HHHHHHHHHHHHHHHHHHTTCTTCCEEEEEEEESGGGTCCCSSCEEEEEEESSCCHHHHHHHHHHHH
T ss_pred CCCCCCCcHHCC-HHHHHHHHHHHHHHHHHHhcccCCCEEEEEEEcCcccCCCCcCccceeEecCcCChHHHHHHHHHHH
Confidence 566664 233 35589999999999999999999999999 999999999999999999999888
Q ss_pred cCchHHHHHHhhhccCCCCccCCCCCccccccccccCCccEEEECCeEEEEecCCCCCCceEEEEeccCCCCcccCCHHH
Q psy9252 147 HGNEEEFMKRITLKTVPGRLLYDHEKLYDKILRNKFKYKKVIYNDSLCWAYRELTKLAPVYINIIPKKNLTSLAEAQEED 226 (346)
Q Consensus 147 h~~~e~~~~~~~~~~~~~~~~~~~~CVFCdIi~~E~~~~rVVyEdE~fvAf~p~~P~sPGHvLVIPKRHV~sL~dLt~eE 226 (346)
|+++ .+.|+||+|+++|. +||||++|+||+|++|.+|||+|||||+|+.++.+|++++
T Consensus 209 y~~~------------------~~~ciFc~ii~~E~----iV~E~e~~~af~~~~p~~P~h~lViPk~Hv~~l~dl~~~e 266 (351)
T 1z84_A 209 YFEE------------------TGKCCLCEAKSKHF----VIDESSHFVSVAPFAATYPFEIWIIPKDHSSHFHHLDDVK 266 (351)
T ss_dssp HHHH------------------HSSCTTTTHHHHSE----EEEECSSEEEEECTTCSSTTCEEEEESSCCSCGGGCCHHH
T ss_pred HHhh------------------cCCCHHHHHHhcCe----EEecCCcEEEEeccCCCCCeEEEEEeccccCChHHCCHHH
Confidence 7774 36899999998874 9999999999999999999999999999999999999999
Q ss_pred HHHHHHHHH-HHHHHHHHhCCCCCeEEEEecCCCCC----CccceeeEEEecC
Q psy9252 227 AFLLGHMFH-LCQKFAFDLKMREGYRVVINNGHAGN----HNLTHFNILLIGG 274 (346)
Q Consensus 227 ~~~La~Ll~-va~kVlk~lgL~~GYnm~~N~Gp~AG----qsV~HLHLHIIPr 274 (346)
+..|+.+++ +++++.+.++. +|||+++|+|+.+| |+++|+|+||+||
T Consensus 267 ~~~La~~l~~v~~~l~~~~~~-~~yn~~~n~gp~~g~~~~q~v~HlHiHiiPR 318 (351)
T 1z84_A 267 AVDLGGLLKLMLQKIAKQLND-PPYNYMIHTSPLKVTESQLPYTHWFLQIVPQ 318 (351)
T ss_dssp HHHHHHHHHHHHHHHHHHTTS-CCEEEEEECCCTTCCGGGGGGCCCEEEEEEC
T ss_pred HHHHHHHHHHHHHHHHHhcCC-CCEEEEEeCCCccCCCCCCccceEEEEEEcc
Confidence 999999988 44566666774 59999999999987 7999999999997
|
| >1gup_A Galactose-1-phosphate uridylyltransferase; nucleotidyltransferase, galactose metabolism; HET: GDU; 1.80A {Escherichia coli} SCOP: d.13.1.2 d.13.1.2 PDB: 1guq_A* 1hxq_A* 1hxp_A* | Back alignment and structure |
|---|
| >3o1c_A Histidine triad nucleotide-binding protein 1; hydrolase, HINT protein, HIT protein, adenosine 5'- monophosphoramidase; HET: ADN; 1.08A {Oryctolagus cuniculus} SCOP: d.13.1.1 PDB: 3llj_A* 1rzy_A* 3qgz_A* 3o1z_A 3o1x_A* 4eqe_A* 4eqg_A* 4eqh_A* 3tw2_A* 1kpb_A 1kpf_A* 1kpa_A 1kpc_A 1av5_A* 1kpe_A* 4rhn_A* 3rhn_A* 5rhn_A* 6rhn_A | Back alignment and structure |
|---|
| >3n1s_A HIT-like protein HINT; histidine triad nucleotide binding protein, GMP, hydro; HET: 5GP; 1.45A {Escherichia coli} SCOP: d.13.1.0 PDB: 3n1t_A* | Back alignment and structure |
|---|
| >3oj7_A Putative histidine triad family protein; hydrolase, structural genomics, seattle structural genomics for infectious disease, ssgcid; 1.40A {Entamoeba histolytica} SCOP: d.13.1.0 PDB: 3omf_A* 3oxk_A* | Back alignment and structure |
|---|
| >4egu_A Histidine triad (HIT) protein; structural genomics, center for structural genomics of infec diseases, csgid, HIT domain, unknown function; HET: 5GP; 0.95A {Clostridium difficile} | Back alignment and structure |
|---|
| >1xqu_A HIT family hydrolase; protein STRU initiative, PSI, southeast collaboratory for structural GEN secsg; 2.30A {Clostridium thermocellum} SCOP: d.13.1.1 | Back alignment and structure |
|---|
| >3o0m_A HIT family protein; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, hydrola structural genomics; HET: AMP; 1.90A {Mycobacterium smegmatis str} | Back alignment and structure |
|---|
| >3imi_A HIT family protein; structural genomics, infectious diseases for structural genomics of infectious diseases, unknown FUN csgid; 2.01A {Bacillus anthracis str} SCOP: d.13.1.1 | Back alignment and structure |
|---|
| >3lb5_A HIT-like protein involved in cell-cycle regulatio; niaid, seattle structural genomics center for infectious DIS ssgcid, histidine triad; 1.90A {Bartonella henselae} | Back alignment and structure |
|---|
| >3ksv_A Uncharacterized protein; HIT family, structural genomics, structural genomics of PATH protozoa consortium, SGPP, unknown function; 1.90A {Leishmania major} SCOP: d.13.1.0 | Back alignment and structure |
|---|
| >3l7x_A SMU.412C, putative HIT-like protein involved in cell-cycle regulation; 1.70A {Streptococcus mutans} | Back alignment and structure |
|---|
| >3ano_A AP-4-A phosphorylase; diadenosine polyphosphate, HIT transferase; HET: PG4; 1.89A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >2eo4_A 150AA long hypothetical histidine triad nucleotid protein; HIT family, structural genomics, NPPSFA; 1.80A {Sulfolobus tokodaii} | Back alignment and structure |
|---|
| >3r6f_A HIT family protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, protozoan parasite; 1.85A {Encephalitozoon cuniculi} | Back alignment and structure |
|---|
| >1y23_A HIT, histidine triad protein; HIT protein, PKCI-1, cell-cycle regulation, NYSGXRC, structural genomics, protein structure initiative; 2.30A {Bacillus subtilis} SCOP: d.13.1.1 | Back alignment and structure |
|---|
| >3p0t_A Uncharacterized protein; ssgcid, HIT-like protein, mycobacerium paratuberculosis, STR genomics; 1.90A {Mycobacterium avium subsp} | Back alignment and structure |
|---|
| >2oik_A Histidine triad (HIT) protein; HIT-like fold, structural genomics, joint center for structu genomics, JCSG; HET: MSE; 1.65A {Methylobacillus flagellatus} SCOP: d.13.1.1 | Back alignment and structure |
|---|
| >1fit_A FragIle histidine protein; FHIT, fragIle histidine triad protein, putative human tumor suppressor, advanced photon source, APS; HET: FRU; 1.85A {Homo sapiens} SCOP: d.13.1.1 PDB: 1fhi_A* 2fit_A* 3fit_A* 4fit_A 5fit_A* 6fit_A* 2fhi_A* | Back alignment and structure |
|---|
| >1ems_A Nitfhit, NIT-fragIle histidine triad fusion protein; WORM, nitrilase, nucleotide-binding protein, cancer; 2.80A {Caenorhabditis elegans} SCOP: d.13.1.1 d.160.1.1 | Back alignment and structure |
|---|
| >3ohe_A Histidine triad (HIT) protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-biology; HET: MSE; 1.20A {Marinobacter aquaeolei} | Back alignment and structure |
|---|
| >3i24_A HIT family hydrolase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 1.50A {Vibrio fischeri ES114} | Back alignment and structure |
|---|
| >3sp4_A Aprataxin-like protein; HIT domain, zinc finger, DNA-binding protein, DNA deadenylas hydrolase; 1.80A {Schizosaccharomyces pombe} PDB: 3spd_A* 3spl_A* 3szq_A* | Back alignment and structure |
|---|
| >3nrd_A Histidine triad (HIT) protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE; 2.06A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3i4s_A Histidine triad protein; hydrolase, phosphatase, HIT superfamily, PSI-2, NYSGXRC, STR genomics, protein structure initiative; 1.75A {Bradyrhizobium japonicum} | Back alignment and structure |
|---|
| >3bl9_A Scavenger mRNA-decapping enzyme DCPS; ligand complex, cytoplasm, hydrolase, nonsense-mediated mRNA decay, nucleus, polymorphism, structural genomics; HET: DD2; 1.80A {Homo sapiens} SCOP: d.13.1.3 d.246.1.1 PDB: 3bl7_A* 3bla_A* | Back alignment and structure |
|---|
| >1vlr_A MRNA decapping enzyme; 16740816, structural genomics, JCSG, protein structure initiative, PSI, joint center for structural genomics; 1.83A {Mus musculus} SCOP: d.13.1.3 d.246.1.1 PDB: 1xmm_B* 1xml_B 1st0_B* 1st4_B* | Back alignment and structure |
|---|
| >1z84_A Galactose-1-phosphate uridyl transferase-like protein; GALT, zinc, AMP, structural genomics, protein structure initiative, CESG; HET: AMP; 1.83A {Arabidopsis thaliana} SCOP: d.13.1.2 d.13.1.2 PDB: 1zwj_A 2q4h_A* 2q4l_A 2h39_A* | Back alignment and structure |
|---|
| >1gup_A Galactose-1-phosphate uridylyltransferase; nucleotidyltransferase, galactose metabolism; HET: GDU; 1.80A {Escherichia coli} SCOP: d.13.1.2 d.13.1.2 PDB: 1guq_A* 1hxq_A* 1hxp_A* | Back alignment and structure |
|---|
| >2pof_A CDP-diacylglycerol pyrophosphatase; NYSGXRC, PFAM02611, PSI-2, phospholipid biosynthesis structural genomics, protein structure initiative; 1.40A {Escherichia coli} SCOP: d.13.1.4 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 346 | ||||
| d1kpfa_ | 111 | d.13.1.1 (A:) Protein kinase C inhibitor-1, PKCI-1 | 2e-13 | |
| d1xqua_ | 113 | d.13.1.1 (A:) Putative hydrolase {Clostridium ther | 2e-09 | |
| d1emsa1 | 160 | d.13.1.1 (A:281-440) NIT-FHIT fusion protein, C-te | 7e-06 | |
| d1y23a_ | 139 | d.13.1.1 (A:) Hit {Bacillus subtilis [TaxId: 1423] | 8e-05 | |
| d1fita_ | 146 | d.13.1.1 (A:) FHIT (fragile histidine triad protei | 5e-04 | |
| d1guqa2 | 171 | d.13.1.2 (A:178-348) Galactose-1-phosphate uridyly | 7e-04 |
| >d1kpfa_ d.13.1.1 (A:) Protein kinase C inhibitor-1, PKCI-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 111 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: HIT-like superfamily: HIT-like family: HIT (HINT, histidine triad) family of protein kinase-interacting proteins domain: Protein kinase C inhibitor-1, PKCI-1 species: Human (Homo sapiens) [TaxId: 9606]
Score = 64.0 bits (155), Expect = 2e-13
Identities = 38/108 (35%), Positives = 72/108 (66%), Gaps = 1/108 (0%)
Query: 173 LYDKILRNKFKYKKVIYNDSLCWAYRELTKLAPVYINIIPKKNLTSLAEAQEEDAFLLGH 232
++ KI+R + K+I+ D C A+ +++ AP + +IPKK+++ ++ A+++D LLGH
Sbjct: 3 IFGKIIRKEIP-AKIIFEDDRCLAFHDISPQAPTHFLVIPKKHISQISVAEDDDESLLGH 61
Query: 233 MFHLCQKFAFDLKMREGYRVVINNGHAGNHNLTHFNILLIGGRQMRYP 280
+ + +K A DL + +GYR+V+N G G ++ H ++ ++GGRQM +P
Sbjct: 62 LMIVGKKCAADLGLNKGYRMVVNEGSDGGQSVYHVHLHVLGGRQMHWP 109
|
| >d1xqua_ d.13.1.1 (A:) Putative hydrolase {Clostridium thermocellum [TaxId: 1515]} Length = 113 | Back information, alignment and structure |
|---|
| >d1emsa1 d.13.1.1 (A:281-440) NIT-FHIT fusion protein, C-terminal domain {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 160 | Back information, alignment and structure |
|---|
| >d1y23a_ d.13.1.1 (A:) Hit {Bacillus subtilis [TaxId: 1423]} Length = 139 | Back information, alignment and structure |
|---|
| >d1fita_ d.13.1.1 (A:) FHIT (fragile histidine triad protein) {Human (Homo sapiens) [TaxId: 9606]} Length = 146 | Back information, alignment and structure |
|---|
| >d1guqa2 d.13.1.2 (A:178-348) Galactose-1-phosphate uridylyltransferase {Escherichia coli [TaxId: 562]} Length = 171 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 346 | |||
| d1kpfa_ | 111 | Protein kinase C inhibitor-1, PKCI-1 {Human (Homo | 100.0 | |
| d1xqua_ | 113 | Putative hydrolase {Clostridium thermocellum [TaxI | 99.97 | |
| d1y23a_ | 139 | Hit {Bacillus subtilis [TaxId: 1423]} | 99.96 | |
| d1emsa1 | 160 | NIT-FHIT fusion protein, C-terminal domain {Nemato | 99.95 | |
| d1guqa2 | 171 | Galactose-1-phosphate uridylyltransferase {Escheri | 99.94 | |
| d1z84a2 | 156 | Galactose-1-phosphate uridylyltransferase {Thale c | 99.93 | |
| d2oika1 | 139 | Histidine triad protein Mfla2506 {Methylobacillus | 99.89 | |
| d1fita_ | 146 | FHIT (fragile histidine triad protein) {Human (Hom | 99.89 | |
| d1vlra1 | 192 | mRNA decapping enzyme DcpS C-terminal domain {Mous | 99.37 | |
| d1z84a1 | 173 | Galactose-1-phosphate uridylyltransferase {Thale c | 98.6 | |
| d1guqa1 | 176 | Galactose-1-phosphate uridylyltransferase {Escheri | 98.42 | |
| d1z84a1 | 173 | Galactose-1-phosphate uridylyltransferase {Thale c | 97.18 | |
| d1guqa1 | 176 | Galactose-1-phosphate uridylyltransferase {Escheri | 96.89 | |
| d2pofa1 | 220 | CDP-diacylglycerol pyrophosphatase CDH {Escherichi | 93.44 |
| >d1kpfa_ d.13.1.1 (A:) Protein kinase C inhibitor-1, PKCI-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a+b) fold: HIT-like superfamily: HIT-like family: HIT (HINT, histidine triad) family of protein kinase-interacting proteins domain: Protein kinase C inhibitor-1, PKCI-1 species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00 E-value=4e-34 Score=234.57 Aligned_cols=111 Identities=34% Similarity=0.743 Sum_probs=106.2
Q ss_pred CCccccccccccCCccEEEECCeEEEEecCCCCCCceEEEEeccCCCCcccCCHHHHHHHHHHHHHHHHHHHHhCCCCCe
Q psy9252 171 EKLYDKILRNKFKYKKVIYNDSLCWAYRELTKLAPVYINIIPKKNLTSLAEAQEEDAFLLGHMFHLCQKFAFDLKMREGY 250 (346)
Q Consensus 171 ~CVFCdIi~~E~~~~rVVyEdE~fvAf~p~~P~sPGHvLVIPKRHV~sL~dLt~eE~~~La~Ll~va~kVlk~lgL~~GY 250 (346)
+|+||+|+++|.+ +.+|||||+++||+|.+|.+|||+|||||+|+.++.+|++++..++..++.++++++++.+.++||
T Consensus 1 dCiFc~I~~~e~p-~~ivyede~~~af~D~~P~~~gH~LViPk~H~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~g~ 79 (111)
T d1kpfa_ 1 DTIFGKIIRKEIP-AKIIFEDDRCLAFHDISPQAPTHFLVIPKKHISQISVAEDDDESLLGHLMIVGKKCAADLGLNKGY 79 (111)
T ss_dssp CCHHHHHHTTSSC-CCEEEECSSEEEEECSSCSSSEEEEEEESSCCSCGGGCCGGGHHHHHHHHHHHHHHHHHTTCTTCE
T ss_pred CCcccccccCCCC-ccEEEeCCCEEEEecCCCCCCceEEEeecchhcchhhhhhHHHHHHHHHHHHHHHHHHHhCCCCCE
Confidence 5999999999998 899999999999999999999999999999999999999999999999999999998887767899
Q ss_pred EEEEecCCCCCCccceeeEEEecCCCCCCCCC
Q psy9252 251 RVVINNGHAGNHNLTHFNILLIGGRQMRYPKY 282 (346)
Q Consensus 251 nm~~N~Gp~AGqsV~HLHLHIIPrdkLkw~aG 282 (346)
|+++|+|+.|||+|+|+|+|||||++|+|++|
T Consensus 80 ~i~~n~g~~agq~V~HlH~Hiip~~~l~wppg 111 (111)
T d1kpfa_ 80 RMVVNEGSDGGQSVYHVHLHVLGGRQMHWPPG 111 (111)
T ss_dssp EEECCCHHHHTCCSSSCCEEEEESSCCCSSCC
T ss_pred EEEEeCCccCCcccceeEEEEeCCCcCCCCcC
Confidence 99999999999999999999999999999987
|
| >d1xqua_ d.13.1.1 (A:) Putative hydrolase {Clostridium thermocellum [TaxId: 1515]} | Back information, alignment and structure |
|---|
| >d1y23a_ d.13.1.1 (A:) Hit {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1emsa1 d.13.1.1 (A:281-440) NIT-FHIT fusion protein, C-terminal domain {Nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1guqa2 d.13.1.2 (A:178-348) Galactose-1-phosphate uridylyltransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1z84a2 d.13.1.2 (A:196-351) Galactose-1-phosphate uridylyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d2oika1 d.13.1.1 (A:6-144) Histidine triad protein Mfla2506 {Methylobacillus flagellatus [TaxId: 405]} | Back information, alignment and structure |
|---|
| >d1fita_ d.13.1.1 (A:) FHIT (fragile histidine triad protein) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vlra1 d.13.1.3 (A:146-337) mRNA decapping enzyme DcpS C-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1z84a1 d.13.1.2 (A:23-195) Galactose-1-phosphate uridylyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1guqa1 d.13.1.2 (A:2-177) Galactose-1-phosphate uridylyltransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1z84a1 d.13.1.2 (A:23-195) Galactose-1-phosphate uridylyltransferase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} | Back information, alignment and structure |
|---|
| >d1guqa1 d.13.1.2 (A:2-177) Galactose-1-phosphate uridylyltransferase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2pofa1 d.13.1.4 (A:31-250) CDP-diacylglycerol pyrophosphatase CDH {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|