Psyllid ID: psy9313


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350------
MMKHEEMYNTTQSHRSTYQSDVNEQNSNLIVNYVPQTMTQEELQHLFSSVGEVESCKLIRDKTTAQSLGYGFVNYYRTEDAERAIIELNGLKLQNKSIKVSYARPSSEAIKRANLYVSGLPKHMTQEDLENLFRPYGTIITSRILCDKMASENVRSFVSGTPEIPQISKGIGFVRFNQHIEAEHAMQELNGTIPEGASEPITVKFANSPAGRAKALAANLNAQAAAMRHFAAAMRHFGNPLHHSARFKFAPLTADLLNNSMLPPKSLHGSGWCIFVYNLAPETEDNVLWQLFGPFGAVQNVKVVRDPQTYKCKGFGFVCMTNYDEAVFAIQSLNGYALGDRLLQVSFKTHKPLPPV
cccccEEEEccccccccccccccccccEEEEccccccccHHHHHHHHcccccEEEEEEEEcccccccccEEEEEcccHHHHHHHHHHHcccccccEEEEEEEEcccccccccccEEEEcccccccHHHHHHHHccccccccEEEEEcccccccccccccccccccccccEEEEEEcccHHHHHHHHHHHcccccccccccEEEEccccccHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccHHHHccccccccccccccccEEEEEcccccccHHHHHHHHcccccEEEEEEEEEccccccEEEEEEEcccHHHHHHHHHHHcccccccEEEEEEcccccccccc
cccccEEEEccccccccccccHHHcccEEEEEcccccccHHHHHHHHHccccEEEEEEEEccccccEEEEEEEEEccHHHHHHHHHHHcccEEccEEcEEEEcccccHHHcccEEEEEcccccccHHHHHHHHHHHccEEEEEEEEccccccccEEEEEEcccccccEEEEEEEEEccHHHHHHHHHHHccccccccccccEEEEcccHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEcccccccHHHHHHHHcccccEEEEEEEEccccccccccEEEEcccHHHHHHHHHHHcccEEcccEEEEEEccccccccc
mmkheemynttqsHRSTYQsdvneqnsnLIVNYVPQTMTQEELQHLFSSvgevescklirdkttaqslGYGFVNYYRTEDAERAIIELNGLklqnksikvsyarpsseaiKRANLyvsglpkhmtqedlenlfrpygtiitSRILCDKMASENvrsfvsgtpeipqiskgigfvrFNQHIEAEHAMQELngtipegasepitvkfanspaGRAKALAANLNAQAAAMRHFAAAMRhfgnplhhsarfkfapltadllnnsmlppkslhgsgwcifvynlapetednVLWQlfgpfgavqnvkvvrdpqtykckgfgfvcmtNYDEAVFAIQSLNGYALGDRLLQVsfkthkplppv
mmkheemynttqshrstYQSDVNEQNSNLIVNYVPQTMTQEELQHLFSSVGEVESCKLIrdkttaqslgyGFVNYYRTEDAERAIIElnglklqnksikvsyarpsseaikRANLYVSGLPKHMTQEDLENLFRPYGTIITSRILCDKMASENVRSfvsgtpeipqisKGIGFVRFNQHIEAEHAMQELNGTIPEGASEPITVKFANSPAGRAKALAANLNAQAAAMRHFAAAMRHFGNPLHHSARFKFAPLTADLLNNSMLPPKSLHGSGWCIFVYNLAPETEDNVLWQLFGPFGAVQNVKVVRDPQTYKCKGFGFVCMTNYDEAVFAIQSLNGYALGDRLLQvsfkthkplppv
MMKHEEMYNTTQSHRSTYQSDVNEQNSNLIVNYVPQTMTQEELQHLFSSVGEVESCKLIRDKTTAQSLGYGFVNYYRTEDAERAIIELNGLKLQNKSIKVSYARPSSEAIKRANLYVSGLPKHMTQEDLENLFRPYGTIITSRILCDKMASENVRSFVSGTPEIPQISKGIGFVRFNQHIEAEHAMQELNGTIPEGASEPITVKFANSPagrakalaanlnaqaaamrhfaaamrhfGNPLHHSARFKFAPLTADLLNNSMLPPKSLHGSGWCIFVYNLAPETEDNVLWQLFGPFGAVQNVKVVRDPQTYKCKGFGFVCMTNYDEAVFAIQSLNGYALGDRLLQVSFKTHKPLPPV
****************************LIVNYVPQTMTQEELQHLFSSVGEVESCKLIRDKTTAQSLGYGFVNYYRTEDAERAIIELNGLKLQNKSIKVSYAR****AIKRANLYVSGLPKHMTQEDLENLFRPYGTIITSRILCDKMASENVRSFVSGTPEIPQISKGIGFVRFNQHIEAEHA*****************************ALAANLNAQAAAMRHFAAAMRHFGNPLHHSARFKFAPLTADLLNNSMLPPKSLHGSGWCIFVYNLAPETEDNVLWQLFGPFGAVQNVKVVRDPQTYKCKGFGFVCMTNYDEAVFAIQSLNGYALGDRLLQVSF*********
*****************************IVNYVPQTMTQEELQHLFSSVGEVESCKLIRDKTTAQSLGYGFVNYYRTEDAERAIIELNGLKLQNKSIK****************YVSGLPKHMTQEDLENLFRPYGTIITSRILCDKMASENVRSFVSGTPEIPQISKGIGFVRFNQHIEAEHAMQELNGTIPEGASEPITV*****************************AMRHFGNPLH**************************GSGWCIFVYNLAPETEDNVLWQLFGPFGAVQNVKVVRDPQTYKCKGFGFVCMTNYDEAVFAIQSLNGYALGDRLLQVSF**H******
******************QSDVNEQNSNLIVNYVPQTMTQEELQHLFSSVGEVESCKLIRDKTTAQSLGYGFVNYYRTEDAERAIIELNGLKLQNKSIKVSYARPSSEAIKRANLYVSGLPKHMTQEDLENLFRPYGTIITSRILCDKMASENVRSFVSGTPEIPQISKGIGFVRFNQHIEAEHAMQELNGTIPEGASEPITVKFANSPAGRAKALAANLNAQAAAMRHFAAAMRHFGNPLHHSARFKFAPLTADLLNNSMLPPKSLHGSGWCIFVYNLAPETEDNVLWQLFGPFGAVQNVKVVRDPQTYKCKGFGFVCMTNYDEAVFAIQSLNGYALGDRLLQVSFKTHKPLPPV
*M*HEEMYNTTQS******SDVNEQNSNLIVNYVPQTMTQEELQHLFSSVGEVESCKLIRDKTTAQSLGYGFVNYYRTEDAERAIIELNGLKLQNKSIKVSYARPSSEAIKRANLYVSGLPKHMTQEDLENLFRPYGTIITSRILCDKMASENVRSFVSGTPEIPQISKGIGFVRFNQHIEAEHAMQELNGTIPEGASEPITVKFANSPAGRAKALAANLNAQAAAMRHFAAAMRHFGNPLHHSARFKFAPLTADLLNNSMLPPKSLHGSGWCIFVYNLAPETEDNVLWQLFGPFGAVQNVKVVRDPQTYKCKGFGFVCMTNYDEAVFAIQSLNGYALGDRLLQVSFKTH******
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MMKHEEMYNTTQSHRSTYQSDVNEQNSNLIVNYVPQTMTQEELQHLFSSVGEVESCKLIRDKTTAQSLGYGFVNYYRTEDAERAIIELNGLKLQNKSIKVSYARPSSEAIKRANLYVSGLPKHMTQEDLENLFRPYGTIITSRILCDKMASENVRSFVSGTPEIPQISKGIGFVRFNQHIEAEHAMQELNGTIPEGASEPITVKFANSPAGRAKALAANLNAQAAAMRHFAAAMRHFGNPLHHSARFKFAPLTADLLNNSMLPPKSLHGSGWCIFVYNLAPETEDNVLWQLFGPFGAVQNVKVVRDPQTYKCKGFGFVCMTNYDEAVFAIQSLNGYALGDRLLQVSFKTHKPLPPV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query356 2.2.26 [Sep-21-2011]
Q28FX0343 ELAV-like protein 3 OS=Xe yes N/A 0.856 0.889 0.588 1e-108
Q91584348 ELAV-like protein 3 OS=Xe N/A N/A 0.859 0.879 0.567 1e-105
P26378380 ELAV-like protein 4 OS=Ho no N/A 0.856 0.802 0.534 1e-104
O09032373 ELAV-like protein 4 OS=Ra yes N/A 0.856 0.817 0.534 1e-104
Q61701385 ELAV-like protein 4 OS=Mu no N/A 0.856 0.792 0.534 1e-104
Q28GD4375 ELAV-like protein 2 OS=Xe no N/A 0.867 0.824 0.564 1e-104
Q5R9Z6359 ELAV-like protein 2 OS=Po no N/A 0.865 0.857 0.554 1e-104
Q12926359 ELAV-like protein 2 OS=Ho yes N/A 0.865 0.857 0.554 1e-104
Q60899360 ELAV-like protein 2 OS=Mu no N/A 0.865 0.855 0.553 1e-104
Q8CH84359 ELAV-like protein 2 OS=Ra no N/A 0.865 0.857 0.552 1e-103
>sp|Q28FX0|ELAV3_XENTR ELAV-like protein 3 OS=Xenopus tropicalis GN=elavl3 PE=2 SV=1 Back     alignment and function desciption
 Score =  392 bits (1007), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 196/333 (58%), Positives = 240/333 (72%), Gaps = 28/333 (8%)

Query: 23  NEQNSNLIVNYVPQTMTQEELQHLFSSVGEVESCKLIRDKTTAQSLGYGFVNYYRTEDAE 82
           ++  +NLIVNY+PQ MTQEE + LF S+GE+ESCKL+RDK T QSLGYGFVNY    DA+
Sbjct: 31  DDSKTNLIVNYLPQNMTQEEFKSLFGSIGEIESCKLVRDKITGQSLGYGFVNYVDPNDAD 90

Query: 83  RAIIELNGLKLQNKSIKVSYARPSSEAIKRANLYVSGLPKHMTQEDLENLFRPYGTIITS 142
           +AI  LNGLKLQ K+IKVSYARPSS +I+ ANLYVS LPK M Q+++E LF  YG IITS
Sbjct: 91  KAINTLNGLKLQTKTIKVSYARPSSASIRDANLYVSSLPKTMNQKEMEQLFSQYGRIITS 150

Query: 143 RILCDKMASENVRSFVSGTPEIPQISKGIGFVRFNQHIEAEHAMQELNGTIPEGASEPIT 202
           RIL D+         V+G+     +S+G+GF+RF++ IEAE A++ LNG  P GASEPIT
Sbjct: 151 RILVDQ---------VTGS-----VSRGVGFIRFDKRIEAEEAIKGLNGQKPLGASEPIT 196

Query: 203 VKFANSPAGRAKALAANLNAQAAAMRHFAAAMRHFGNPLHH-SARFKFAPLTADLLNNSM 261
           VKFAN+P+ +          QA     +    R +  PLHH + RF+F+P+T D + N  
Sbjct: 197 VKFANNPSQKT--------GQALLTHLYQTTARRYTGPLHHQTQRFRFSPITIDSVTN-- 246

Query: 262 LPPKSLHG---SGWCIFVYNLAPETEDNVLWQLFGPFGAVQNVKVVRDPQTYKCKGFGFV 318
           L   SL G   +GWCIFVYNL+PE +++VLWQLFGPFGAV NVKV+RD  T KCKGFGFV
Sbjct: 247 LAGVSLTGPTTAGWCIFVYNLSPEADESVLWQLFGPFGAVTNVKVIRDFTTNKCKGFGFV 306

Query: 319 CMTNYDEAVFAIQSLNGYALGDRLLQVSFKTHK 351
            MTNYDEA  AI SLNGY LGDR+LQVSFKT K
Sbjct: 307 TMTNYDEAAMAIASLNGYRLGDRVLQVSFKTSK 339




Binds to AU-rich sequences (AREs) of target mRNAs. May also bind poly-A tracts via RRM 3. May be involved in neuronal differentiation and maintenance.
Xenopus tropicalis (taxid: 8364)
>sp|Q91584|ELAV3_XENLA ELAV-like protein 3 OS=Xenopus laevis GN=elavl3 PE=2 SV=1 Back     alignment and function description
>sp|P26378|ELAV4_HUMAN ELAV-like protein 4 OS=Homo sapiens GN=ELAVL4 PE=1 SV=2 Back     alignment and function description
>sp|O09032|ELAV4_RAT ELAV-like protein 4 OS=Rattus norvegicus GN=Elavl4 PE=1 SV=1 Back     alignment and function description
>sp|Q61701|ELAV4_MOUSE ELAV-like protein 4 OS=Mus musculus GN=Elavl4 PE=1 SV=1 Back     alignment and function description
>sp|Q28GD4|ELAV2_XENTR ELAV-like protein 2 OS=Xenopus tropicalis GN=elavl2 PE=2 SV=2 Back     alignment and function description
>sp|Q5R9Z6|ELAV2_PONAB ELAV-like protein 2 OS=Pongo abelii GN=ELAVL2 PE=2 SV=1 Back     alignment and function description
>sp|Q12926|ELAV2_HUMAN ELAV-like protein 2 OS=Homo sapiens GN=ELAVL2 PE=1 SV=2 Back     alignment and function description
>sp|Q60899|ELAV2_MOUSE ELAV-like protein 2 OS=Mus musculus GN=Elavl2 PE=2 SV=1 Back     alignment and function description
>sp|Q8CH84|ELAV2_RAT ELAV-like protein 2 OS=Rattus norvegicus GN=Elavl2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query356
345493621349 PREDICTED: ELAV-like protein 3-like isof 0.901 0.919 0.704 1e-135
383865034 502 PREDICTED: ELAV-like protein 2-like [Meg 0.901 0.639 0.656 1e-132
380027075362 PREDICTED: ELAV-like protein 2-like [Api 0.901 0.886 0.666 1e-131
345493619383 PREDICTED: ELAV-like protein 3-like isof 0.901 0.838 0.645 1e-130
350425139371 PREDICTED: ELAV-like protein 2-like [Bom 0.901 0.865 0.644 1e-129
340709266 533 PREDICTED: ELAV-like protein 2-like [Bom 0.901 0.602 0.644 1e-129
328700227383 PREDICTED: ELAV-like protein 4-like isof 0.924 0.859 0.668 1e-129
328792242378 PREDICTED: ELAV-like protein 2-like [Api 0.901 0.849 0.637 1e-128
328700229392 PREDICTED: ELAV-like protein 4-like isof 0.926 0.841 0.650 1e-128
270014670350 hypothetical protein TcasGA2_TC004718 [T 0.853 0.868 0.670 1e-127
>gi|345493621|ref|XP_003427111.1| PREDICTED: ELAV-like protein 3-like isoform 3 [Nasonia vitripennis] gi|345493623|ref|XP_001603257.2| PREDICTED: ELAV-like protein 3-like isoform 1 [Nasonia vitripennis] Back     alignment and taxonomy information
 Score =  487 bits (1254), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 238/338 (70%), Positives = 279/338 (82%), Gaps = 17/338 (5%)

Query: 19  QSDVNEQNSNLIVNYVPQTMTQEELQHLFSSVGEVESCKLIRDKTTAQSLGYGFVNYYRT 78
           QS   E  +NLIVNY+PQTMTQEE++ LFSS+GEVESCKLIRDK T QSLGYGFVNY+R 
Sbjct: 20  QSSQEESKTNLIVNYLPQTMTQEEIRSLFSSIGEVESCKLIRDKLTGQSLGYGFVNYHRP 79

Query: 79  EDAERAIIELNGLKLQNKSIKVSYARPSSEAIKRANLYVSGLPKHMTQEDLENLFRPYGT 138
           EDAE+AI  LNGL+LQNK+IKVSYARPSSEAIK ANLYVSGLPK+MTQ+DLENLF PYG 
Sbjct: 80  EDAEKAINTLNGLRLQNKTIKVSYARPSSEAIKGANLYVSGLPKNMTQQDLENLFSPYGR 139

Query: 139 IITSRILCDKMASENVRSFVSGTPE-IPQISKGIGFVRFNQHIEAEHAMQELNGTIPEGA 197
           IITSRILCD +    VR FV+G  + +P +SKG+GF+RF+Q +EAE A+QELNGTIP+G+
Sbjct: 140 IITSRILCDNIT---VRQFVTGGGDNLPGLSKGVGFIRFDQRVEAERAIQELNGTIPKGS 196

Query: 198 SEPITVKFANSPAGRAKA---LAANLNAQAAAMRHFAAAMRHFGNPLHH-SARFKFAPLT 253
           +EPITVKFAN+P+   KA   LAA L  QA          R FG P+HH + RF+++PL 
Sbjct: 197 TEPITVKFANNPSNNNKAIPPLAAYLTPQAT---------RRFGGPIHHPTGRFRYSPLA 247

Query: 254 ADLLNNSMLPPKSLHGSGWCIFVYNLAPETEDNVLWQLFGPFGAVQNVKVVRDPQTYKCK 313
            DLL NSMLP  +++GSGWCIFVYNLAPETE+NVLWQLFGPFGAVQ+VKV+RD QT KCK
Sbjct: 248 GDLLANSMLPGNAMNGSGWCIFVYNLAPETEENVLWQLFGPFGAVQSVKVIRDLQTNKCK 307

Query: 314 GFGFVCMTNYDEAVFAIQSLNGYALGDRLLQVSFKTHK 351
           GFGFV MTNY+EAV AIQSLNGY LG+R+LQVSFKT+K
Sbjct: 308 GFGFVTMTNYEEAVVAIQSLNGYTLGNRVLQVSFKTNK 345




Source: Nasonia vitripennis

Species: Nasonia vitripennis

Genus: Nasonia

Family: Pteromalidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|383865034|ref|XP_003707981.1| PREDICTED: ELAV-like protein 2-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|380027075|ref|XP_003697261.1| PREDICTED: ELAV-like protein 2-like [Apis florea] Back     alignment and taxonomy information
>gi|345493619|ref|XP_003427110.1| PREDICTED: ELAV-like protein 3-like isoform 2 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|350425139|ref|XP_003494024.1| PREDICTED: ELAV-like protein 2-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340709266|ref|XP_003393232.1| PREDICTED: ELAV-like protein 2-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|328700227|ref|XP_001951393.2| PREDICTED: ELAV-like protein 4-like isoform 1 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328792242|ref|XP_394166.4| PREDICTED: ELAV-like protein 2-like [Apis mellifera] Back     alignment and taxonomy information
>gi|328700229|ref|XP_003241188.1| PREDICTED: ELAV-like protein 4-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|270014670|gb|EFA11118.1| hypothetical protein TcasGA2_TC004718 [Tribolium castaneum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query356
FB|FBgn0010263444 Rbp9 "RNA-binding protein 9" [ 0.935 0.75 0.563 2.7e-100
FB|FBgn0086675356 fne "found in neurons" [Drosop 0.879 0.879 0.599 5.6e-100
UNIPROTKB|E2RI94388 ELAVL2 "Uncharacterized protei 0.488 0.448 0.624 1.1e-91
UNIPROTKB|B1AM49387 ELAVL2 "ELAV-like protein 2" [ 0.488 0.449 0.624 1.1e-91
UNIPROTKB|Q12926359 ELAVL2 "ELAV-like protein 2" [ 0.488 0.484 0.624 1.1e-91
UNIPROTKB|B1APY8385 ELAVL4 "ELAV-like protein 4" [ 0.483 0.446 0.620 1.1e-91
UNIPROTKB|P26378380 ELAVL4 "ELAV-like protein 4" [ 0.483 0.452 0.620 1.1e-91
MGI|MGI:107427385 Elavl4 "ELAV (embryonic lethal 0.483 0.446 0.620 1.1e-91
RGD|1560027373 Elavl4 "ELAV (embryonic lethal 0.483 0.461 0.620 1.1e-91
UNIPROTKB|F1LRL1384 Elavl4 "ELAV-like protein 4" [ 0.483 0.447 0.620 1.1e-91
FB|FBgn0010263 Rbp9 "RNA-binding protein 9" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 995 (355.3 bits), Expect = 2.7e-100, P = 2.7e-100
 Identities = 204/362 (56%), Positives = 257/362 (70%)

Query:     9 NTTQSHRSTYQSDVNEQ---NSNLIVNYVPQTMTQEELQHLFSSVGEVESCKLIRDKTTA 65
             N   ++ +T  ++ N +    +NLIVNY+PQTM+Q+E++ LF S GEVESCKLIRDK T 
Sbjct:    89 NNNNNNNATANNNNNNEPDPKTNLIVNYLPQTMSQDEIRSLFVSFGEVESCKLIRDKVTG 148

Query:    66 QSLGYGFVNYYRTEDAERAIIELNGLKLQNKSIKVSYARPSSEAIKRANLYVSGLPKHMT 125
             QSLGYGFVNY + EDAE+AI  LNGL+LQNK+IKVS ARPSSE+IK ANLYVSGLPK+MT
Sbjct:   149 QSLGYGFVNYVKQEDAEKAINALNGLRLQNKTIKVSIARPSSESIKGANLYVSGLPKNMT 208

Query:   126 QEDLENLFRPYGTIITSRILCDKMASENVRSFVSGTPEIPQISKGIGFVRFNQHIEAEHA 185
             Q DLE+LF PYG IITSRILCD +  E+     +G      +SKG+GF+RF+Q  EA+ A
Sbjct:   209 QSDLESLFSPYGKIITSRILCDNITGEHA----AG------LSKGVGFIRFDQRFEADRA 258

Query:   186 MQELNGTIPEGASEPITVKFANSPXXXXXXXXXXXXXXXX----------XXXXXXXXXX 235
             ++ELNGT P+ ++EPITVKFAN+P                                    
Sbjct:   259 IKELNGTTPKNSTEPITVKFANNPSSNKNSMQPLAAYIAPQNTRGGRAFPANAAAGAAAA 318

Query:   236 XXGNPLHHSA-RF-----KFAPLTADLLNNSMLPPKSLHGSGWCIFVYNLAPETEDNVLW 289
                  +H +A R+     +++PLT+DL+ N M+   ++  SGWCIFVYNLAP+TE+NVLW
Sbjct:   319 AAAAAIHPNAGRYSSVISRYSPLTSDLITNGMIQGNTIASSGWCIFVYNLAPDTEENVLW 378

Query:   290 QLFGPFGAVQNVKVVRDPQTYKCKGFGFVCMTNYDEAVFAIQSLNGYALGDRLLQVSFKT 349
             QLFGPFGAVQ+VKV+RD Q+ KCKGFGFV MTNY+EAV AIQSLNGY LG+R+LQVSFKT
Sbjct:   379 QLFGPFGAVQSVKVIRDLQSNKCKGFGFVTMTNYEEAVLAIQSLNGYTLGNRVLQVSFKT 438

Query:   350 HK 351
             +K
Sbjct:   439 NK 440




GO:0003729 "mRNA binding" evidence=ISS;NAS
GO:0003730 "mRNA 3'-UTR binding" evidence=TAS
GO:0007293 "germarium-derived egg chamber formation" evidence=TAS
GO:0005634 "nucleus" evidence=TAS
GO:0003723 "RNA binding" evidence=IEA
GO:0000166 "nucleotide binding" evidence=IEA
GO:0048477 "oogenesis" evidence=IMP
GO:0036093 "germ cell proliferation" evidence=IMP
GO:0060856 "establishment of blood-brain barrier" evidence=IMP
FB|FBgn0086675 fne "found in neurons" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|E2RI94 ELAVL2 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|B1AM49 ELAVL2 "ELAV-like protein 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q12926 ELAVL2 "ELAV-like protein 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|B1APY8 ELAVL4 "ELAV-like protein 4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|P26378 ELAVL4 "ELAV-like protein 4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:107427 Elavl4 "ELAV (embryonic lethal, abnormal vision, Drosophila)-like 4 (Hu antigen D)" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1560027 Elavl4 "ELAV (embryonic lethal, abnormal vision, Drosophila)-like 4" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1LRL1 Elavl4 "ELAV-like protein 4" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q15717ELAV1_HUMANNo assigned EC number0.55450.83980.9171noN/A
Q28FX0ELAV3_XENTRNo assigned EC number0.58850.85670.8892yesN/A
Q60900ELAV3_MOUSENo assigned EC number0.52690.86230.8365noN/A
Q6GLB5ELAV1_XENTRNo assigned EC number0.55180.84550.9233noN/A
Q1JQ73ELV1A_XENLANo assigned EC number0.53980.84550.8931N/AN/A
O09032ELAV4_RATNo assigned EC number0.53460.85670.8176yesN/A
P26378ELAV4_HUMANNo assigned EC number0.53460.85670.8026noN/A
Q12926ELAV2_HUMANNo assigned EC number0.55490.86510.8579yesN/A
Q60899ELAV2_MOUSENo assigned EC number0.55330.86510.8555noN/A
Q5U259ELV1B_XENLANo assigned EC number0.55480.84550.9233N/AN/A
Q28GD4ELAV2_XENTRNo assigned EC number0.56410.86790.824noN/A
Q91584ELAV3_XENLANo assigned EC number0.56720.85950.8793N/AN/A
Q5R9Z6ELAV2_PONABNo assigned EC number0.55490.86510.8579noN/A
Q8CH84ELAV2_RATNo assigned EC number0.55200.86510.8579noN/A
P70372ELAV1_MOUSENo assigned EC number0.55480.84550.9233noN/A
Q14576ELAV3_HUMANNo assigned EC number0.52840.85950.8337noN/A
Q91903ELAV2_XENLANo assigned EC number0.53250.92130.8431N/AN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query356
TIGR01661352 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing f 1e-157
TIGR01659346 TIGR01659, sex-lethal, sex-lethal family splicing 2e-53
cd1237778 cd12377, RRM3_Hu, RNA recognition motif 3 in the H 2e-50
cd1265078 cd12650, RRM1_Hu, RNA recognition motif 1 in the H 2e-46
cd1265686 cd12656, RRM3_HuD, RNA recognition motif 3 in vert 9e-45
cd1265486 cd12654, RRM3_HuB, RNA recognition motif 3 in vert 2e-44
cd1265585 cd12655, RRM3_HuC, RNA recognition motif 3 in vert 1e-42
cd1265279 cd12652, RRM2_Hu, RNA recognition motif 2 in the H 3e-42
cd1265384 cd12653, RRM3_HuR, RNA recognition motif 3 in vert 4e-40
cd1277183 cd12771, RRM1_HuB, RNA recognition motif 1 in vert 1e-36
cd1277083 cd12770, RRM1_HuD, RNA recognition motif 1 in vert 2e-36
cd1237577 cd12375, RRM1_Hu_like, RNA recognition motif 1 in 1e-35
cd1277284 cd12772, RRM1_HuC, RNA recognition motif 1 in vert 1e-35
cd1264981 cd12649, RRM1_SXL, RNA recognition motif 1 in Dros 2e-35
cd1276981 cd12769, RRM1_HuR, RNA recognition motif 1 in vert 4e-35
TIGR01628 562 TIGR01628, PABP-1234, polyadenylate binding protei 1e-31
cd1277590 cd12775, RRM2_HuB, RNA recognition motif 2 in vert 5e-30
cd1237679 cd12376, RRM2_Hu_like, RNA recognition motif 2 in 3e-29
cd1277681 cd12776, RRM2_HuC, RNA recognition motif 2 in vert 2e-28
cd1277481 cd12774, RRM2_HuD, RNA recognition motif 2 in vert 9e-28
TIGR01628 562 TIGR01628, PABP-1234, polyadenylate binding protei 3e-27
cd1277384 cd12773, RRM2_HuR, RNA recognition motif 2 in vert 1e-25
TIGR01628562 TIGR01628, PABP-1234, polyadenylate binding protei 8e-23
smart0036073 smart00360, RRM, RNA recognition motif 4e-21
smart0036073 smart00360, RRM, RNA recognition motif 3e-20
cd1224479 cd12244, RRM2_MSSP, RNA recognition motif 2 in the 1e-19
cd1265179 cd12651, RRM2_SXL, RNA recognition motif 2 in Dros 3e-19
TIGR01622457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 9e-19
cd1238280 cd12382, RRM_RBMX_like, RNA recognition motif in h 5e-18
cd1235375 cd12353, RRM2_TIA1_like, RNA recognition motif 2 i 6e-18
COG0724306 COG0724, COG0724, RNA-binding proteins (RRM domain 1e-17
cd1239978 cd12399, RRM_HP0827_like, RNA recognition motif in 2e-17
cd1241379 cd12413, RRM1_RBM28_like, RNA recognition motif 1 2e-17
pfam0007670 pfam00076, RRM_1, RNA recognition motif 7e-17
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 7e-17
cd1228473 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 9e-17
cd1239978 cd12399, RRM_HP0827_like, RNA recognition motif in 1e-16
cd1236273 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in 1e-16
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 3e-16
cd1239573 cd12395, RRM2_RBM34, RNA recognition motif 2 in RN 3e-16
pfam0007670 pfam00076, RRM_1, RNA recognition motif 5e-16
cd1236273 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in 1e-15
cd1236378 cd12363, RRM_TRA2, RNA recognition motif in transf 3e-15
smart0036073 smart00360, RRM, RNA recognition motif 5e-15
cd1240877 cd12408, RRM_eIF3G_like, RNA recognition motif in 5e-15
cd1265279 cd12652, RRM2_Hu, RNA recognition motif 2 in the H 1e-14
cd1236177 cd12361, RRM1_2_CELF1-6_like, RNA recognition moti 2e-14
pfam0007670 pfam00076, RRM_1, RNA recognition motif 4e-14
cd1233583 cd12335, RRM2_SF3B4, RNA recognition motif 2 in sp 4e-14
cd1238080 cd12380, RRM3_I_PABPs, RNA recognition motif 3 fou 4e-14
cd0059072 cd00590, RRM_SF, RNA recognition motif (RRM) super 5e-14
cd1238280 cd12382, RRM_RBMX_like, RNA recognition motif in h 7e-14
cd1236177 cd12361, RRM1_2_CELF1-6_like, RNA recognition moti 1e-13
cd1238080 cd12380, RRM3_I_PABPs, RNA recognition motif 3 fou 1e-13
cd1237880 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in 1e-13
cd1238977 cd12389, RRM2_RAVER, RNA recognition motif 2 in ri 1e-13
cd1237778 cd12377, RRM3_Hu, RNA recognition motif 3 in the H 2e-13
COG0724 306 COG0724, COG0724, RNA-binding proteins (RRM domain 2e-13
cd1241379 cd12413, RRM1_RBM28_like, RNA recognition motif 1 2e-13
cd1236378 cd12363, RRM_TRA2, RNA recognition motif in transf 2e-13
cd1224371 cd12243, RRM1_MSSP, RNA recognition motif 1 in the 2e-13
cd1267479 cd12674, RRM1_Nop4p, RNA recognition motif 1 in ye 2e-13
cd1235473 cd12354, RRM3_TIA1_like, RNA recognition motif 2 i 3e-13
cd1224371 cd12243, RRM1_MSSP, RNA recognition motif 1 in the 4e-13
cd1228473 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 6e-13
cd1240877 cd12408, RRM_eIF3G_like, RNA recognition motif in 8e-13
cd1237679 cd12376, RRM2_Hu_like, RNA recognition motif 2 in 1e-12
cd1239978 cd12399, RRM_HP0827_like, RNA recognition motif in 1e-12
cd1239875 cd12398, RRM_CSTF2_RNA15_like, RNA recognition mot 1e-12
COG0724306 COG0724, COG0724, RNA-binding proteins (RRM domain 2e-12
cd1238383 cd12383, RRM_RBM42, RNA recognition motif in RNA-b 2e-12
cd1235375 cd12353, RRM2_TIA1_like, RNA recognition motif 2 i 3e-12
cd1236681 cd12366, RRM1_RBM45, RNA recognition motif 1 in RN 3e-12
cd1235272 cd12352, RRM1_TIA1_like, RNA recognition motif 1 i 3e-12
cd1238179 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in 3e-12
cd1241189 cd12411, RRM_ist3_like, RNA recognition motif in i 3e-12
cd1261975 cd12619, RRM2_PUB1, RNA recognition motif 2 in yea 4e-12
cd1223583 cd12235, RRM_PPIL4, RNA recognition motif in pepti 4e-12
cd1244980 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in 4e-12
cd1236273 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in 5e-12
cd1238179 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in 5e-12
cd1237977 cd12379, RRM2_I_PABPs, RNA recognition motif 2 fou 5e-12
cd1264079 cd12640, RRM3_Bruno_like, RNA recognition motif 3 5e-12
cd1239875 cd12398, RRM_CSTF2_RNA15_like, RNA recognition mot 6e-12
cd1263979 cd12639, RRM3_CELF3_4_5_6, RNA recognition motif 2 9e-12
cd1263892 cd12638, RRM3_CELF1_2, RNA recognition motif 3 in 9e-12
cd1277481 cd12774, RRM2_HuD, RNA recognition motif 2 in vert 2e-11
cd1238280 cd12382, RRM_RBMX_like, RNA recognition motif in h 2e-11
cd1225172 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 2e-11
cd1261380 cd12613, RRM2_NGR1_NAM8_like, RNA recognition moti 2e-11
cd1234580 cd12345, RRM2_SECp43_like, RNA recognition motif 2 3e-11
cd1235473 cd12354, RRM3_TIA1_like, RNA recognition motif 2 i 4e-11
cd1263581 cd12635, RRM2_CELF3_4_5_6, RNA recognition motif 2 4e-11
cd1247385 cd12473, RRM2_MSSP1, RNA recognition motif 2 found 5e-11
cd1238179 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in 6e-11
cd1261880 cd12618, RRM2_TIA1, RNA recognition motif 2 in nuc 6e-11
cd1277590 cd12775, RRM2_HuB, RNA recognition motif 2 in vert 7e-11
cd1247588 cd12475, RRM2_RBMS3, RNA recognition motif 2 found 8e-11
cd1261474 cd12614, RRM1_PUB1, RNA recognition motif 1 in yea 9e-11
cd1237577 cd12375, RRM1_Hu_like, RNA recognition motif 1 in 1e-10
cd1265179 cd12651, RRM2_SXL, RNA recognition motif 2 in Dros 1e-10
cd1234773 cd12347, RRM_PPIE, RNA recognition motif in cyclop 1e-10
cd1256576 cd12565, RRM1_MRD1, RNA recognition motif 1 in yea 1e-10
cd1237177 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U 1e-10
cd1223793 cd12237, RRM_snRNP35, RNA recognition motif found 1e-10
cd1236774 cd12367, RRM2_RBM45, RNA recognition motif 2 in RN 1e-10
cd1233474 cd12334, RRM1_SF3B4, RNA recognition motif 1 in sp 1e-10
cd1234481 cd12344, RRM1_SECp43_like, RNA recognition motif 1 1e-10
TIGR01622 457 TIGR01622, SF-CC1, splicing factor, CC1-like famil 2e-10
cd1225172 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 2e-10
cd1241280 cd12412, RRM_DAZL_BOULE, RNA recognition motif in 2e-10
cd1235580 cd12355, RRM_RBM18, RNA recognition motif in eukar 2e-10
cd1247486 cd12474, RRM2_MSSP2, RNA recognition motif 2 found 2e-10
cd1239092 cd12390, RRM3_RAVER, RNA recognition motif 3 in ri 2e-10
cd1267079 cd12670, RRM2_Nop12p_like, RNA recognition motif 2 2e-10
cd1267175 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif i 2e-10
cd1264981 cd12649, RRM1_SXL, RNA recognition motif 1 in Dros 3e-10
cd1277681 cd12776, RRM2_HuC, RNA recognition motif 2 in vert 3e-10
cd1231674 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition mot 3e-10
cd1233675 cd12336, RRM_RBM7_like, RNA recognition motif in R 3e-10
cd1266577 cd12665, RRM2_RAVER1, RNA recognition motif 2 foun 3e-10
cd1261780 cd12617, RRM2_TIAR, RNA recognition motif 2 in nuc 3e-10
cd1261780 cd12617, RRM2_TIAR, RNA recognition motif 2 in nuc 4e-10
cd1238476 cd12384, RRM_RBM24_RBM38_like, RNA recognition mot 4e-10
cd1267479 cd12674, RRM1_Nop4p, RNA recognition motif 1 in ye 5e-10
cd1241582 cd12415, RRM3_RBM28_like, RNA recognition motif 3 5e-10
cd1231384 cd12313, RRM1_RRM2_RBM5_like, RNA recognition moti 5e-10
cd1256679 cd12566, RRM2_MRD1, RNA recognition motif 2 in yea 5e-10
cd1231173 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in 6e-10
cd1266677 cd12666, RRM2_RAVER2, RNA recognition motif 2 in v 6e-10
cd1234672 cd12346, RRM3_NGR1_NAM8_like, RNA recognition moti 6e-10
cd1235473 cd12354, RRM3_TIA1_like, RNA recognition motif 2 i 7e-10
cd1231882 cd12318, RRM5_RBM19_like, RNA recognition motif 5 8e-10
cd1263380 cd12633, RRM1_FCA, RNA recognition motif 1 in plan 8e-10
cd1238977 cd12389, RRM2_RAVER, RNA recognition motif 2 in ri 9e-10
cd1244776 cd12447, RRM1_gar2, RNA recognition motif 1 in yea 9e-10
cd1233583 cd12335, RRM2_SF3B4, RNA recognition motif 2 in sp 1e-09
cd1224371 cd12243, RRM1_MSSP, RNA recognition motif 1 in the 1e-09
cd1236681 cd12366, RRM1_RBM45, RNA recognition motif 1 in RN 1e-09
cd1223177 cd12231, RRM2_U2AF65, RNA recognition motif 2 foun 1e-09
cd1232488 cd12324, RRM_RBM8, RNA recognition motif in RNA-bi 1e-09
cd1233271 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 1e-09
cd1222777 cd12227, RRM_SCAF4_SCAF8, RNA recognition motif in 1e-09
PLN03134144 PLN03134, PLN03134, glycine-rich RNA-binding prote 1e-09
cd1230575 cd12305, RRM_NELFE, RNA recognition motif in negat 1e-09
cd1239573 cd12395, RRM2_RBM34, RNA recognition motif 2 in RN 2e-09
cd1263979 cd12639, RRM3_CELF3_4_5_6, RNA recognition motif 2 2e-09
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 2e-09
cd1239281 cd12392, RRM2_SART3, RNA recognition motif 2 in sq 2e-09
cd1223691 cd12236, RRM_snRNP70, RNA recognition motif in U1 2e-09
cd1234580 cd12345, RRM2_SECp43_like, RNA recognition motif 2 3e-09
cd1233474 cd12334, RRM1_SF3B4, RNA recognition motif 1 in sp 3e-09
cd1233271 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 3e-09
cd1241476 cd12414, RRM2_RBM28_like, RNA recognition motif 2 3e-09
cd1245480 cd12454, RRM2_RIM4_like, RNA recognition motif 2 i 3e-09
cd1241875 cd12418, RRM_Aly_REF_like, RNA recognition motif i 3e-09
cd1238080 cd12380, RRM3_I_PABPs, RNA recognition motif 3 fou 4e-09
cd1264079 cd12640, RRM3_Bruno_like, RNA recognition motif 3 4e-09
cd1238476 cd12384, RRM_RBM24_RBM38_like, RNA recognition mot 4e-09
cd1241476 cd12414, RRM2_RBM28_like, RNA recognition motif 2 4e-09
cd1234366 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 5e-09
cd1231577 cd12315, RRM1_RBM19_MRD1, RNA recognition motif 1 6e-09
cd1241582 cd12415, RRM3_RBM28_like, RNA recognition motif 3 7e-09
cd1232488 cd12324, RRM_RBM8, RNA recognition motif in RNA-bi 7e-09
pfam1389356 pfam13893, RRM_5, RNA recognition motif 7e-09
cd1261084 cd12610, RRM1_SECp43, RNA recognition motif 1 in t 7e-09
cd1265078 cd12650, RRM1_Hu, RNA recognition motif 1 in the H 8e-09
cd1244980 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in 9e-09
cd1263892 cd12638, RRM3_CELF1_2, RNA recognition motif 3 in 9e-09
cd1239281 cd12392, RRM2_SART3, RNA recognition motif 2 in sq 9e-09
cd1277384 cd12773, RRM2_HuR, RNA recognition motif 2 in vert 1e-08
cd1261880 cd12618, RRM2_TIA1, RNA recognition motif 2 in nuc 1e-08
cd1267175 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif i 1e-08
cd1231674 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition mot 1e-08
cd1256679 cd12566, RRM2_MRD1, RNA recognition motif 2 in yea 1e-08
cd1239378 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc 1e-08
cd1247086 cd12470, RRM1_MSSP1, RNA recognition motif 1 in ve 1e-08
cd1237577 cd12375, RRM1_Hu_like, RNA recognition motif 1 in 2e-08
cd1233271 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 2e-08
PLN03134144 PLN03134, PLN03134, glycine-rich RNA-binding prote 2e-08
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 2e-08
cd1224078 cd12240, RRM_NCBP2, RNA recognition motif found in 2e-08
cd1255277 cd12552, RRM_Nop15p, RNA recognition motif in yeas 2e-08
cd1261681 cd12616, RRM1_TIAR, RNA recognition motif 1 in nuc 2e-08
cd1263780 cd12637, RRM2_FCA, RNA recognition motif 2 in plan 2e-08
cd1244873 cd12448, RRM2_gar2, RNA recognition motif 2 in yea 2e-08
cd1235976 cd12359, RRM2_VICKZ, RNA recognition motif 2 in th 2e-08
cd1237880 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in 3e-08
cd1231882 cd12318, RRM5_RBM19_like, RNA recognition motif 5 3e-08
cd1256476 cd12564, RRM1_RBM19, RNA recognition motif 1 in RN 3e-08
cd1232177 cd12321, RRM1_TDP43, RNA recognition motif 1 in TA 4e-08
cd1228373 cd12283, RRM1_RBM39_like, RNA recognition motif 1 4e-08
cd1236573 cd12365, RRM_RNPS1, RNA recognition motif in RNA-b 4e-08
cd1264279 cd12642, RRM_TRA2A, RNA recognition motif in trans 4e-08
cd1237977 cd12379, RRM2_I_PABPs, RNA recognition motif 2 fou 5e-08
cd1255277 cd12552, RRM_Nop15p, RNA recognition motif in yeas 5e-08
cd1237373 cd12373, RRM_SRSF3_like, RNA recognition motif in 5e-08
cd1236177 cd12361, RRM1_2_CELF1-6_like, RNA recognition moti 6e-08
cd1237177 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U 6e-08
cd1239378 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc 6e-08
cd1238383 cd12383, RRM_RBM42, RNA recognition motif in RNA-b 7e-08
cd1236681 cd12366, RRM1_RBM45, RNA recognition motif 1 in RN 7e-08
cd1261380 cd12613, RRM2_NGR1_NAM8_like, RNA recognition moti 7e-08
cd1244776 cd12447, RRM1_gar2, RNA recognition motif 1 in yea 7e-08
cd1234366 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 7e-08
cd1222384 cd12223, RRM_SR140, RNA recognition motif (RRM) in 7e-08
cd1223370 cd12233, RRM_Srp1p_AtRSp31_like, RNA recognition m 7e-08
cd1265078 cd12650, RRM1_Hu, RNA recognition motif 1 in the H 8e-08
cd1228473 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 9e-08
cd1237076 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U 9e-08
cd1234481 cd12344, RRM1_SECp43_like, RNA recognition motif 1 1e-07
cd1231674 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition mot 1e-07
cd1223177 cd12231, RRM2_U2AF65, RNA recognition motif 2 foun 1e-07
cd1236875 cd12368, RRM3_RBM45, RNA recognition motif 3 in RN 1e-07
cd1234067 cd12340, RBD_RRM1_NPL3, RNA recognition motif 1 in 1e-07
cd1233075 cd12330, RRM2_Hrp1p, RNA recognition motif 2 in ye 1e-07
cd1257878 cd12578, RRM1_hnRNPA_like, RNA recognition motif 1 1e-07
cd1239773 cd12397, RRM2_Nop13p_fungi, RNA recognition motif 1e-07
cd1265585 cd12655, RRM3_HuC, RNA recognition motif 3 in vert 2e-07
cd1265384 cd12653, RRM3_HuR, RNA recognition motif 3 in vert 2e-07
cd1237977 cd12379, RRM2_I_PABPs, RNA recognition motif 2 fou 2e-07
cd1264079 cd12640, RRM3_Bruno_like, RNA recognition motif 3 2e-07
cd1234672 cd12346, RRM3_NGR1_NAM8_like, RNA recognition moti 2e-07
cd1233075 cd12330, RRM2_Hrp1p, RNA recognition motif 2 in ye 2e-07
cd1256181 cd12561, RRM1_RBM5_like, RNA recognition motif 1 i 2e-07
cd1229878 cd12298, RRM3_Prp24, RNA recognition motif 3 in fu 2e-07
cd1264189 cd12641, RRM_TRA2B, RNA recognition motif in Trans 2e-07
cd1233971 cd12339, RRM2_SRSF1_4_like, RNA recognition motif 2e-07
cd1263979 cd12639, RRM3_CELF3_4_5_6, RNA recognition motif 2 3e-07
cd1239092 cd12390, RRM3_RAVER, RNA recognition motif 3 in ri 3e-07
cd1222384 cd12223, RRM_SR140, RNA recognition motif (RRM) in 3e-07
cd1262491 cd12624, RRM_PRC, RNA recognition motif in peroxis 3e-07
cd1256779 cd12567, RRM3_RBM19, RNA recognition motif 3 in RN 3e-07
cd1237880 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in 4e-07
cd1241189 cd12411, RRM_ist3_like, RNA recognition motif in i 4e-07
cd1261975 cd12619, RRM2_PUB1, RNA recognition motif 2 in yea 4e-07
cd1263892 cd12638, RRM3_CELF1_2, RNA recognition motif 3 in 4e-07
cd1245480 cd12454, RRM2_RIM4_like, RNA recognition motif 2 i 4e-07
cd1222384 cd12223, RRM_SR140, RNA recognition motif (RRM) in 4e-07
cd1240176 cd12401, RRM_eIF4H, RNA recognition motif in eukar 4e-07
cd1263287 cd12632, RRM1_CELF3_4_5_6, RNA recognition motif 1 4e-07
cd1260869 cd12608, RRM1_CoAA, RNA recognition motif 1 in ver 4e-07
cd1235375 cd12353, RRM2_TIA1_like, RNA recognition motif 2 i 5e-07
cd1244684 cd12446, RRM_RBM25, RNA recognition motif in eukar 5e-07
cd1238772 cd12387, RRM3_hnRNPM_like, RNA recognition motif 3 5e-07
cd1265686 cd12656, RRM3_HuD, RNA recognition motif 3 in vert 6e-07
cd1264981 cd12649, RRM1_SXL, RNA recognition motif 1 in Dros 6e-07
cd1257980 cd12579, RRM2_hnRNPA0, RNA recognition motif 2 in 6e-07
cd1241379 cd12413, RRM1_RBM28_like, RNA recognition motif 1 7e-07
cd1240776 cd12407, RRM_FOX1_like, RNA recognition motif in v 7e-07
cd1261574 cd12615, RRM1_TIA1, RNA recognition motif 1 in nuc 7e-07
cd1232572 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition 7e-07
cd1232975 cd12329, RRM2_hnRNPD_like, RNA recognition motif 2 7e-07
cd1230774 cd12307, RRM_NIFK_like, RNA recognition motif in n 7e-07
cd1234067 cd12340, RBD_RRM1_NPL3, RNA recognition motif 1 in 8e-07
cd1261282 cd12612, RRM2_SECp43, RNA recognition motif 2 in t 8e-07
cd1247280 cd12472, RRM1_RBMS3, RNA recognition motif 1 found 8e-07
cd1232572 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition 9e-07
cd1265486 cd12654, RRM3_HuB, RNA recognition motif 3 in vert 1e-06
cd1265279 cd12652, RRM2_Hu, RNA recognition motif 2 in the H 1e-06
cd1234773 cd12347, RRM_PPIE, RNA recognition motif in cyclop 1e-06
cd1264279 cd12642, RRM_TRA2A, RNA recognition motif in trans 1e-06
cd1238674 cd12386, RRM2_hnRNPM_like, RNA recognition motif 2 1e-06
cd1232374 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA- 1e-06
cd1276381 cd12763, RRM1_hnRNPA3, RNA recognition motif 1 in 1e-06
cd1235272 cd12352, RRM1_TIA1_like, RNA recognition motif 1 i 2e-06
cd1244980 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in 2e-06
pfam1425969 pfam14259, RRM_6, RNA recognition motif (a 2e-06
pfam1389356 pfam13893, RRM_5, RNA recognition motif 2e-06
cd1228373 cd12283, RRM1_RBM39_like, RNA recognition motif 1 2e-06
cd1229878 cd12298, RRM3_Prp24, RNA recognition motif 3 in fu 2e-06
cd1264189 cd12641, RRM_TRA2B, RNA recognition motif in Trans 2e-06
cd1240776 cd12407, RRM_FOX1_like, RNA recognition motif in v 2e-06
TIGR01642509 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, la 2e-06
cd1232873 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 2e-06
cd1249572 cd12495, RRM3_hnRNPQ, RNA recognition motif 3 in v 2e-06
cd1262174 cd12621, RRM3_TIA1, RNA recognition motif 3 in nuc 2e-06
cd1239378 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc 3e-06
cd1263287 cd12632, RRM1_CELF3_4_5_6, RNA recognition motif 1 3e-06
cd1230774 cd12307, RRM_NIFK_like, RNA recognition motif in n 3e-06
cd1260667 cd12606, RRM1_RBM4, RNA recognition motif 1 in ver 3e-06
cd1230673 cd12306, RRM_II_PABPs, RNA recognition motif in ty 3e-06
cd1260968 cd12609, RRM2_CoAA, RNA recognition motif 2 in ver 3e-06
cd1276981 cd12769, RRM1_HuR, RNA recognition motif 1 in vert 4e-06
TIGR01628 562 TIGR01628, PABP-1234, polyadenylate binding protei 4e-06
cd1238977 cd12389, RRM2_RAVER, RNA recognition motif 2 in ri 4e-06
cd1259375 cd12593, RRM_RBM11, RNA recognition motif in verte 4e-06
cd1263184 cd12631, RRM1_CELF1_2_Bruno, RNA recognition motif 4e-06
cd1235789 cd12357, RRM_PPARGC1A_like, RNA recognition motif 4e-06
cd12676107 cd12676, RRM3_Nop4p, RNA recognition motif 3 in ye 4e-06
cd1224273 cd12242, RRM_SLIRP, RNA recognition motif found in 4e-06
cd1257179 cd12571, RRM6_RBM19, RNA recognition motif 6 in RN 4e-06
cd1231072 cd12310, RRM3_Spen, RNA recognition motif 3 in the 4e-06
cd1249774 cd12497, RRM3_RBM47, RNA recognition motif 3 in ve 4e-06
cd1277284 cd12772, RRM1_HuC, RNA recognition motif 1 in vert 5e-06
cd1234580 cd12345, RRM2_SECp43_like, RNA recognition motif 2 5e-06
cd1241280 cd12412, RRM_DAZL_BOULE, RNA recognition motif in 5e-06
cd1244873 cd12448, RRM2_gar2, RNA recognition motif 2 in yea 5e-06
cd1240776 cd12407, RRM_FOX1_like, RNA recognition motif in v 5e-06
cd1249472 cd12494, RRM3_hnRNPR, RNA recognition motif 3 in v 5e-06
cd1257482 cd12574, RRM1_DAZAP1, RNA recognition motif 1 in D 5e-06
cd1267381 cd12673, RRM_BOULE, RNA recognition motif in prote 5e-06
TIGR01628 562 TIGR01628, PABP-1234, polyadenylate binding protei 6e-06
cd1224479 cd12244, RRM2_MSSP, RNA recognition motif 2 in the 6e-06
cd1231173 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in 6e-06
cd1231173 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in 6e-06
cd1241698 cd12416, RRM4_RBM28_like, RNA recognition motif 4 6e-06
cd1277183 cd12771, RRM1_HuB, RNA recognition motif 1 in vert 7e-06
cd1277183 cd12771, RRM1_HuB, RNA recognition motif 1 in vert 7e-06
cd1240877 cd12408, RRM_eIF3G_like, RNA recognition motif in 7e-06
cd1232873 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 7e-06
cd1223289 cd12232, RRM3_U2AF65, RNA recognition motif 3 foun 7e-06
TIGR01645 612 TIGR01645, half-pint, poly-U binding splicing fact 7e-06
cd1238476 cd12384, RRM_RBM24_RBM38_like, RNA recognition mot 8e-06
cd1263780 cd12637, RRM2_FCA, RNA recognition motif 2 in plan 8e-06
cd1252477 cd12524, RRM1_MEI2_like, RNA recognition motif 1 i 8e-06
cd1242079 cd12420, RRM_RBPMS_like, RNA recognition motif in 8e-06
cd1258671 cd12586, RRM1_PSP1, RNA recognition motif 1 in ver 8e-06
cd1257776 cd12577, RRM1_Hrp1p, RNA recognition motif 1 in ye 9e-06
cd1233770 cd12337, RRM1_SRSF4_like, RNA recognition motif 1 9e-06
cd1241280 cd12412, RRM_DAZL_BOULE, RNA recognition motif in 1e-05
cd1247086 cd12470, RRM1_MSSP1, RNA recognition motif 1 in ve 1e-05
cd1237373 cd12373, RRM_SRSF3_like, RNA recognition motif in 1e-05
cd1256779 cd12567, RRM3_RBM19, RNA recognition motif 3 in RN 1e-05
cd1238772 cd12387, RRM3_hnRNPM_like, RNA recognition motif 3 1e-05
cd1247280 cd12472, RRM1_RBMS3, RNA recognition motif 1 found 1e-05
TIGR01645 612 TIGR01645, half-pint, poly-U binding splicing fact 1e-05
cd1252477 cd12524, RRM1_MEI2_like, RNA recognition motif 1 i 1e-05
cd1222678 cd12226, RRM_NOL8, RNA recognition motif in nucleo 1e-05
cd1222678 cd12226, RRM_NOL8, RNA recognition motif in nucleo 1e-05
cd1234168 cd12341, RRM_hnRNPC_like, RNA recognition motif in 1e-05
cd1263681 cd12636, RRM2_Bruno_like, RNA recognition motif 2 1e-05
cd1232679 cd12326, RRM1_hnRNPA0, RNA recognition motif 1 fou 1e-05
cd1232076 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition mot 1e-05
cd1277083 cd12770, RRM1_HuD, RNA recognition motif 1 in vert 2e-05
cd1223583 cd12235, RRM_PPIL4, RNA recognition motif in pepti 2e-05
cd1247385 cd12473, RRM2_MSSP1, RNA recognition motif 2 found 2e-05
cd1261474 cd12614, RRM1_PUB1, RNA recognition motif 1 in yea 2e-05
cd1234481 cd12344, RRM1_SECp43_like, RNA recognition motif 1 2e-05
cd1231384 cd12313, RRM1_RRM2_RBM5_like, RNA recognition moti 2e-05
cd1234672 cd12346, RRM3_NGR1_NAM8_like, RNA recognition moti 2e-05
cd1244776 cd12447, RRM1_gar2, RNA recognition motif 1 in yea 2e-05
cd1241875 cd12418, RRM_Aly_REF_like, RNA recognition motif i 2e-05
cd1247086 cd12470, RRM1_MSSP1, RNA recognition motif 1 in ve 2e-05
cd1233075 cd12330, RRM2_Hrp1p, RNA recognition motif 2 in ye 2e-05
cd1258671 cd12586, RRM1_PSP1, RNA recognition motif 1 in ver 2e-05
cd1227272 cd12272, RRM2_PHIP1, RNA recognition motif 2 in Ar 2e-05
cd1241774 cd12417, RRM_SAFB_like, RNA recognition motif in t 2e-05
cd1231284 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif 2e-05
cd1247175 cd12471, RRM1_MSSP2, RNA recognition motif 1 in ve 2e-05
cd1247175 cd12471, RRM1_MSSP2, RNA recognition motif 1 in ve 2e-05
cd1224177 cd12241, RRM_SF3B14, RNA recognition motif found i 2e-05
cd1227671 cd12276, RRM2_MEI2_EAR1_like, RNA recognition moti 2e-05
cd1275674 cd12756, RRM1_hnRNPD, RNA recognition motif 1 in h 2e-05
cd1240984 cd12409, RRM1_RRT5, RNA recognition motif 1 in yea 2e-05
cd1262073 cd12620, RRM3_TIAR, RNA recognition motif 3 in nuc 2e-05
cd1277083 cd12770, RRM1_HuD, RNA recognition motif 1 in vert 3e-05
cd1263581 cd12635, RRM2_CELF3_4_5_6, RNA recognition motif 2 3e-05
cd1223793 cd12237, RRM_snRNP35, RNA recognition motif found 3e-05
cd1247486 cd12474, RRM2_MSSP2, RNA recognition motif 2 found 3e-05
cd1224078 cd12240, RRM_NCBP2, RNA recognition motif found in 3e-05
cd1232177 cd12321, RRM1_TDP43, RNA recognition motif 1 in TA 3e-05
cd1260869 cd12608, RRM1_CoAA, RNA recognition motif 1 in ver 3e-05
cd1260968 cd12609, RRM2_CoAA, RNA recognition motif 2 in ver 3e-05
TIGR01645 612 TIGR01645, half-pint, poly-U binding splicing fact 3e-05
cd1257776 cd12577, RRM1_Hrp1p, RNA recognition motif 1 in ye 3e-05
cd1224177 cd12241, RRM_SF3B14, RNA recognition motif found i 3e-05
cd1226777 cd12267, RRM_YRA1_MLO3, RNA recognition motif in y 3e-05
cd1275977 cd12759, RRM1_MSI1, RNA recognition motif 1 in RNA 3e-05
cd1248578 cd12485, RRM1_RBM47, RNA recognition motif 1 found 3e-05
cd1252279 cd12522, RRM4_MRN1, RNA recognition motif 4 of RNA 3e-05
cd1226282 cd12262, RRM2_4_MRN1, RNA recognition motif 2 and 3e-05
cd1263076 cd12630, RRM2_IGF2BP3, RNA recognition motif 2 in 3e-05
cd1257675 cd12576, RRM1_MSI, RNA recognition motif 1 in RNA- 3e-05
cd1267583 cd12675, RRM2_Nop4p, RNA recognition motif 2 in ye 3e-05
cd1257274 cd12572, RRM2_MSI1, RNA recognition motif 2 in RNA 3e-05
cd1241582 cd12415, RRM3_RBM28_like, RNA recognition motif 3 4e-05
cd1247280 cd12472, RRM1_RBMS3, RNA recognition motif 1 found 4e-05
TIGR01645612 TIGR01645, half-pint, poly-U binding splicing fact 4e-05
cd1249883 cd12498, RRM3_ACF, RNA recognition motif 3 in vert 4e-05
cd1276181 cd12761, RRM1_hnRNPA1, RNA recognition motif 1 in 4e-05
cd1277284 cd12772, RRM1_HuC, RNA recognition motif 1 in vert 5e-05
cd1276981 cd12769, RRM1_HuR, RNA recognition motif 1 in vert 5e-05
cd1263780 cd12637, RRM2_FCA, RNA recognition motif 2 in plan 5e-05
cd1257675 cd12576, RRM1_MSI, RNA recognition motif 1 in RNA- 5e-05
cd1227371 cd12273, RRM1_NEFsp, RNA recognition motif 1 in ve 5e-05
cd1247175 cd12471, RRM1_MSSP2, RNA recognition motif 1 in ve 6e-05
cd1252971 cd12529, RRM2_MEI2_like, RNA recognition motif 2 i 6e-05
cd1263481 cd12634, RRM2_CELF1_2, RNA recognition motif 2 in 6e-05
cd1225172 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 7e-05
cd1243180 cd12431, RRM_ALKBH8, RNA recognition motif in alky 7e-05
cd1258575 cd12585, RRM2_hnRPDL, RNA recognition motif 2 in h 7e-05
cd1265179 cd12651, RRM2_SXL, RNA recognition motif 2 in Dros 8e-05
cd1261282 cd12612, RRM2_SECp43, RNA recognition motif 2 in t 8e-05
cd1258871 cd12588, RRM1_p54nrb, RNA recognition motif 1 in v 8e-05
cd1224978 cd12249, RRM1_hnRNPR_like, RNA recognition motif 1 8e-05
cd1262876 cd12628, RRM2_IGF2BP1, RNA recognition motif 2 in 9e-05
cd1267479 cd12674, RRM1_Nop4p, RNA recognition motif 1 in ye 1e-04
cd1231882 cd12318, RRM5_RBM19_like, RNA recognition motif 5 1e-04
cd1263380 cd12633, RRM1_FCA, RNA recognition motif 1 in plan 1e-04
cd1235976 cd12359, RRM2_VICKZ, RNA recognition motif 2 in th 1e-04
cd1257878 cd12578, RRM1_hnRNPA_like, RNA recognition motif 1 1e-04
cd1229878 cd12298, RRM3_Prp24, RNA recognition motif 3 in fu 1e-04
cd1232873 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 1e-04
cd1260667 cd12606, RRM1_RBM4, RNA recognition motif 1 in ver 1e-04
cd12676107 cd12676, RRM3_Nop4p, RNA recognition motif 3 in ye 1e-04
cd1241698 cd12416, RRM4_RBM28_like, RNA recognition motif 4 1e-04
cd1232679 cd12326, RRM1_hnRNPA0, RNA recognition motif 1 fou 1e-04
cd1241774 cd12417, RRM_SAFB_like, RNA recognition motif in t 1e-04
cd1267583 cd12675, RRM2_Nop4p, RNA recognition motif 2 in ye 1e-04
cd1227371 cd12273, RRM1_NEFsp, RNA recognition motif 1 in ve 1e-04
cd1268169 cd12681, RRM_SKAR, RNA recognition motif in S6K1 A 1e-04
cd1268075 cd12680, RRM_THOC4, RNA recognition motif in THO c 1e-04
TIGR01648 578 TIGR01648, hnRNP-R-Q, heterogeneous nuclear ribonu 1e-04
cd1259670 cd12596, RRM1_SRSF6, RNA recognition motif 1 in ve 1e-04
cd1267282 cd12672, RRM_DAZL, RNA recognition motif in verteb 1e-04
cd1262274 cd12622, RRM3_PUB1, RNA recognition motif 3 in yea 1e-04
TIGR01659 346 TIGR01659, sex-lethal, sex-lethal family splicing 2e-04
cd1247588 cd12475, RRM2_RBMS3, RNA recognition motif 2 found 2e-04
cd1223793 cd12237, RRM_snRNP35, RNA recognition motif found 2e-04
cd1237373 cd12373, RRM_SRSF3_like, RNA recognition motif in 2e-04
cd1236875 cd12368, RRM3_RBM45, RNA recognition motif 3 in RN 2e-04
cd1244684 cd12446, RRM_RBM25, RNA recognition motif in eukar 2e-04
cd1238772 cd12387, RRM3_hnRNPM_like, RNA recognition motif 3 2e-04
TIGR01642 509 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, la 2e-04
cd1263184 cd12631, RRM1_CELF1_2_Bruno, RNA recognition motif 2e-04
cd1241698 cd12416, RRM4_RBM28_like, RNA recognition motif 4 2e-04
cd1231284 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif 2e-04
cd1258871 cd12588, RRM1_p54nrb, RNA recognition motif 1 in v 2e-04
TIGR01648 578 TIGR01648, hnRNP-R-Q, heterogeneous nuclear ribonu 2e-04
cd1276076 cd12760, RRM1_MSI2, RNA recognition motif 1 in RNA 2e-04
cd1276076 cd12760, RRM1_MSI2, RNA recognition motif 1 in RNA 2e-04
cd1227884 cd12278, RRM_eIF3B, RNA recognition motif in eukar 2e-04
cd1257574 cd12575, RRM1_hnRNPD_like, RNA recognition motif 1 2e-04
cd1240074 cd12400, RRM_Nop6, RNA recognition motif in Saccha 2e-04
cd1258480 cd12584, RRM2_hnRNPAB, RNA recognition motif 2 in 2e-04
cd1230979 cd12309, RRM2_Spen, RNA recognition motif 2 in the 2e-04
cd1257379 cd12573, RRM2_MSI2, RNA recognition motif 2 in RNA 2e-04
cd1267976 cd12679, RRM_SAFB1_SAFB2, RNA recognition motif in 2e-04
cd1237778 cd12377, RRM3_Hu, RNA recognition motif 3 in the H 3e-04
cd1237679 cd12376, RRM2_Hu_like, RNA recognition motif 2 in 3e-04
cd1234366 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 3e-04
cd1249572 cd12495, RRM3_hnRNPQ, RNA recognition motif 3 in v 3e-04
cd1249774 cd12497, RRM3_RBM47, RNA recognition motif 3 in ve 3e-04
cd1275977 cd12759, RRM1_MSI1, RNA recognition motif 1 in RNA 3e-04
TIGR01648 578 TIGR01648, hnRNP-R-Q, heterogeneous nuclear ribonu 3e-04
cd1258077 cd12580, RRM2_hnRNPA1, RNA recognition motif 2 in 3e-04
cd1269776 cd12697, RRM3_ROD1, RNA recognition motif 3 in ver 3e-04
cd1275876 cd12758, RRM1_hnRPDL, RNA recognition motif 1 in h 3e-04
cd1266898 cd12668, RRM3_RAVER2, RNA recognition motif 3 foun 3e-04
cd1235679 cd12356, RRM_PPARGC1B, RNA recognition motif in pe 3e-04
cd1245980 cd12459, RRM1_CID8_like, RNA recognition motif 1 i 3e-04
cd1256476 cd12564, RRM1_RBM19, RNA recognition motif 1 in RN 4e-04
cd1263681 cd12636, RRM2_Bruno_like, RNA recognition motif 2 4e-04
cd1276181 cd12761, RRM1_hnRNPA1, RNA recognition motif 1 in 4e-04
cd1245288 cd12452, RRM_ARP_like, RNA recognition motif in ye 4e-04
cd1259570 cd12595, RRM1_SRSF5, RNA recognition motif 1 in ve 4e-04
cd1248279 cd12482, RRM1_hnRNPR, RNA recognition motif 1 in v 4e-04
cd1235580 cd12355, RRM_RBM18, RNA recognition motif in eukar 5e-04
cd1257980 cd12579, RRM2_hnRNPA0, RNA recognition motif 2 in 5e-04
cd1224273 cd12242, RRM_SLIRP, RNA recognition motif found in 5e-04
cd1241774 cd12417, RRM_SAFB_like, RNA recognition motif in t 5e-04
cd1246778 cd12467, RRM_Srp1p_like, RNA recognition motif 1 i 5e-04
cd1235873 cd12358, RRM1_VICKZ, RNA recognition motif 1 in th 5e-04
cd1229080 cd12290, RRM1_LARP7, RNA recognition motif 1 in La 5e-04
cd1248478 cd12484, RRM1_RBM46, RNA recognition motif 1 found 5e-04
cd1249674 cd12496, RRM3_RBM46, RNA recognition motif 3 in ve 5e-04
cd1260767 cd12607, RRM2_RBM4, RNA recognition motif 2 in ver 5e-04
cd1261975 cd12619, RRM2_PUB1, RNA recognition motif 2 in yea 6e-04
cd1261880 cd12618, RRM2_TIA1, RNA recognition motif 2 in nuc 6e-04
cd1261780 cd12617, RRM2_TIAR, RNA recognition motif 2 in nuc 6e-04
cd1231384 cd12313, RRM1_RRM2_RBM5_like, RNA recognition moti 6e-04
cd1236573 cd12365, RRM_RNPS1, RNA recognition motif in RNA-b 6e-04
cd1233770 cd12337, RRM1_SRSF4_like, RNA recognition motif 1 6e-04
cd1240984 cd12409, RRM1_RRT5, RNA recognition motif 1 in yea 6e-04
cd1259275 cd12592, RRM_RBM7, RNA recognition motif in verteb 6e-04
cd1235580 cd12355, RRM_RBM18, RNA recognition motif in eukar 7e-04
cd1239281 cd12392, RRM2_SART3, RNA recognition motif 2 in sq 7e-04
cd1257482 cd12574, RRM1_DAZAP1, RNA recognition motif 1 in D 7e-04
cd1229778 cd12297, RRM2_Prp24, RNA recognition motif 2 in fu 7e-04
cd1258180 cd12581, RRM2_hnRNPA2B1, RNA recognition motif 2 i 7e-04
cd1266577 cd12665, RRM2_RAVER1, RNA recognition motif 2 foun 8e-04
cd1235976 cd12359, RRM2_VICKZ, RNA recognition motif 2 in th 8e-04
cd1245179 cd12451, RRM2_NUCLs, RNA recognition motif 2 in nu 8e-04
cd1276281 cd12762, RRM1_hnRNPA2B1, RNA recognition motif 1 i 8e-04
cd1239172 cd12391, RRM1_SART3, RNA recognition motif 1 in sq 8e-04
cd1258375 cd12583, RRM2_hnRNPD, RNA recognition motif 2 in h 8e-04
cd1223691 cd12236, RRM_snRNP70, RNA recognition motif in U1 9e-04
cd1236573 cd12365, RRM_RNPS1, RNA recognition motif in RNA-b 9e-04
cd1261380 cd12613, RRM2_NGR1_NAM8_like, RNA recognition moti 0.001
cd1263581 cd12635, RRM2_CELF3_4_5_6, RNA recognition motif 2 0.001
cd1234773 cd12347, RRM_PPIE, RNA recognition motif in cyclop 0.001
cd1256576 cd12565, RRM1_MRD1, RNA recognition motif 1 in yea 0.001
cd1233675 cd12336, RRM_RBM7_like, RNA recognition motif in R 0.001
cd1241476 cd12414, RRM2_RBM28_like, RNA recognition motif 2 0.001
cd1237076 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U 0.001
cd1262174 cd12621, RRM3_TIA1, RNA recognition motif 3 in nuc 0.001
cd1231072 cd12310, RRM3_Spen, RNA recognition motif 3 in the 0.001
cd1258671 cd12586, RRM1_PSP1, RNA recognition motif 1 in ver 0.001
cd1262274 cd12622, RRM3_PUB1, RNA recognition motif 3 in yea 0.001
cd1229080 cd12290, RRM1_LARP7, RNA recognition motif 1 in La 0.001
cd1227172 cd12271, RRM1_PHIP1, RNA recognition motif 1 in Ar 0.001
cd12696107 cd12696, RRM3_PTBP2, RNA recognition motif 3 in ve 0.001
cd1232780 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in D 0.001
cd1224678 cd12246, RRM1_U1A_like, RNA recognition motif 1 in 0.001
cd1233583 cd12335, RRM2_SF3B4, RNA recognition motif 2 in sp 0.002
cd1238383 cd12383, RRM_RBM42, RNA recognition motif in RNA-b 0.002
cd1236774 cd12367, RRM2_RBM45, RNA recognition motif 2 in RN 0.002
cd1256679 cd12566, RRM2_MRD1, RNA recognition motif 2 in yea 0.002
cd1230575 cd12305, RRM_NELFE, RNA recognition motif in negat 0.002
cd1256779 cd12567, RRM3_RBM19, RNA recognition motif 3 in RN 0.002
cd1232374 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA- 0.002
cd1276381 cd12763, RRM1_hnRNPA3, RNA recognition motif 1 in 0.002
cd1262174 cd12621, RRM3_TIA1, RNA recognition motif 3 in nuc 0.002
cd1249472 cd12494, RRM3_hnRNPR, RNA recognition motif 3 in v 0.002
cd1232076 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition mot 0.002
cd1227671 cd12276, RRM2_MEI2_EAR1_like, RNA recognition moti 0.002
cd1262073 cd12620, RRM3_TIAR, RNA recognition motif 3 in nuc 0.002
cd1267976 cd12679, RRM_SAFB1_SAFB2, RNA recognition motif in 0.002
cd1245179 cd12451, RRM2_NUCLs, RNA recognition motif 2 in nu 0.002
cd1240678 cd12406, RRM4_NCL, RNA recognition motif 4 in vert 0.002
cd1227571 cd12275, RRM1_MEI2_EAR1_like, RNA recognition moti 0.002
cd1246279 cd12462, RRM_SCAF8, RNA recognition motif in SR-re 0.002
cd1230386 cd12303, RRM_spSet1p_like, RNA recognition motif i 0.002
cd1257076 cd12570, RRM5_MRD1, RNA recognition motif 5 in yea 0.002
cd1242374 cd12423, RRM3_PTBP1_like, RNA recognition motif 3 0.002
cd1225473 cd12254, RRM_hnRNPH_ESRPs_RBM12_like, RNA recognit 0.002
cd1256576 cd12565, RRM1_MRD1, RNA recognition motif 1 in yea 0.003
cd1224078 cd12240, RRM_NCBP2, RNA recognition motif found in 0.003
cd1230673 cd12306, RRM_II_PABPs, RNA recognition motif in ty 0.003
cd1259375 cd12593, RRM_RBM11, RNA recognition motif in verte 0.003
cd1257482 cd12574, RRM1_DAZAP1, RNA recognition motif 1 in D 0.003
cd1267381 cd12673, RRM_BOULE, RNA recognition motif in prote 0.003
cd1248379 cd12483, RRM1_hnRNPQ, RNA recognition motif 1 in v 0.003
cd1258280 cd12582, RRM2_hnRNPA3, RNA recognition motif 2 in 0.003
cd1235177 cd12351, RRM4_SHARP, RNA recognition motif 4 in SM 0.003
cd1242471 cd12424, RRM3_hnRNPL_like, RNA recognition motif 1 0.003
cd1242285 cd12422, RRM2_PTBP1_hnRNPL_like, RNA recognition m 0.003
cd1229778 cd12297, RRM2_Prp24, RNA recognition motif 2 in fu 0.004
cd1222474 cd12224, RRM_RBM22, RNA recognition motif (RRM) fo 0.004
cd1222577 cd12225, RRM1_2_CID8_like, RNA recognition motif 1 0.004
cd1228192 cd12281, RRM1_TatSF1_like, RNA recognition motif 1 0.004
cd1256286 cd12562, RRM2_RBM5_like, RNA recognition motif 2 i 0.004
cd1275775 cd12757, RRM1_hnRNPAB, RNA recognition motif 1 in 0.004
cd1275586 cd12755, RRM2_RBM5, RNA recognition motif 2 in ver 0.004
>gnl|CDD|233516 TIGR01661, ELAV_HUD_SF, ELAV/HuD family splicing factor Back     alignment and domain information
 Score =  443 bits (1142), Expect = e-157
 Identities = 190/365 (52%), Positives = 240/365 (65%), Gaps = 51/365 (13%)

Query: 24  EQNSNLIVNYVPQTMTQEELQHLFSSVGEVESCKLIRDKTTAQSLGYGFVNYYRTEDAER 83
           E  +NLIVNY+PQTMTQEE++ LF+S+GE+ESCKL+RDK T QSLGYGFVNY R EDAE+
Sbjct: 1   ESKTNLIVNYLPQTMTQEEIRSLFTSIGEIESCKLVRDKVTGQSLGYGFVNYVRPEDAEK 60

Query: 84  AIIELNGLKLQNKSIKVSYARPSSEAIKRANLYVSGLPKHMTQEDLENLFRPYGTIITSR 143
           A+  LNGL+LQNK+IKVSYARPSS++IK ANLYVSGLPK MTQ +LE++F P+G IITSR
Sbjct: 61  AVNSLNGLRLQNKTIKVSYARPSSDSIKGANLYVSGLPKTMTQHELESIFSPFGQIITSR 120

Query: 144 ILCDKMASENVRSFVSGTPEIPQISKGIGFVRFNQHIEAEHAMQELNGTIPEGASEPITV 203
           IL D                +  +SKG+GF+RF++  EA+ A++ LNGT P G +EPITV
Sbjct: 121 ILSD---------------NVTGLSKGVGFIRFDKRDEADRAIKTLNGTTPSGCTEPITV 165

Query: 204 KFANSPAGRAK-----ALAANLNAQAAAMRHFAAAMRHFGNPLHH-SARFK--------- 248
           KFAN+P+          L A  N Q   +            P+HH +ARF+         
Sbjct: 166 KFANNPSSSNSKGLLSQLEAVQNPQTTRVPLSTILTAAGIGPMHHAAARFRPSAGDFTAV 225

Query: 249 ------------------FAPLTADLLNNSMLPP---KSLHGSGWCIFVYNLAPETEDNV 287
                              +P   D     +       +  G+G+CIFVYNL+P+T++ V
Sbjct: 226 LAHQQQQHAVAQQHAAQRASPPATDGQTAGLAAGAQIAASDGAGYCIFVYNLSPDTDETV 285

Query: 288 LWQLFGPFGAVQNVKVVRDPQTYKCKGFGFVCMTNYDEAVFAIQSLNGYALGDRLLQVSF 347
           LWQLFGPFGAVQNVK++RD  T +CKG+GFV MTNYDEA  AI SLNGY LG+R+LQVSF
Sbjct: 286 LWQLFGPFGAVQNVKIIRDLTTNQCKGYGFVSMTNYDEAAMAILSLNGYTLGNRVLQVSF 345

Query: 348 KTHKP 352
           KT+K 
Sbjct: 346 KTNKA 350


This model describes the ELAV/HuD subfamily of splicing factors found in metazoa. HuD stands for the human paraneoplastic encephalomyelitis antigen D of which there are 4 variants in human. ELAV stnds for the Drosophila Embryonic lethal abnormal visual protein. ELAV-like splicing factors are also known in human as HuB (ELAV-like protein 2), HuC (ELAV-like protein 3, Paraneoplastic cerebellar degeneration-associated antigen) and HuR (ELAV-like protein 1). These genes are most closely related to the sex-lethal subfamily of splicing factors found in Dipteran insects (TIGR01659). These proteins contain 3 RNA-recognition motifs (rrm: pfam00076). Length = 352

>gnl|CDD|233515 TIGR01659, sex-lethal, sex-lethal family splicing factor Back     alignment and domain information
>gnl|CDD|240823 cd12377, RRM3_Hu, RNA recognition motif 3 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|241094 cd12650, RRM1_Hu, RNA recognition motif 1 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|241100 cd12656, RRM3_HuD, RNA recognition motif 3 in vertebrate Hu-antigen D (HuD) Back     alignment and domain information
>gnl|CDD|241098 cd12654, RRM3_HuB, RNA recognition motif 3 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|241099 cd12655, RRM3_HuC, RNA recognition motif 3 in vertebrate Hu-antigen C (HuC) Back     alignment and domain information
>gnl|CDD|241096 cd12652, RRM2_Hu, RNA recognition motif 2 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|241097 cd12653, RRM3_HuR, RNA recognition motif 3 in vertebrate Hu-antigen R (HuR) Back     alignment and domain information
>gnl|CDD|241215 cd12771, RRM1_HuB, RNA recognition motif 1 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|241214 cd12770, RRM1_HuD, RNA recognition motif 1 in vertebrate Hu-antigen D (HuD) Back     alignment and domain information
>gnl|CDD|240821 cd12375, RRM1_Hu_like, RNA recognition motif 1 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|241216 cd12772, RRM1_HuC, RNA recognition motif 1 in vertebrate Hu-antigen C (HuC) Back     alignment and domain information
>gnl|CDD|241093 cd12649, RRM1_SXL, RNA recognition motif 1 in Drosophila sex-lethal (SXL) and similar proteins Back     alignment and domain information
>gnl|CDD|241213 cd12769, RRM1_HuR, RNA recognition motif 1 in vertebrate Hu-antigen R (HuR) Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|241219 cd12775, RRM2_HuB, RNA recognition motif 2 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|240822 cd12376, RRM2_Hu_like, RNA recognition motif 2 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|241220 cd12776, RRM2_HuC, RNA recognition motif 2 in vertebrate Hu-antigen C (HuC) Back     alignment and domain information
>gnl|CDD|241218 cd12774, RRM2_HuD, RNA recognition motif 2 in vertebrate Hu-antigen D (HuD) Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|241217 cd12773, RRM2_HuR, RNA recognition motif 2 in vertebrate Hu-antigen R (HuR) Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240690 cd12244, RRM2_MSSP, RNA recognition motif 2 in the c-myc gene single-strand binding proteins (MSSP) family Back     alignment and domain information
>gnl|CDD|241095 cd12651, RRM2_SXL, RNA recognition motif 2 in Drosophila sex-lethal (SXL) and similar proteins Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA recognition motif 1 (hRBMY), testis-specific heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T) and similar proteins Back     alignment and domain information
>gnl|CDD|240799 cd12353, RRM2_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter pylori HP0827 protein and similar proteins Back     alignment and domain information
>gnl|CDD|240859 cd12413, RRM1_RBM28_like, RNA recognition motif 1 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|240730 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 in vertebrate RNA-binding protein RBM23, RBM39 and similar proteins Back     alignment and domain information
>gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter pylori HP0827 protein and similar proteins Back     alignment and domain information
>gnl|CDD|240808 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in CELF/Bruno-like family of RNA binding proteins CELF1, CELF2, CELF3, CELF4, CELF5, CELF6 and similar proteins Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|240841 cd12395, RRM2_RBM34, RNA recognition motif 2 in RNA-binding protein 34 (RBM34) and similar proteins Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240808 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in CELF/Bruno-like family of RNA binding proteins CELF1, CELF2, CELF3, CELF4, CELF5, CELF6 and similar proteins Back     alignment and domain information
>gnl|CDD|240809 cd12363, RRM_TRA2, RNA recognition motif in transformer-2 protein homolog TRA2-alpha, TRA2-beta and similar proteins Back     alignment and domain information
>gnl|CDD|214636 smart00360, RRM, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240854 cd12408, RRM_eIF3G_like, RNA recognition motif in eukaryotic translation initiation factor 3 subunit G (eIF-3G) and similar proteins Back     alignment and domain information
>gnl|CDD|241096 cd12652, RRM2_Hu, RNA recognition motif 2 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|240807 cd12361, RRM1_2_CELF1-6_like, RNA recognition motif 1 and 2 in CELF/Bruno-like family of RNA binding proteins and plant flowering time control protein FCA Back     alignment and domain information
>gnl|CDD|215696 pfam00076, RRM_1, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240781 cd12335, RRM2_SF3B4, RNA recognition motif 2 in splicing factor 3B subunit 4 (SF3B4) and similar proteins Back     alignment and domain information
>gnl|CDD|240826 cd12380, RRM3_I_PABPs, RNA recognition motif 3 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240668 cd00590, RRM_SF, RNA recognition motif (RRM) superfamily Back     alignment and domain information
>gnl|CDD|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA recognition motif 1 (hRBMY), testis-specific heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T) and similar proteins Back     alignment and domain information
>gnl|CDD|240807 cd12361, RRM1_2_CELF1-6_like, RNA recognition motif 1 and 2 in CELF/Bruno-like family of RNA binding proteins and plant flowering time control protein FCA Back     alignment and domain information
>gnl|CDD|240826 cd12380, RRM3_I_PABPs, RNA recognition motif 3 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240824 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240835 cd12389, RRM2_RAVER, RNA recognition motif 2 in ribonucleoprotein PTB-binding raver-1, raver-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240823 cd12377, RRM3_Hu, RNA recognition motif 3 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>gnl|CDD|240859 cd12413, RRM1_RBM28_like, RNA recognition motif 1 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240809 cd12363, RRM_TRA2, RNA recognition motif in transformer-2 protein homolog TRA2-alpha, TRA2-beta and similar proteins Back     alignment and domain information
>gnl|CDD|240689 cd12243, RRM1_MSSP, RNA recognition motif 1 in the c-myc gene single-strand binding proteins (MSSP) family Back     alignment and domain information
>gnl|CDD|241118 cd12674, RRM1_Nop4p, RNA recognition motif 1 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240800 cd12354, RRM3_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins (p40-TIA-1 and TIAR), and yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 Back     alignment and domain information
>gnl|CDD|240689 cd12243, RRM1_MSSP, RNA recognition motif 1 in the c-myc gene single-strand binding proteins (MSSP) family Back     alignment and domain information
>gnl|CDD|240730 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 in vertebrate RNA-binding protein RBM23, RBM39 and similar proteins Back     alignment and domain information
>gnl|CDD|240854 cd12408, RRM_eIF3G_like, RNA recognition motif in eukaryotic translation initiation factor 3 subunit G (eIF-3G) and similar proteins Back     alignment and domain information
>gnl|CDD|240822 cd12376, RRM2_Hu_like, RNA recognition motif 2 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|240845 cd12399, RRM_HP0827_like, RNA recognition motif in Helicobacter pylori HP0827 protein and similar proteins Back     alignment and domain information
>gnl|CDD|240844 cd12398, RRM_CSTF2_RNA15_like, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), yeast ortholog mRNA 3'-end-processing protein RNA15 and similar proteins Back     alignment and domain information
>gnl|CDD|223796 COG0724, COG0724, RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>gnl|CDD|240829 cd12383, RRM_RBM42, RNA recognition motif in RNA-binding protein 42 (RBM42) and similar proteins Back     alignment and domain information
>gnl|CDD|240799 cd12353, RRM2_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|240812 cd12366, RRM1_RBM45, RNA recognition motif 1 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|240798 cd12352, RRM1_TIA1_like, RNA recognition motif 1 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|240827 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240857 cd12411, RRM_ist3_like, RNA recognition motif in ist3 family Back     alignment and domain information
>gnl|CDD|241063 cd12619, RRM2_PUB1, RNA recognition motif 2 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|240681 cd12235, RRM_PPIL4, RNA recognition motif in peptidyl-prolyl cis-trans isomerase-like 4 (PPIase) and similar proteins Back     alignment and domain information
>gnl|CDD|240895 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in cold inducible RNA binding protein (CIRBP), RNA binding motif protein 3 (RBM3) and similar proteins Back     alignment and domain information
>gnl|CDD|240808 cd12362, RRM3_CELF1-6, RNA recognition motif 3 in CELF/Bruno-like family of RNA binding proteins CELF1, CELF2, CELF3, CELF4, CELF5, CELF6 and similar proteins Back     alignment and domain information
>gnl|CDD|240827 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240825 cd12379, RRM2_I_PABPs, RNA recognition motif 2 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|241084 cd12640, RRM3_Bruno_like, RNA recognition motif 3 in Drosophila melanogaster Bruno protein and similar proteins Back     alignment and domain information
>gnl|CDD|240844 cd12398, RRM_CSTF2_RNA15_like, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), yeast ortholog mRNA 3'-end-processing protein RNA15 and similar proteins Back     alignment and domain information
>gnl|CDD|241083 cd12639, RRM3_CELF3_4_5_6, RNA recognition motif 2 in CUGBP Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6 and similar proteins Back     alignment and domain information
>gnl|CDD|241082 cd12638, RRM3_CELF1_2, RNA recognition motif 3 in CUGBP Elav-like family member CELF-1, CELF-2 and similar proteins Back     alignment and domain information
>gnl|CDD|241218 cd12774, RRM2_HuD, RNA recognition motif 2 in vertebrate Hu-antigen D (HuD) Back     alignment and domain information
>gnl|CDD|240828 cd12382, RRM_RBMX_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein G (hnRNP G), Y chromosome RNA recognition motif 1 (hRBMY), testis-specific heterogeneous nuclear ribonucleoprotein G-T (hnRNP G-T) and similar proteins Back     alignment and domain information
>gnl|CDD|240697 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information
>gnl|CDD|241057 cd12613, RRM2_NGR1_NAM8_like, RNA recognition motif 2 in yeast negative growth regulatory protein NGR1, yeast protein NAM8 and similar proteins Back     alignment and domain information
>gnl|CDD|240791 cd12345, RRM2_SECp43_like, RNA recognition motif 2 in tRNA selenocysteine-associated protein 1 (SECp43) and similar proteins Back     alignment and domain information
>gnl|CDD|240800 cd12354, RRM3_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins (p40-TIA-1 and TIAR), and yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 Back     alignment and domain information
>gnl|CDD|241079 cd12635, RRM2_CELF3_4_5_6, RNA recognition motif 2 in CUGBP Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6 and similar proteins Back     alignment and domain information
>gnl|CDD|240917 cd12473, RRM2_MSSP1, RNA recognition motif 2 found in vertebrate single-stranded DNA-binding protein MSSP-1 Back     alignment and domain information
>gnl|CDD|240827 cd12381, RRM4_I_PABPs, RNA recognition motif 4 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|241062 cd12618, RRM2_TIA1, RNA recognition motif 2 in nucleolysin TIA-1 isoform p40 (p40-TIA-1) and similar proteins Back     alignment and domain information
>gnl|CDD|241219 cd12775, RRM2_HuB, RNA recognition motif 2 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|240919 cd12475, RRM2_RBMS3, RNA recognition motif 2 found in vertebrate RNA-binding motif, single-stranded-interacting protein 3 (RBMS3) Back     alignment and domain information
>gnl|CDD|241058 cd12614, RRM1_PUB1, RNA recognition motif 1 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|240821 cd12375, RRM1_Hu_like, RNA recognition motif 1 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|241095 cd12651, RRM2_SXL, RNA recognition motif 2 in Drosophila sex-lethal (SXL) and similar proteins Back     alignment and domain information
>gnl|CDD|240793 cd12347, RRM_PPIE, RNA recognition motif in cyclophilin-33 (Cyp33) and similar proteins Back     alignment and domain information
>gnl|CDD|241009 cd12565, RRM1_MRD1, RNA recognition motif 1 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240817 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|240683 cd12237, RRM_snRNP35, RNA recognition motif found in U11/U12 small nuclear ribonucleoprotein 35 kDa protein (U11/U12-35K) and similar proteins Back     alignment and domain information
>gnl|CDD|240813 cd12367, RRM2_RBM45, RNA recognition motif 2 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|240780 cd12334, RRM1_SF3B4, RNA recognition motif 1 in splicing factor 3B subunit 4 (SF3B4) and similar proteins Back     alignment and domain information
>gnl|CDD|240790 cd12344, RRM1_SECp43_like, RNA recognition motif 1 in tRNA selenocysteine-associated protein 1 (SECp43) and similar proteins Back     alignment and domain information
>gnl|CDD|233496 TIGR01622, SF-CC1, splicing factor, CC1-like family Back     alignment and domain information
>gnl|CDD|240697 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information
>gnl|CDD|240858 cd12412, RRM_DAZL_BOULE, RNA recognition motif in AZoospermia (DAZ) autosomal homologs, DAZL (DAZ-like) and BOULE Back     alignment and domain information
>gnl|CDD|240801 cd12355, RRM_RBM18, RNA recognition motif in eukaryotic RNA-binding protein 18 and similar proteins Back     alignment and domain information
>gnl|CDD|240918 cd12474, RRM2_MSSP2, RNA recognition motif 2 found in vertebrate single-stranded DNA-binding protein MSSP-2 Back     alignment and domain information
>gnl|CDD|240836 cd12390, RRM3_RAVER, RNA recognition motif 3 in ribonucleoprotein PTB-binding raver-1, raver-2 and similar proteins Back     alignment and domain information
>gnl|CDD|241114 cd12670, RRM2_Nop12p_like, RNA recognition motif 2 in yeast nucleolar protein 12 (Nop12p) and similar proteins Back     alignment and domain information
>gnl|CDD|241115 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), cleavage stimulation factor subunit 2 tau variant (CSTF2T) and similar proteins Back     alignment and domain information
>gnl|CDD|241093 cd12649, RRM1_SXL, RNA recognition motif 1 in Drosophila sex-lethal (SXL) and similar proteins Back     alignment and domain information
>gnl|CDD|241220 cd12776, RRM2_HuC, RNA recognition motif 2 in vertebrate Hu-antigen C (HuC) Back     alignment and domain information
>gnl|CDD|240762 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and RNA recognition motif 2 found in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|240782 cd12336, RRM_RBM7_like, RNA recognition motif in RNA-binding protein 7 (RBM7) and similar proteins Back     alignment and domain information
>gnl|CDD|241109 cd12665, RRM2_RAVER1, RNA recognition motif 2 found in vertebrate ribonucleoprotein PTB-binding 1 (raver-1) Back     alignment and domain information
>gnl|CDD|241061 cd12617, RRM2_TIAR, RNA recognition motif 2 in nucleolysin TIAR and similar proteins Back     alignment and domain information
>gnl|CDD|241061 cd12617, RRM2_TIAR, RNA recognition motif 2 in nucleolysin TIAR and similar proteins Back     alignment and domain information
>gnl|CDD|240830 cd12384, RRM_RBM24_RBM38_like, RNA recognition motif in eukaryotic RNA-binding protein RBM24, RBM38 and similar proteins Back     alignment and domain information
>gnl|CDD|241118 cd12674, RRM1_Nop4p, RNA recognition motif 1 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240861 cd12415, RRM3_RBM28_like, RNA recognition motif 3 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240759 cd12313, RRM1_RRM2_RBM5_like, RNA recognition motif 1 and 2 in RNA-binding protein 5 (RBM5) and similar proteins Back     alignment and domain information
>gnl|CDD|241010 cd12566, RRM2_MRD1, RNA recognition motif 2 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240757 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in serine/arginine-rich splicing factor SRSF2, SRSF8 and similar proteins Back     alignment and domain information
>gnl|CDD|241110 cd12666, RRM2_RAVER2, RNA recognition motif 2 in vertebrate ribonucleoprotein PTB-binding 2 (raver-2) Back     alignment and domain information
>gnl|CDD|240792 cd12346, RRM3_NGR1_NAM8_like, RNA recognition motif 3 in yeast negative growth regulatory protein NGR1 (RBP1), yeast protein NAM8 and similar proteins Back     alignment and domain information
>gnl|CDD|240800 cd12354, RRM3_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins (p40-TIA-1 and TIAR), and yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 Back     alignment and domain information
>gnl|CDD|240764 cd12318, RRM5_RBM19_like, RNA recognition motif 5 in RNA-binding protein 19 (RBM19 or RBD-1) and similar proteins Back     alignment and domain information
>gnl|CDD|241077 cd12633, RRM1_FCA, RNA recognition motif 1 in plant flowering time control protein FCA and similar proteins Back     alignment and domain information
>gnl|CDD|240835 cd12389, RRM2_RAVER, RNA recognition motif 2 in ribonucleoprotein PTB-binding raver-1, raver-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240893 cd12447, RRM1_gar2, RNA recognition motif 1 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|240781 cd12335, RRM2_SF3B4, RNA recognition motif 2 in splicing factor 3B subunit 4 (SF3B4) and similar proteins Back     alignment and domain information
>gnl|CDD|240689 cd12243, RRM1_MSSP, RNA recognition motif 1 in the c-myc gene single-strand binding proteins (MSSP) family Back     alignment and domain information
>gnl|CDD|240812 cd12366, RRM1_RBM45, RNA recognition motif 1 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|240677 cd12231, RRM2_U2AF65, RNA recognition motif 2 found in U2 large nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa subunit (U2AF65) and similar proteins Back     alignment and domain information
>gnl|CDD|240770 cd12324, RRM_RBM8, RNA recognition motif in RNA-binding protein RBM8A, RBM8B nd similar proteins Back     alignment and domain information
>gnl|CDD|240778 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 in the p54nrb/PSF/PSP1 family Back     alignment and domain information
>gnl|CDD|240673 cd12227, RRM_SCAF4_SCAF8, RNA recognition motif in SR-related and CTD-associated factor 4 (SCAF4), SR-related and CTD-associated factor 8 (SCAF8) and similar proteins Back     alignment and domain information
>gnl|CDD|178680 PLN03134, PLN03134, glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>gnl|CDD|240751 cd12305, RRM_NELFE, RNA recognition motif in negative elongation factor E (NELF-E) and similar proteins Back     alignment and domain information
>gnl|CDD|240841 cd12395, RRM2_RBM34, RNA recognition motif 2 in RNA-binding protein 34 (RBM34) and similar proteins Back     alignment and domain information
>gnl|CDD|241083 cd12639, RRM3_CELF3_4_5_6, RNA recognition motif 2 in CUGBP Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6 and similar proteins Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|240838 cd12392, RRM2_SART3, RNA recognition motif 2 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|240682 cd12236, RRM_snRNP70, RNA recognition motif in U1 small nuclear ribonucleoprotein 70 kDa (U1-70K) and similar proteins Back     alignment and domain information
>gnl|CDD|240791 cd12345, RRM2_SECp43_like, RNA recognition motif 2 in tRNA selenocysteine-associated protein 1 (SECp43) and similar proteins Back     alignment and domain information
>gnl|CDD|240780 cd12334, RRM1_SF3B4, RNA recognition motif 1 in splicing factor 3B subunit 4 (SF3B4) and similar proteins Back     alignment and domain information
>gnl|CDD|240778 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 in the p54nrb/PSF/PSP1 family Back     alignment and domain information
>gnl|CDD|240860 cd12414, RRM2_RBM28_like, RNA recognition motif 2 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240900 cd12454, RRM2_RIM4_like, RNA recognition motif 2 in yeast meiotic activator RIM4 and similar proteins Back     alignment and domain information
>gnl|CDD|240864 cd12418, RRM_Aly_REF_like, RNA recognition motif in the Aly/REF family Back     alignment and domain information
>gnl|CDD|240826 cd12380, RRM3_I_PABPs, RNA recognition motif 3 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|241084 cd12640, RRM3_Bruno_like, RNA recognition motif 3 in Drosophila melanogaster Bruno protein and similar proteins Back     alignment and domain information
>gnl|CDD|240830 cd12384, RRM_RBM24_RBM38_like, RNA recognition motif in eukaryotic RNA-binding protein RBM24, RBM38 and similar proteins Back     alignment and domain information
>gnl|CDD|240860 cd12414, RRM2_RBM28_like, RNA recognition motif 2 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240789 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 and 2 in RRM-containing coactivator activator/modulator (CoAA) and similar proteins Back     alignment and domain information
>gnl|CDD|240761 cd12315, RRM1_RBM19_MRD1, RNA recognition motif 1 in RNA-binding protein 19 (RBM19), yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240861 cd12415, RRM3_RBM28_like, RNA recognition motif 3 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240770 cd12324, RRM_RBM8, RNA recognition motif in RNA-binding protein RBM8A, RBM8B nd similar proteins Back     alignment and domain information
>gnl|CDD|206064 pfam13893, RRM_5, RNA recognition motif Back     alignment and domain information
>gnl|CDD|241054 cd12610, RRM1_SECp43, RNA recognition motif 1 in tRNA selenocysteine-associated protein 1 (SECp43) Back     alignment and domain information
>gnl|CDD|241094 cd12650, RRM1_Hu, RNA recognition motif 1 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|240895 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in cold inducible RNA binding protein (CIRBP), RNA binding motif protein 3 (RBM3) and similar proteins Back     alignment and domain information
>gnl|CDD|241082 cd12638, RRM3_CELF1_2, RNA recognition motif 3 in CUGBP Elav-like family member CELF-1, CELF-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240838 cd12392, RRM2_SART3, RNA recognition motif 2 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|241217 cd12773, RRM2_HuR, RNA recognition motif 2 in vertebrate Hu-antigen R (HuR) Back     alignment and domain information
>gnl|CDD|241062 cd12618, RRM2_TIA1, RNA recognition motif 2 in nucleolysin TIA-1 isoform p40 (p40-TIA-1) and similar proteins Back     alignment and domain information
>gnl|CDD|241115 cd12671, RRM_CSTF2_CSTF2T, RNA recognition motif in cleavage stimulation factor subunit 2 (CSTF2), cleavage stimulation factor subunit 2 tau variant (CSTF2T) and similar proteins Back     alignment and domain information
>gnl|CDD|240762 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and RNA recognition motif 2 found in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|241010 cd12566, RRM2_MRD1, RNA recognition motif 2 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240839 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc finger CCHC-type and RNA-binding motif-containing protein 1 (ZCRB1) and similar proteins Back     alignment and domain information
>gnl|CDD|240914 cd12470, RRM1_MSSP1, RNA recognition motif 1 in vertebrate single-stranded DNA-binding protein MSSP-1 Back     alignment and domain information
>gnl|CDD|240821 cd12375, RRM1_Hu_like, RNA recognition motif 1 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|240778 cd12332, RRM1_p54nrb_like, RNA recognition motif 1 in the p54nrb/PSF/PSP1 family Back     alignment and domain information
>gnl|CDD|178680 PLN03134, PLN03134, glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|240686 cd12240, RRM_NCBP2, RNA recognition motif found in nuclear cap-binding protein subunit 2 (CBP20) and similar proteins Back     alignment and domain information
>gnl|CDD|240996 cd12552, RRM_Nop15p, RNA recognition motif in yeast ribosome biogenesis protein 15 (Nop15p) and similar proteins Back     alignment and domain information
>gnl|CDD|241060 cd12616, RRM1_TIAR, RNA recognition motif 1 in nucleolysin TIAR and similar proteins Back     alignment and domain information
>gnl|CDD|241081 cd12637, RRM2_FCA, RNA recognition motif 2 in plant flowering time control protein FCA and similar proteins Back     alignment and domain information
>gnl|CDD|240894 cd12448, RRM2_gar2, RNA recognition motif 2 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|240805 cd12359, RRM2_VICKZ, RNA recognition motif 2 in the VICKZ family proteins Back     alignment and domain information
>gnl|CDD|240824 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240764 cd12318, RRM5_RBM19_like, RNA recognition motif 5 in RNA-binding protein 19 (RBM19 or RBD-1) and similar proteins Back     alignment and domain information
>gnl|CDD|241008 cd12564, RRM1_RBM19, RNA recognition motif 1 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|240767 cd12321, RRM1_TDP43, RNA recognition motif 1 in TAR DNA-binding protein 43 (TDP-43) and similar proteins Back     alignment and domain information
>gnl|CDD|240729 cd12283, RRM1_RBM39_like, RNA recognition motif 1 in vertebrate RNA-binding protein 39 (RBM39) and similar proteins Back     alignment and domain information
>gnl|CDD|240811 cd12365, RRM_RNPS1, RNA recognition motif in RNA-binding protein with serine-rich domain 1 (RNPS1) and similar proteins Back     alignment and domain information
>gnl|CDD|241086 cd12642, RRM_TRA2A, RNA recognition motif in transformer-2 protein homolog alpha (TRA-2 alpha) and similar proteins Back     alignment and domain information
>gnl|CDD|240825 cd12379, RRM2_I_PABPs, RNA recognition motif 2 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240996 cd12552, RRM_Nop15p, RNA recognition motif in yeast ribosome biogenesis protein 15 (Nop15p) and similar proteins Back     alignment and domain information
>gnl|CDD|240819 cd12373, RRM_SRSF3_like, RNA recognition motif in serine/arginine-rich splicing factor 3 (SRSF3) and similar proteins Back     alignment and domain information
>gnl|CDD|240807 cd12361, RRM1_2_CELF1-6_like, RNA recognition motif 1 and 2 in CELF/Bruno-like family of RNA binding proteins and plant flowering time control protein FCA Back     alignment and domain information
>gnl|CDD|240817 cd12371, RRM2_PUF60, RNA recognition motif 2 in (U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|240839 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc finger CCHC-type and RNA-binding motif-containing protein 1 (ZCRB1) and similar proteins Back     alignment and domain information
>gnl|CDD|240829 cd12383, RRM_RBM42, RNA recognition motif in RNA-binding protein 42 (RBM42) and similar proteins Back     alignment and domain information
>gnl|CDD|240812 cd12366, RRM1_RBM45, RNA recognition motif 1 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|241057 cd12613, RRM2_NGR1_NAM8_like, RNA recognition motif 2 in yeast negative growth regulatory protein NGR1, yeast protein NAM8 and similar proteins Back     alignment and domain information
>gnl|CDD|240893 cd12447, RRM1_gar2, RNA recognition motif 1 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|240789 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 and 2 in RRM-containing coactivator activator/modulator (CoAA) and similar proteins Back     alignment and domain information
>gnl|CDD|240669 cd12223, RRM_SR140, RNA recognition motif (RRM) in U2-associated protein SR140 and similar proteins Back     alignment and domain information
>gnl|CDD|240679 cd12233, RRM_Srp1p_AtRSp31_like, RNA recognition motif found in fission yeast pre-mRNA-splicing factor Srp1p, Arabidopsis thaliana arginine/serine-rich-splicing factor RSp31 and similar proteins Back     alignment and domain information
>gnl|CDD|241094 cd12650, RRM1_Hu, RNA recognition motif 1 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|240730 cd12284, RRM2_RBM23_RBM39, RNA recognition motif 2 in vertebrate RNA-binding protein RBM23, RBM39 and similar proteins Back     alignment and domain information
>gnl|CDD|240816 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|240790 cd12344, RRM1_SECp43_like, RNA recognition motif 1 in tRNA selenocysteine-associated protein 1 (SECp43) and similar proteins Back     alignment and domain information
>gnl|CDD|240762 cd12316, RRM3_RBM19_RRM2_MRD1, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and RNA recognition motif 2 found in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|240677 cd12231, RRM2_U2AF65, RNA recognition motif 2 found in U2 large nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa subunit (U2AF65) and similar proteins Back     alignment and domain information
>gnl|CDD|240814 cd12368, RRM3_RBM45, RNA recognition motif 3 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|240786 cd12340, RBD_RRM1_NPL3, RNA recognition motif 1 in yeast nucleolar protein 3 (Npl3p) and similar proteins Back     alignment and domain information
>gnl|CDD|240776 cd12330, RRM2_Hrp1p, RNA recognition motif 2 in yeast nuclear polyadenylated RNA-binding protein 4 (Hrp1p or Nab4p) and similar proteins Back     alignment and domain information
>gnl|CDD|241022 cd12578, RRM1_hnRNPA_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A subfamily Back     alignment and domain information
>gnl|CDD|240843 cd12397, RRM2_Nop13p_fungi, RNA recognition motif 2 in yeast nucleolar protein 13 (Nop13p) and similar proteins Back     alignment and domain information
>gnl|CDD|241099 cd12655, RRM3_HuC, RNA recognition motif 3 in vertebrate Hu-antigen C (HuC) Back     alignment and domain information
>gnl|CDD|241097 cd12653, RRM3_HuR, RNA recognition motif 3 in vertebrate Hu-antigen R (HuR) Back     alignment and domain information
>gnl|CDD|240825 cd12379, RRM2_I_PABPs, RNA recognition motif 2 found in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|241084 cd12640, RRM3_Bruno_like, RNA recognition motif 3 in Drosophila melanogaster Bruno protein and similar proteins Back     alignment and domain information
>gnl|CDD|240792 cd12346, RRM3_NGR1_NAM8_like, RNA recognition motif 3 in yeast negative growth regulatory protein NGR1 (RBP1), yeast protein NAM8 and similar proteins Back     alignment and domain information
>gnl|CDD|240776 cd12330, RRM2_Hrp1p, RNA recognition motif 2 in yeast nuclear polyadenylated RNA-binding protein 4 (Hrp1p or Nab4p) and similar proteins Back     alignment and domain information
>gnl|CDD|241005 cd12561, RRM1_RBM5_like, RNA recognition motif 1 in RNA-binding protein 5 (RBM5) and similar proteins Back     alignment and domain information
>gnl|CDD|240744 cd12298, RRM3_Prp24, RNA recognition motif 3 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|241085 cd12641, RRM_TRA2B, RNA recognition motif in Transformer-2 protein homolog beta (TRA-2 beta) and similar proteins Back     alignment and domain information
>gnl|CDD|240785 cd12339, RRM2_SRSF1_4_like, RNA recognition motif 2 in serine/arginine-rich splicing factor SRSF1, SRSF4 and similar proteins Back     alignment and domain information
>gnl|CDD|241083 cd12639, RRM3_CELF3_4_5_6, RNA recognition motif 2 in CUGBP Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6 and similar proteins Back     alignment and domain information
>gnl|CDD|240836 cd12390, RRM3_RAVER, RNA recognition motif 3 in ribonucleoprotein PTB-binding raver-1, raver-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240669 cd12223, RRM_SR140, RNA recognition motif (RRM) in U2-associated protein SR140 and similar proteins Back     alignment and domain information
>gnl|CDD|241068 cd12624, RRM_PRC, RNA recognition motif in peroxisome proliferator-activated receptor gamma coactivator-related protein 1 (PRC) and similar proteins Back     alignment and domain information
>gnl|CDD|241011 cd12567, RRM3_RBM19, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|240824 cd12378, RRM1_I_PABPs, RNA recognition motif 1 in type I polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|240857 cd12411, RRM_ist3_like, RNA recognition motif in ist3 family Back     alignment and domain information
>gnl|CDD|241063 cd12619, RRM2_PUB1, RNA recognition motif 2 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|241082 cd12638, RRM3_CELF1_2, RNA recognition motif 3 in CUGBP Elav-like family member CELF-1, CELF-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240900 cd12454, RRM2_RIM4_like, RNA recognition motif 2 in yeast meiotic activator RIM4 and similar proteins Back     alignment and domain information
>gnl|CDD|240669 cd12223, RRM_SR140, RNA recognition motif (RRM) in U2-associated protein SR140 and similar proteins Back     alignment and domain information
>gnl|CDD|240847 cd12401, RRM_eIF4H, RNA recognition motif in eukaryotic translation initiation factor 4H (eIF-4H) and similar proteins Back     alignment and domain information
>gnl|CDD|241076 cd12632, RRM1_CELF3_4_5_6, RNA recognition motif 1 in CUGBP Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6 and similar proteins Back     alignment and domain information
>gnl|CDD|241052 cd12608, RRM1_CoAA, RNA recognition motif 1 in vertebrate RRM-containing coactivator activator/modulator (CoAA) Back     alignment and domain information
>gnl|CDD|240799 cd12353, RRM2_TIA1_like, RNA recognition motif 2 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|240892 cd12446, RRM_RBM25, RNA recognition motif in eukaryotic RNA-binding protein 25 and similar proteins Back     alignment and domain information
>gnl|CDD|240833 cd12387, RRM3_hnRNPM_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein M (hnRNP M) and similar proteins Back     alignment and domain information
>gnl|CDD|241100 cd12656, RRM3_HuD, RNA recognition motif 3 in vertebrate Hu-antigen D (HuD) Back     alignment and domain information
>gnl|CDD|241093 cd12649, RRM1_SXL, RNA recognition motif 1 in Drosophila sex-lethal (SXL) and similar proteins Back     alignment and domain information
>gnl|CDD|241023 cd12579, RRM2_hnRNPA0, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0) and similar proteins Back     alignment and domain information
>gnl|CDD|240859 cd12413, RRM1_RBM28_like, RNA recognition motif 1 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240853 cd12407, RRM_FOX1_like, RNA recognition motif in vertebrate RNA binding protein fox-1 homologs and similar proteins Back     alignment and domain information
>gnl|CDD|241059 cd12615, RRM1_TIA1, RNA recognition motif 1 in nucleolysin TIA-1 isoform p40 (p40-TIA-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240771 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP A and hnRNP D subfamilies and similar proteins Back     alignment and domain information
>gnl|CDD|240775 cd12329, RRM2_hnRNPD_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein hnRNP D0, hnRNP A/B, hnRNP DL and similar proteins Back     alignment and domain information
>gnl|CDD|240753 cd12307, RRM_NIFK_like, RNA recognition motif in nucleolar protein interacting with the FHA domain of pKI-67 (NIFK) and similar proteins Back     alignment and domain information
>gnl|CDD|240786 cd12340, RBD_RRM1_NPL3, RNA recognition motif 1 in yeast nucleolar protein 3 (Npl3p) and similar proteins Back     alignment and domain information
>gnl|CDD|241056 cd12612, RRM2_SECp43, RNA recognition motif 2 in tRNA selenocysteine-associated protein 1 (SECp43) Back     alignment and domain information
>gnl|CDD|240916 cd12472, RRM1_RBMS3, RNA recognition motif 1 found in vertebrate RNA-binding motif, single-stranded-interacting protein 3 (RBMS3) Back     alignment and domain information
>gnl|CDD|240771 cd12325, RRM1_hnRNPA_hnRNPD_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP A and hnRNP D subfamilies and similar proteins Back     alignment and domain information
>gnl|CDD|241098 cd12654, RRM3_HuB, RNA recognition motif 3 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|241096 cd12652, RRM2_Hu, RNA recognition motif 2 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|240793 cd12347, RRM_PPIE, RNA recognition motif in cyclophilin-33 (Cyp33) and similar proteins Back     alignment and domain information
>gnl|CDD|241086 cd12642, RRM_TRA2A, RNA recognition motif in transformer-2 protein homolog alpha (TRA-2 alpha) and similar proteins Back     alignment and domain information
>gnl|CDD|240832 cd12386, RRM2_hnRNPM_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein M (hnRNP M) and similar proteins Back     alignment and domain information
>gnl|CDD|240769 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA-binding protein Musashi homologs Musashi-1, Musashi-2 and similar proteins Back     alignment and domain information
>gnl|CDD|241207 cd12763, RRM1_hnRNPA3, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A3 (hnRNP A3) and similar proteins Back     alignment and domain information
>gnl|CDD|240798 cd12352, RRM1_TIA1_like, RNA recognition motif 1 in granule-associated RNA binding proteins p40-TIA-1 and TIAR Back     alignment and domain information
>gnl|CDD|240895 cd12449, RRM_CIRBP_RBM3, RNA recognition motif in cold inducible RNA binding protein (CIRBP), RNA binding motif protein 3 (RBM3) and similar proteins Back     alignment and domain information
>gnl|CDD|222631 pfam14259, RRM_6, RNA recognition motif (a Back     alignment and domain information
>gnl|CDD|206064 pfam13893, RRM_5, RNA recognition motif Back     alignment and domain information
>gnl|CDD|240729 cd12283, RRM1_RBM39_like, RNA recognition motif 1 in vertebrate RNA-binding protein 39 (RBM39) and similar proteins Back     alignment and domain information
>gnl|CDD|240744 cd12298, RRM3_Prp24, RNA recognition motif 3 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|241085 cd12641, RRM_TRA2B, RNA recognition motif in Transformer-2 protein homolog beta (TRA-2 beta) and similar proteins Back     alignment and domain information
>gnl|CDD|240853 cd12407, RRM_FOX1_like, RNA recognition motif in vertebrate RNA binding protein fox-1 homologs and similar proteins Back     alignment and domain information
>gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>gnl|CDD|240774 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A subfamily Back     alignment and domain information
>gnl|CDD|240939 cd12495, RRM3_hnRNPQ, RNA recognition motif 3 in vertebrate heterogeneous nuclear ribonucleoprotein Q (hnRNP Q) Back     alignment and domain information
>gnl|CDD|241065 cd12621, RRM3_TIA1, RNA recognition motif 3 in nucleolysin TIA-1 isoform p40 (p40-TIA-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240839 cd12393, RRM_ZCRB1, RNA recognition motif in Zinc finger CCHC-type and RNA-binding motif-containing protein 1 (ZCRB1) and similar proteins Back     alignment and domain information
>gnl|CDD|241076 cd12632, RRM1_CELF3_4_5_6, RNA recognition motif 1 in CUGBP Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6 and similar proteins Back     alignment and domain information
>gnl|CDD|240753 cd12307, RRM_NIFK_like, RNA recognition motif in nucleolar protein interacting with the FHA domain of pKI-67 (NIFK) and similar proteins Back     alignment and domain information
>gnl|CDD|241050 cd12606, RRM1_RBM4, RNA recognition motif 1 in vertebrate RNA-binding protein 4 (RBM4) Back     alignment and domain information
>gnl|CDD|240752 cd12306, RRM_II_PABPs, RNA recognition motif in type II polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|241053 cd12609, RRM2_CoAA, RNA recognition motif 2 in vertebrate RRM-containing coactivator activator/modulator (CoAA) Back     alignment and domain information
>gnl|CDD|241213 cd12769, RRM1_HuR, RNA recognition motif 1 in vertebrate Hu-antigen R (HuR) Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|240835 cd12389, RRM2_RAVER, RNA recognition motif 2 in ribonucleoprotein PTB-binding raver-1, raver-2 and similar proteins Back     alignment and domain information
>gnl|CDD|241037 cd12593, RRM_RBM11, RNA recognition motif in vertebrate RNA-binding protein 11 (RBM11) Back     alignment and domain information
>gnl|CDD|241075 cd12631, RRM1_CELF1_2_Bruno, RNA recognition motif 1 in CUGBP Elav-like family member CELF-1, CELF-2, Drosophila melanogaster Bruno protein and similar proteins Back     alignment and domain information
>gnl|CDD|240803 cd12357, RRM_PPARGC1A_like, RNA recognition motif in the peroxisome proliferator-activated receptor gamma coactivator 1A (PGC-1alpha) family of regulated coactivators Back     alignment and domain information
>gnl|CDD|241120 cd12676, RRM3_Nop4p, RNA recognition motif 3 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240688 cd12242, RRM_SLIRP, RNA recognition motif found in SRA stem-loop-interacting RNA-binding protein (SLIRP) and similar proteins Back     alignment and domain information
>gnl|CDD|241015 cd12571, RRM6_RBM19, RNA recognition motif 6 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|240756 cd12310, RRM3_Spen, RNA recognition motif 3 in the Spen (split end) protein family Back     alignment and domain information
>gnl|CDD|240941 cd12497, RRM3_RBM47, RNA recognition motif 3 in vertebrate RNA-binding protein 47 (RBM47) Back     alignment and domain information
>gnl|CDD|241216 cd12772, RRM1_HuC, RNA recognition motif 1 in vertebrate Hu-antigen C (HuC) Back     alignment and domain information
>gnl|CDD|240791 cd12345, RRM2_SECp43_like, RNA recognition motif 2 in tRNA selenocysteine-associated protein 1 (SECp43) and similar proteins Back     alignment and domain information
>gnl|CDD|240858 cd12412, RRM_DAZL_BOULE, RNA recognition motif in AZoospermia (DAZ) autosomal homologs, DAZL (DAZ-like) and BOULE Back     alignment and domain information
>gnl|CDD|240894 cd12448, RRM2_gar2, RNA recognition motif 2 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|240853 cd12407, RRM_FOX1_like, RNA recognition motif in vertebrate RNA binding protein fox-1 homologs and similar proteins Back     alignment and domain information
>gnl|CDD|240938 cd12494, RRM3_hnRNPR, RNA recognition motif 3 in vertebrate heterogeneous nuclear ribonucleoprotein R (hnRNP R) Back     alignment and domain information
>gnl|CDD|241018 cd12574, RRM1_DAZAP1, RNA recognition motif 1 in Deleted in azoospermia-associated protein 1 (DAZAP1) and similar proteins Back     alignment and domain information
>gnl|CDD|241117 cd12673, RRM_BOULE, RNA recognition motif in protein BOULE Back     alignment and domain information
>gnl|CDD|130689 TIGR01628, PABP-1234, polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>gnl|CDD|240690 cd12244, RRM2_MSSP, RNA recognition motif 2 in the c-myc gene single-strand binding proteins (MSSP) family Back     alignment and domain information
>gnl|CDD|240757 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in serine/arginine-rich splicing factor SRSF2, SRSF8 and similar proteins Back     alignment and domain information
>gnl|CDD|240757 cd12311, RRM_SRSF2_SRSF8, RNA recognition motif in serine/arginine-rich splicing factor SRSF2, SRSF8 and similar proteins Back     alignment and domain information
>gnl|CDD|240862 cd12416, RRM4_RBM28_like, RNA recognition motif 4 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|241215 cd12771, RRM1_HuB, RNA recognition motif 1 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|241215 cd12771, RRM1_HuB, RNA recognition motif 1 in vertebrate Hu-antigen B (HuB) Back     alignment and domain information
>gnl|CDD|240854 cd12408, RRM_eIF3G_like, RNA recognition motif in eukaryotic translation initiation factor 3 subunit G (eIF-3G) and similar proteins Back     alignment and domain information
>gnl|CDD|240774 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A subfamily Back     alignment and domain information
>gnl|CDD|240678 cd12232, RRM3_U2AF65, RNA recognition motif 3 found in U2 large nuclear ribonucleoprotein auxiliary factor U2AF 65 kDa subunit (U2AF65) and similar proteins Back     alignment and domain information
>gnl|CDD|130706 TIGR01645, half-pint, poly-U binding splicing factor, half-pint family Back     alignment and domain information
>gnl|CDD|240830 cd12384, RRM_RBM24_RBM38_like, RNA recognition motif in eukaryotic RNA-binding protein RBM24, RBM38 and similar proteins Back     alignment and domain information
>gnl|CDD|241081 cd12637, RRM2_FCA, RNA recognition motif 2 in plant flowering time control protein FCA and similar proteins Back     alignment and domain information
>gnl|CDD|240968 cd12524, RRM1_MEI2_like, RNA recognition motif 1 in plant Mei2-like proteins Back     alignment and domain information
>gnl|CDD|240866 cd12420, RRM_RBPMS_like, RNA recognition motif in RNA-binding protein with multiple splicing (RBP-MS)-like proteins Back     alignment and domain information
>gnl|CDD|241030 cd12586, RRM1_PSP1, RNA recognition motif 1 in vertebrate paraspeckle protein 1 (PSP1) Back     alignment and domain information
>gnl|CDD|241021 cd12577, RRM1_Hrp1p, RNA recognition motif 1 in yeast nuclear polyadenylated RNA-binding protein 4 (Hrp1p or Nab4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240783 cd12337, RRM1_SRSF4_like, RNA recognition motif 1 in serine/arginine-rich splicing factor 4 (SRSF4) and similar proteins Back     alignment and domain information
>gnl|CDD|240858 cd12412, RRM_DAZL_BOULE, RNA recognition motif in AZoospermia (DAZ) autosomal homologs, DAZL (DAZ-like) and BOULE Back     alignment and domain information
>gnl|CDD|240914 cd12470, RRM1_MSSP1, RNA recognition motif 1 in vertebrate single-stranded DNA-binding protein MSSP-1 Back     alignment and domain information
>gnl|CDD|240819 cd12373, RRM_SRSF3_like, RNA recognition motif in serine/arginine-rich splicing factor 3 (SRSF3) and similar proteins Back     alignment and domain information
>gnl|CDD|241011 cd12567, RRM3_RBM19, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|240833 cd12387, RRM3_hnRNPM_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein M (hnRNP M) and similar proteins Back     alignment and domain information
>gnl|CDD|240916 cd12472, RRM1_RBMS3, RNA recognition motif 1 found in vertebrate RNA-binding motif, single-stranded-interacting protein 3 (RBMS3) Back     alignment and domain information
>gnl|CDD|130706 TIGR01645, half-pint, poly-U binding splicing factor, half-pint family Back     alignment and domain information
>gnl|CDD|240968 cd12524, RRM1_MEI2_like, RNA recognition motif 1 in plant Mei2-like proteins Back     alignment and domain information
>gnl|CDD|240672 cd12226, RRM_NOL8, RNA recognition motif in nucleolar protein 8 (NOL8) and similar proteins Back     alignment and domain information
>gnl|CDD|240672 cd12226, RRM_NOL8, RNA recognition motif in nucleolar protein 8 (NOL8) and similar proteins Back     alignment and domain information
>gnl|CDD|240787 cd12341, RRM_hnRNPC_like, RNA recognition motif in heterogeneous nuclear ribonucleoprotein C (hnRNP C)-related proteins Back     alignment and domain information
>gnl|CDD|241080 cd12636, RRM2_Bruno_like, RNA recognition motif 2 in Drosophila melanogaster Bruno protein and similar proteins Back     alignment and domain information
>gnl|CDD|240772 cd12326, RRM1_hnRNPA0, RNA recognition motif 1 found in heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0) and similar proteins Back     alignment and domain information
>gnl|CDD|240766 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition motif 6 in RNA-binding protein 19 (RBM19 or RBD-1) and RNA recognition motif 5 in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|241214 cd12770, RRM1_HuD, RNA recognition motif 1 in vertebrate Hu-antigen D (HuD) Back     alignment and domain information
>gnl|CDD|240681 cd12235, RRM_PPIL4, RNA recognition motif in peptidyl-prolyl cis-trans isomerase-like 4 (PPIase) and similar proteins Back     alignment and domain information
>gnl|CDD|240917 cd12473, RRM2_MSSP1, RNA recognition motif 2 found in vertebrate single-stranded DNA-binding protein MSSP-1 Back     alignment and domain information
>gnl|CDD|241058 cd12614, RRM1_PUB1, RNA recognition motif 1 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|240790 cd12344, RRM1_SECp43_like, RNA recognition motif 1 in tRNA selenocysteine-associated protein 1 (SECp43) and similar proteins Back     alignment and domain information
>gnl|CDD|240759 cd12313, RRM1_RRM2_RBM5_like, RNA recognition motif 1 and 2 in RNA-binding protein 5 (RBM5) and similar proteins Back     alignment and domain information
>gnl|CDD|240792 cd12346, RRM3_NGR1_NAM8_like, RNA recognition motif 3 in yeast negative growth regulatory protein NGR1 (RBP1), yeast protein NAM8 and similar proteins Back     alignment and domain information
>gnl|CDD|240893 cd12447, RRM1_gar2, RNA recognition motif 1 in yeast protein gar2 and similar proteins Back     alignment and domain information
>gnl|CDD|240864 cd12418, RRM_Aly_REF_like, RNA recognition motif in the Aly/REF family Back     alignment and domain information
>gnl|CDD|240914 cd12470, RRM1_MSSP1, RNA recognition motif 1 in vertebrate single-stranded DNA-binding protein MSSP-1 Back     alignment and domain information
>gnl|CDD|240776 cd12330, RRM2_Hrp1p, RNA recognition motif 2 in yeast nuclear polyadenylated RNA-binding protein 4 (Hrp1p or Nab4p) and similar proteins Back     alignment and domain information
>gnl|CDD|241030 cd12586, RRM1_PSP1, RNA recognition motif 1 in vertebrate paraspeckle protein 1 (PSP1) Back     alignment and domain information
>gnl|CDD|240718 cd12272, RRM2_PHIP1, RNA recognition motif 2 in Arabidopsis thaliana phragmoplastin interacting protein 1 (PHIP1) and similar proteins Back     alignment and domain information
>gnl|CDD|240863 cd12417, RRM_SAFB_like, RNA recognition motif in the scaffold attachment factor (SAFB) family Back     alignment and domain information
>gnl|CDD|240758 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif in serine/arginine-rich splicing factor SRSF10, SRSF12 and similar proteins Back     alignment and domain information
>gnl|CDD|240915 cd12471, RRM1_MSSP2, RNA recognition motif 1 in vertebrate single-stranded DNA-binding protein MSSP-2 Back     alignment and domain information
>gnl|CDD|240915 cd12471, RRM1_MSSP2, RNA recognition motif 1 in vertebrate single-stranded DNA-binding protein MSSP-2 Back     alignment and domain information
>gnl|CDD|240687 cd12241, RRM_SF3B14, RNA recognition motif found in pre-mRNA branch site protein p14 (SF3B14) and similar proteins Back     alignment and domain information
>gnl|CDD|240722 cd12276, RRM2_MEI2_EAR1_like, RNA recognition motif 2 in Mei2-like proteins and terminal EAR1-like proteins Back     alignment and domain information
>gnl|CDD|241200 cd12756, RRM1_hnRNPD, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein D0 (hnRNP D0) and similar proteins Back     alignment and domain information
>gnl|CDD|240855 cd12409, RRM1_RRT5, RNA recognition motif 1 in yeast regulator of rDNA transcription protein 5 (RRT5) and similar proteins Back     alignment and domain information
>gnl|CDD|241064 cd12620, RRM3_TIAR, RNA recognition motif 3 in nucleolysin TIAR and similar proteins Back     alignment and domain information
>gnl|CDD|241214 cd12770, RRM1_HuD, RNA recognition motif 1 in vertebrate Hu-antigen D (HuD) Back     alignment and domain information
>gnl|CDD|241079 cd12635, RRM2_CELF3_4_5_6, RNA recognition motif 2 in CUGBP Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6 and similar proteins Back     alignment and domain information
>gnl|CDD|240683 cd12237, RRM_snRNP35, RNA recognition motif found in U11/U12 small nuclear ribonucleoprotein 35 kDa protein (U11/U12-35K) and similar proteins Back     alignment and domain information
>gnl|CDD|240918 cd12474, RRM2_MSSP2, RNA recognition motif 2 found in vertebrate single-stranded DNA-binding protein MSSP-2 Back     alignment and domain information
>gnl|CDD|240686 cd12240, RRM_NCBP2, RNA recognition motif found in nuclear cap-binding protein subunit 2 (CBP20) and similar proteins Back     alignment and domain information
>gnl|CDD|240767 cd12321, RRM1_TDP43, RNA recognition motif 1 in TAR DNA-binding protein 43 (TDP-43) and similar proteins Back     alignment and domain information
>gnl|CDD|241052 cd12608, RRM1_CoAA, RNA recognition motif 1 in vertebrate RRM-containing coactivator activator/modulator (CoAA) Back     alignment and domain information
>gnl|CDD|241053 cd12609, RRM2_CoAA, RNA recognition motif 2 in vertebrate RRM-containing coactivator activator/modulator (CoAA) Back     alignment and domain information
>gnl|CDD|130706 TIGR01645, half-pint, poly-U binding splicing factor, half-pint family Back     alignment and domain information
>gnl|CDD|241021 cd12577, RRM1_Hrp1p, RNA recognition motif 1 in yeast nuclear polyadenylated RNA-binding protein 4 (Hrp1p or Nab4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240687 cd12241, RRM_SF3B14, RNA recognition motif found in pre-mRNA branch site protein p14 (SF3B14) and similar proteins Back     alignment and domain information
>gnl|CDD|240713 cd12267, RRM_YRA1_MLO3, RNA recognition motif in yeast RNA annealing protein YRA1 (Yra1p), yeast mRNA export protein mlo3 and similar proteins Back     alignment and domain information
>gnl|CDD|241203 cd12759, RRM1_MSI1, RNA recognition motif 1 in RNA-binding protein Musashi homolog 1 (Musashi-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240929 cd12485, RRM1_RBM47, RNA recognition motif 1 found in vertebrate RNA-binding protein 47 (RBM47) Back     alignment and domain information
>gnl|CDD|240966 cd12522, RRM4_MRN1, RNA recognition motif 4 of RNA-binding protein MRN1 and similar proteins Back     alignment and domain information
>gnl|CDD|240708 cd12262, RRM2_4_MRN1, RNA recognition motif 2 and 4 in RNA-binding protein MRN1 and similar proteins Back     alignment and domain information
>gnl|CDD|241074 cd12630, RRM2_IGF2BP3, RNA recognition motif 2 in vertebrate insulin-like growth factor 2 mRNA-binding protein 3 (IGF2BP3) Back     alignment and domain information
>gnl|CDD|241020 cd12576, RRM1_MSI, RNA recognition motif 1 in RNA-binding protein Musashi homolog Musashi-1, Musashi-2 and similar proteins Back     alignment and domain information
>gnl|CDD|241119 cd12675, RRM2_Nop4p, RNA recognition motif 2 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|241016 cd12572, RRM2_MSI1, RNA recognition motif 2 in RNA-binding protein Musashi homolog 1 (Musashi-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240861 cd12415, RRM3_RBM28_like, RNA recognition motif 3 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240916 cd12472, RRM1_RBMS3, RNA recognition motif 1 found in vertebrate RNA-binding motif, single-stranded-interacting protein 3 (RBMS3) Back     alignment and domain information
>gnl|CDD|130706 TIGR01645, half-pint, poly-U binding splicing factor, half-pint family Back     alignment and domain information
>gnl|CDD|240942 cd12498, RRM3_ACF, RNA recognition motif 3 in vertebrate APOBEC-1 complementation factor (ACF) Back     alignment and domain information
>gnl|CDD|241205 cd12761, RRM1_hnRNPA1, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) and similar proteins Back     alignment and domain information
>gnl|CDD|241216 cd12772, RRM1_HuC, RNA recognition motif 1 in vertebrate Hu-antigen C (HuC) Back     alignment and domain information
>gnl|CDD|241213 cd12769, RRM1_HuR, RNA recognition motif 1 in vertebrate Hu-antigen R (HuR) Back     alignment and domain information
>gnl|CDD|241081 cd12637, RRM2_FCA, RNA recognition motif 2 in plant flowering time control protein FCA and similar proteins Back     alignment and domain information
>gnl|CDD|241020 cd12576, RRM1_MSI, RNA recognition motif 1 in RNA-binding protein Musashi homolog Musashi-1, Musashi-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240719 cd12273, RRM1_NEFsp, RNA recognition motif 1 in vertebrate putative RNA exonuclease NEF-sp Back     alignment and domain information
>gnl|CDD|240915 cd12471, RRM1_MSSP2, RNA recognition motif 1 in vertebrate single-stranded DNA-binding protein MSSP-2 Back     alignment and domain information
>gnl|CDD|240973 cd12529, RRM2_MEI2_like, RNA recognition motif 2 in plant Mei2-like proteins Back     alignment and domain information
>gnl|CDD|241078 cd12634, RRM2_CELF1_2, RNA recognition motif 2 in CUGBP Elav-like family member CELF-1, CELF-2 and similar proteins Back     alignment and domain information
>gnl|CDD|240697 cd12251, RRM3_hnRNPR_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information
>gnl|CDD|240877 cd12431, RRM_ALKBH8, RNA recognition motif in alkylated DNA repair protein alkB homolog 8 (ALKBH8) and similar proteins Back     alignment and domain information
>gnl|CDD|241029 cd12585, RRM2_hnRPDL, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein D-like (hnRNP DL) and similar proteins Back     alignment and domain information
>gnl|CDD|241095 cd12651, RRM2_SXL, RNA recognition motif 2 in Drosophila sex-lethal (SXL) and similar proteins Back     alignment and domain information
>gnl|CDD|241056 cd12612, RRM2_SECp43, RNA recognition motif 2 in tRNA selenocysteine-associated protein 1 (SECp43) Back     alignment and domain information
>gnl|CDD|241032 cd12588, RRM1_p54nrb, RNA recognition motif 1 in vertebrate 54 kDa nuclear RNA- and DNA-binding protein (p54nrb) Back     alignment and domain information
>gnl|CDD|240695 cd12249, RRM1_hnRNPR_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein R (hnRNP R) and similar proteins Back     alignment and domain information
>gnl|CDD|241072 cd12628, RRM2_IGF2BP1, RNA recognition motif 2 in vertebrate insulin-like growth factor 2 mRNA-binding protein 1 (IGF2BP1) Back     alignment and domain information
>gnl|CDD|241118 cd12674, RRM1_Nop4p, RNA recognition motif 1 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240764 cd12318, RRM5_RBM19_like, RNA recognition motif 5 in RNA-binding protein 19 (RBM19 or RBD-1) and similar proteins Back     alignment and domain information
>gnl|CDD|241077 cd12633, RRM1_FCA, RNA recognition motif 1 in plant flowering time control protein FCA and similar proteins Back     alignment and domain information
>gnl|CDD|240805 cd12359, RRM2_VICKZ, RNA recognition motif 2 in the VICKZ family proteins Back     alignment and domain information
>gnl|CDD|241022 cd12578, RRM1_hnRNPA_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A subfamily Back     alignment and domain information
>gnl|CDD|240744 cd12298, RRM3_Prp24, RNA recognition motif 3 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|240774 cd12328, RRM2_hnRNPA_like, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A subfamily Back     alignment and domain information
>gnl|CDD|241050 cd12606, RRM1_RBM4, RNA recognition motif 1 in vertebrate RNA-binding protein 4 (RBM4) Back     alignment and domain information
>gnl|CDD|241120 cd12676, RRM3_Nop4p, RNA recognition motif 3 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240862 cd12416, RRM4_RBM28_like, RNA recognition motif 4 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240772 cd12326, RRM1_hnRNPA0, RNA recognition motif 1 found in heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0) and similar proteins Back     alignment and domain information
>gnl|CDD|240863 cd12417, RRM_SAFB_like, RNA recognition motif in the scaffold attachment factor (SAFB) family Back     alignment and domain information
>gnl|CDD|241119 cd12675, RRM2_Nop4p, RNA recognition motif 2 in yeast nucleolar protein 4 (Nop4p) and similar proteins Back     alignment and domain information
>gnl|CDD|240719 cd12273, RRM1_NEFsp, RNA recognition motif 1 in vertebrate putative RNA exonuclease NEF-sp Back     alignment and domain information
>gnl|CDD|241125 cd12681, RRM_SKAR, RNA recognition motif in S6K1 Aly/REF-like target (SKAR) and similar proteins Back     alignment and domain information
>gnl|CDD|241124 cd12680, RRM_THOC4, RNA recognition motif in THO complex subunit 4 (THOC4) and similar proteins Back     alignment and domain information
>gnl|CDD|233507 TIGR01648, hnRNP-R-Q, heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>gnl|CDD|241040 cd12596, RRM1_SRSF6, RNA recognition motif 1 in vertebrate serine/arginine-rich splicing factor 6 (SRSF6) Back     alignment and domain information
>gnl|CDD|241116 cd12672, RRM_DAZL, RNA recognition motif in vertebrate deleted in azoospermia-like (DAZL) proteins Back     alignment and domain information
>gnl|CDD|241066 cd12622, RRM3_PUB1, RNA recognition motif 3 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|233515 TIGR01659, sex-lethal, sex-lethal family splicing factor Back     alignment and domain information
>gnl|CDD|240919 cd12475, RRM2_RBMS3, RNA recognition motif 2 found in vertebrate RNA-binding motif, single-stranded-interacting protein 3 (RBMS3) Back     alignment and domain information
>gnl|CDD|240683 cd12237, RRM_snRNP35, RNA recognition motif found in U11/U12 small nuclear ribonucleoprotein 35 kDa protein (U11/U12-35K) and similar proteins Back     alignment and domain information
>gnl|CDD|240819 cd12373, RRM_SRSF3_like, RNA recognition motif in serine/arginine-rich splicing factor 3 (SRSF3) and similar proteins Back     alignment and domain information
>gnl|CDD|240814 cd12368, RRM3_RBM45, RNA recognition motif 3 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|240892 cd12446, RRM_RBM25, RNA recognition motif in eukaryotic RNA-binding protein 25 and similar proteins Back     alignment and domain information
>gnl|CDD|240833 cd12387, RRM3_hnRNPM_like, RNA recognition motif 3 in heterogeneous nuclear ribonucleoprotein M (hnRNP M) and similar proteins Back     alignment and domain information
>gnl|CDD|233503 TIGR01642, U2AF_lg, U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>gnl|CDD|241075 cd12631, RRM1_CELF1_2_Bruno, RNA recognition motif 1 in CUGBP Elav-like family member CELF-1, CELF-2, Drosophila melanogaster Bruno protein and similar proteins Back     alignment and domain information
>gnl|CDD|240862 cd12416, RRM4_RBM28_like, RNA recognition motif 4 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240758 cd12312, RRM_SRSF10_SRSF12, RNA recognition motif in serine/arginine-rich splicing factor SRSF10, SRSF12 and similar proteins Back     alignment and domain information
>gnl|CDD|241032 cd12588, RRM1_p54nrb, RNA recognition motif 1 in vertebrate 54 kDa nuclear RNA- and DNA-binding protein (p54nrb) Back     alignment and domain information
>gnl|CDD|233507 TIGR01648, hnRNP-R-Q, heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>gnl|CDD|241204 cd12760, RRM1_MSI2, RNA recognition motif 1 in RNA-binding protein Musashi homolog 2 (Musashi-2 ) and similar proteins Back     alignment and domain information
>gnl|CDD|241204 cd12760, RRM1_MSI2, RNA recognition motif 1 in RNA-binding protein Musashi homolog 2 (Musashi-2 ) and similar proteins Back     alignment and domain information
>gnl|CDD|240724 cd12278, RRM_eIF3B, RNA recognition motif in eukaryotic translation initiation factor 3 subunit B (eIF-3B) and similar proteins Back     alignment and domain information
>gnl|CDD|241019 cd12575, RRM1_hnRNPD_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein hnRNP D0, hnRNP A/B, hnRNP DL and similar proteins Back     alignment and domain information
>gnl|CDD|240846 cd12400, RRM_Nop6, RNA recognition motif in Saccharomyces cerevisiae nucleolar protein 6 (Nop6) and similar proteins Back     alignment and domain information
>gnl|CDD|241028 cd12584, RRM2_hnRNPAB, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A/B (hnRNP A/B) and similar proteins Back     alignment and domain information
>gnl|CDD|240755 cd12309, RRM2_Spen, RNA recognition motif 2 in the Spen (split end) protein family Back     alignment and domain information
>gnl|CDD|241017 cd12573, RRM2_MSI2, RNA recognition motif 2 in RNA-binding protein Musashi homolog 2 (Musashi-2) and similar proteins Back     alignment and domain information
>gnl|CDD|241123 cd12679, RRM_SAFB1_SAFB2, RNA recognition motif in scaffold attachment factor B1 (SAFB1), scaffold attachment factor B2 (SAFB2), and similar proteins Back     alignment and domain information
>gnl|CDD|240823 cd12377, RRM3_Hu, RNA recognition motif 3 in the Hu proteins family Back     alignment and domain information
>gnl|CDD|240822 cd12376, RRM2_Hu_like, RNA recognition motif 2 in the Hu proteins family, Drosophila sex-lethal (SXL), and similar proteins Back     alignment and domain information
>gnl|CDD|240789 cd12343, RRM1_2_CoAA_like, RNA recognition motif 1 and 2 in RRM-containing coactivator activator/modulator (CoAA) and similar proteins Back     alignment and domain information
>gnl|CDD|240939 cd12495, RRM3_hnRNPQ, RNA recognition motif 3 in vertebrate heterogeneous nuclear ribonucleoprotein Q (hnRNP Q) Back     alignment and domain information
>gnl|CDD|240941 cd12497, RRM3_RBM47, RNA recognition motif 3 in vertebrate RNA-binding protein 47 (RBM47) Back     alignment and domain information
>gnl|CDD|241203 cd12759, RRM1_MSI1, RNA recognition motif 1 in RNA-binding protein Musashi homolog 1 (Musashi-1) and similar proteins Back     alignment and domain information
>gnl|CDD|233507 TIGR01648, hnRNP-R-Q, heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>gnl|CDD|241024 cd12580, RRM2_hnRNPA1, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) and similar proteins Back     alignment and domain information
>gnl|CDD|241141 cd12697, RRM3_ROD1, RNA recognition motif 3 in vertebrate regulator of differentiation 1 (Rod1) Back     alignment and domain information
>gnl|CDD|241202 cd12758, RRM1_hnRPDL, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein D-like (hnRNP D-like or hnRNP DL) and similar proteins Back     alignment and domain information
>gnl|CDD|241112 cd12668, RRM3_RAVER2, RNA recognition motif 3 found in vertebrate ribonucleoprotein PTB-binding 2 (raver-2) Back     alignment and domain information
>gnl|CDD|240802 cd12356, RRM_PPARGC1B, RNA recognition motif in peroxisome proliferator-activated receptor gamma coactivator 1-beta (PGC-1-beta) and similar proteins Back     alignment and domain information
>gnl|CDD|240905 cd12459, RRM1_CID8_like, RNA recognition motif 1 in Arabidopsis thaliana CTC-interacting domain protein CID8, CID9, CID10, CID11, CID12, CID 13 and similar proteins Back     alignment and domain information
>gnl|CDD|241008 cd12564, RRM1_RBM19, RNA recognition motif 1 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|241080 cd12636, RRM2_Bruno_like, RNA recognition motif 2 in Drosophila melanogaster Bruno protein and similar proteins Back     alignment and domain information
>gnl|CDD|241205 cd12761, RRM1_hnRNPA1, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A1 (hnRNP A1) and similar proteins Back     alignment and domain information
>gnl|CDD|240898 cd12452, RRM_ARP_like, RNA recognition motif in yeast asparagine-rich protein (ARP) and similar proteins Back     alignment and domain information
>gnl|CDD|241039 cd12595, RRM1_SRSF5, RNA recognition motif 1 in vertebrate serine/arginine-rich splicing factor 5 (SRSF5) Back     alignment and domain information
>gnl|CDD|240926 cd12482, RRM1_hnRNPR, RNA recognition motif 1 in vertebrate heterogeneous nuclear ribonucleoprotein R (hnRNP R) Back     alignment and domain information
>gnl|CDD|240801 cd12355, RRM_RBM18, RNA recognition motif in eukaryotic RNA-binding protein 18 and similar proteins Back     alignment and domain information
>gnl|CDD|241023 cd12579, RRM2_hnRNPA0, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A0 (hnRNP A0) and similar proteins Back     alignment and domain information
>gnl|CDD|240688 cd12242, RRM_SLIRP, RNA recognition motif found in SRA stem-loop-interacting RNA-binding protein (SLIRP) and similar proteins Back     alignment and domain information
>gnl|CDD|240863 cd12417, RRM_SAFB_like, RNA recognition motif in the scaffold attachment factor (SAFB) family Back     alignment and domain information
>gnl|CDD|240913 cd12467, RRM_Srp1p_like, RNA recognition motif 1 in fission yeast pre-mRNA-splicing factor Srp1p and similar proteins Back     alignment and domain information
>gnl|CDD|240804 cd12358, RRM1_VICKZ, RNA recognition motif 1 in the VICKZ family proteins Back     alignment and domain information
>gnl|CDD|240736 cd12290, RRM1_LARP7, RNA recognition motif 1 in La-related protein 7 (LARP7) and similar proteins Back     alignment and domain information
>gnl|CDD|240928 cd12484, RRM1_RBM46, RNA recognition motif 1 found in vertebrate RNA-binding protein 46 (RBM46) Back     alignment and domain information
>gnl|CDD|240940 cd12496, RRM3_RBM46, RNA recognition motif 3 in vertebrate RNA-binding protein 46 (RBM46) Back     alignment and domain information
>gnl|CDD|241051 cd12607, RRM2_RBM4, RNA recognition motif 2 in vertebrate RNA-binding protein 4 (RBM4) Back     alignment and domain information
>gnl|CDD|241063 cd12619, RRM2_PUB1, RNA recognition motif 2 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|241062 cd12618, RRM2_TIA1, RNA recognition motif 2 in nucleolysin TIA-1 isoform p40 (p40-TIA-1) and similar proteins Back     alignment and domain information
>gnl|CDD|241061 cd12617, RRM2_TIAR, RNA recognition motif 2 in nucleolysin TIAR and similar proteins Back     alignment and domain information
>gnl|CDD|240759 cd12313, RRM1_RRM2_RBM5_like, RNA recognition motif 1 and 2 in RNA-binding protein 5 (RBM5) and similar proteins Back     alignment and domain information
>gnl|CDD|240811 cd12365, RRM_RNPS1, RNA recognition motif in RNA-binding protein with serine-rich domain 1 (RNPS1) and similar proteins Back     alignment and domain information
>gnl|CDD|240783 cd12337, RRM1_SRSF4_like, RNA recognition motif 1 in serine/arginine-rich splicing factor 4 (SRSF4) and similar proteins Back     alignment and domain information
>gnl|CDD|240855 cd12409, RRM1_RRT5, RNA recognition motif 1 in yeast regulator of rDNA transcription protein 5 (RRT5) and similar proteins Back     alignment and domain information
>gnl|CDD|241036 cd12592, RRM_RBM7, RNA recognition motif in vertebrate RNA-binding protein 7 (RBM7) Back     alignment and domain information
>gnl|CDD|240801 cd12355, RRM_RBM18, RNA recognition motif in eukaryotic RNA-binding protein 18 and similar proteins Back     alignment and domain information
>gnl|CDD|240838 cd12392, RRM2_SART3, RNA recognition motif 2 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|241018 cd12574, RRM1_DAZAP1, RNA recognition motif 1 in Deleted in azoospermia-associated protein 1 (DAZAP1) and similar proteins Back     alignment and domain information
>gnl|CDD|240743 cd12297, RRM2_Prp24, RNA recognition motif 2 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|241025 cd12581, RRM2_hnRNPA2B1, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A2/B1 (hnRNP A2/B1) and similar proteins Back     alignment and domain information
>gnl|CDD|241109 cd12665, RRM2_RAVER1, RNA recognition motif 2 found in vertebrate ribonucleoprotein PTB-binding 1 (raver-1) Back     alignment and domain information
>gnl|CDD|240805 cd12359, RRM2_VICKZ, RNA recognition motif 2 in the VICKZ family proteins Back     alignment and domain information
>gnl|CDD|240897 cd12451, RRM2_NUCLs, RNA recognition motif 2 in nucleolin-like proteins mainly from plants Back     alignment and domain information
>gnl|CDD|241206 cd12762, RRM1_hnRNPA2B1, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A2/B1 (hnRNP A2/B1) and similar proteins Back     alignment and domain information
>gnl|CDD|240837 cd12391, RRM1_SART3, RNA recognition motif 1 in squamous cell carcinoma antigen recognized by T-cells 3 (SART3) and similar proteins Back     alignment and domain information
>gnl|CDD|241027 cd12583, RRM2_hnRNPD, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein D0 (hnRNP D0) and similar proteins Back     alignment and domain information
>gnl|CDD|240682 cd12236, RRM_snRNP70, RNA recognition motif in U1 small nuclear ribonucleoprotein 70 kDa (U1-70K) and similar proteins Back     alignment and domain information
>gnl|CDD|240811 cd12365, RRM_RNPS1, RNA recognition motif in RNA-binding protein with serine-rich domain 1 (RNPS1) and similar proteins Back     alignment and domain information
>gnl|CDD|241057 cd12613, RRM2_NGR1_NAM8_like, RNA recognition motif 2 in yeast negative growth regulatory protein NGR1, yeast protein NAM8 and similar proteins Back     alignment and domain information
>gnl|CDD|241079 cd12635, RRM2_CELF3_4_5_6, RNA recognition motif 2 in CUGBP Elav-like family member CELF-3, CELF-4, CELF-5, CELF-6 and similar proteins Back     alignment and domain information
>gnl|CDD|240793 cd12347, RRM_PPIE, RNA recognition motif in cyclophilin-33 (Cyp33) and similar proteins Back     alignment and domain information
>gnl|CDD|241009 cd12565, RRM1_MRD1, RNA recognition motif 1 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240782 cd12336, RRM_RBM7_like, RNA recognition motif in RNA-binding protein 7 (RBM7) and similar proteins Back     alignment and domain information
>gnl|CDD|240860 cd12414, RRM2_RBM28_like, RNA recognition motif 2 in RNA-binding protein 28 (RBM28) and similar proteins Back     alignment and domain information
>gnl|CDD|240816 cd12370, RRM1_PUF60, RNA recognition motif 1 in (U)-binding-splicing factor PUF60 and similar proteins Back     alignment and domain information
>gnl|CDD|241065 cd12621, RRM3_TIA1, RNA recognition motif 3 in nucleolysin TIA-1 isoform p40 (p40-TIA-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240756 cd12310, RRM3_Spen, RNA recognition motif 3 in the Spen (split end) protein family Back     alignment and domain information
>gnl|CDD|241030 cd12586, RRM1_PSP1, RNA recognition motif 1 in vertebrate paraspeckle protein 1 (PSP1) Back     alignment and domain information
>gnl|CDD|241066 cd12622, RRM3_PUB1, RNA recognition motif 3 in yeast nuclear and cytoplasmic polyadenylated RNA-binding protein PUB1 and similar proteins Back     alignment and domain information
>gnl|CDD|240736 cd12290, RRM1_LARP7, RNA recognition motif 1 in La-related protein 7 (LARP7) and similar proteins Back     alignment and domain information
>gnl|CDD|240717 cd12271, RRM1_PHIP1, RNA recognition motif 1 in Arabidopsis thaliana phragmoplastin interacting protein 1 (PHIP1) and similar proteins Back     alignment and domain information
>gnl|CDD|241140 cd12696, RRM3_PTBP2, RNA recognition motif 3 in vertebrate polypyrimidine tract-binding protein 2 (PTBP2) Back     alignment and domain information
>gnl|CDD|240773 cd12327, RRM2_DAZAP1, RNA recognition motif 2 in Deleted in azoospermia-associated protein 1 (DAZAP1) and similar proteins Back     alignment and domain information
>gnl|CDD|240692 cd12246, RRM1_U1A_like, RNA recognition motif 1 in the U1A/U2B"/SNF protein family Back     alignment and domain information
>gnl|CDD|240781 cd12335, RRM2_SF3B4, RNA recognition motif 2 in splicing factor 3B subunit 4 (SF3B4) and similar proteins Back     alignment and domain information
>gnl|CDD|240829 cd12383, RRM_RBM42, RNA recognition motif in RNA-binding protein 42 (RBM42) and similar proteins Back     alignment and domain information
>gnl|CDD|240813 cd12367, RRM2_RBM45, RNA recognition motif 2 in RNA-binding protein 45 (RBM45) and similar proteins Back     alignment and domain information
>gnl|CDD|241010 cd12566, RRM2_MRD1, RNA recognition motif 2 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240751 cd12305, RRM_NELFE, RNA recognition motif in negative elongation factor E (NELF-E) and similar proteins Back     alignment and domain information
>gnl|CDD|241011 cd12567, RRM3_RBM19, RNA recognition motif 3 in RNA-binding protein 19 (RBM19) and similar proteins Back     alignment and domain information
>gnl|CDD|240769 cd12323, RRM2_MSI, RNA recognition motif 2 in RNA-binding protein Musashi homologs Musashi-1, Musashi-2 and similar proteins Back     alignment and domain information
>gnl|CDD|241207 cd12763, RRM1_hnRNPA3, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A3 (hnRNP A3) and similar proteins Back     alignment and domain information
>gnl|CDD|241065 cd12621, RRM3_TIA1, RNA recognition motif 3 in nucleolysin TIA-1 isoform p40 (p40-TIA-1) and similar proteins Back     alignment and domain information
>gnl|CDD|240938 cd12494, RRM3_hnRNPR, RNA recognition motif 3 in vertebrate heterogeneous nuclear ribonucleoprotein R (hnRNP R) Back     alignment and domain information
>gnl|CDD|240766 cd12320, RRM6_RBM19_RRM5_MRD1, RNA recognition motif 6 in RNA-binding protein 19 (RBM19 or RBD-1) and RNA recognition motif 5 in multiple RNA-binding domain-containing protein 1 (MRD1) Back     alignment and domain information
>gnl|CDD|240722 cd12276, RRM2_MEI2_EAR1_like, RNA recognition motif 2 in Mei2-like proteins and terminal EAR1-like proteins Back     alignment and domain information
>gnl|CDD|241064 cd12620, RRM3_TIAR, RNA recognition motif 3 in nucleolysin TIAR and similar proteins Back     alignment and domain information
>gnl|CDD|241123 cd12679, RRM_SAFB1_SAFB2, RNA recognition motif in scaffold attachment factor B1 (SAFB1), scaffold attachment factor B2 (SAFB2), and similar proteins Back     alignment and domain information
>gnl|CDD|240897 cd12451, RRM2_NUCLs, RNA recognition motif 2 in nucleolin-like proteins mainly from plants Back     alignment and domain information
>gnl|CDD|240852 cd12406, RRM4_NCL, RNA recognition motif 4 in vertebrate nucleolin Back     alignment and domain information
>gnl|CDD|240721 cd12275, RRM1_MEI2_EAR1_like, RNA recognition motif 1 in Mei2-like proteins and terminal EAR1-like proteins Back     alignment and domain information
>gnl|CDD|240908 cd12462, RRM_SCAF8, RNA recognition motif in SR-related and CTD-associated factor 8 (SCAF8) and similar proteins Back     alignment and domain information
>gnl|CDD|240749 cd12303, RRM_spSet1p_like, RNA recognition motif in fission yeast Schizosaccharomyces pombe SET domain-containing protein 1 (spSet1p) and similar proteins Back     alignment and domain information
>gnl|CDD|241014 cd12570, RRM5_MRD1, RNA recognition motif 5 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240869 cd12423, RRM3_PTBP1_like, RNA recognition motif 3 in polypyrimidine tract-binding protein 1 (PTB or hnRNP I) and similar proteins Back     alignment and domain information
>gnl|CDD|240700 cd12254, RRM_hnRNPH_ESRPs_RBM12_like, RNA recognition motif found in heterogeneous nuclear ribonucleoprotein (hnRNP) H protein family, epithelial splicing regulatory proteins (ESRPs), Drosophila RNA-binding protein Fusilli, RNA-binding protein 12 (RBM12) and similar proteins Back     alignment and domain information
>gnl|CDD|241009 cd12565, RRM1_MRD1, RNA recognition motif 1 in yeast multiple RNA-binding domain-containing protein 1 (MRD1) and similar proteins Back     alignment and domain information
>gnl|CDD|240686 cd12240, RRM_NCBP2, RNA recognition motif found in nuclear cap-binding protein subunit 2 (CBP20) and similar proteins Back     alignment and domain information
>gnl|CDD|240752 cd12306, RRM_II_PABPs, RNA recognition motif in type II polyadenylate-binding proteins Back     alignment and domain information
>gnl|CDD|241037 cd12593, RRM_RBM11, RNA recognition motif in vertebrate RNA-binding protein 11 (RBM11) Back     alignment and domain information
>gnl|CDD|241018 cd12574, RRM1_DAZAP1, RNA recognition motif 1 in Deleted in azoospermia-associated protein 1 (DAZAP1) and similar proteins Back     alignment and domain information
>gnl|CDD|241117 cd12673, RRM_BOULE, RNA recognition motif in protein BOULE Back     alignment and domain information
>gnl|CDD|240927 cd12483, RRM1_hnRNPQ, RNA recognition motif 1 in vertebrate heterogeneous nuclear ribonucleoprotein Q (hnRNP Q) Back     alignment and domain information
>gnl|CDD|241026 cd12582, RRM2_hnRNPA3, RNA recognition motif 2 in heterogeneous nuclear ribonucleoprotein A3 (hnRNP A3) and similar proteins Back     alignment and domain information
>gnl|CDD|240797 cd12351, RRM4_SHARP, RNA recognition motif 4 in SMART/HDAC1-associated repressor protein (SHARP) and similar proteins Back     alignment and domain information
>gnl|CDD|240870 cd12424, RRM3_hnRNPL_like, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein L (hnRNP-L) and similar proteins Back     alignment and domain information
>gnl|CDD|240868 cd12422, RRM2_PTBP1_hnRNPL_like, RNA recognition motif in polypyrimidine tract-binding protein 1 (PTB or hnRNP I), heterogeneous nuclear ribonucleoprotein L (hnRNP-L), and similar proteins Back     alignment and domain information
>gnl|CDD|240743 cd12297, RRM2_Prp24, RNA recognition motif 2 in fungal pre-messenger RNA splicing protein 24 (Prp24) and similar proteins Back     alignment and domain information
>gnl|CDD|240670 cd12224, RRM_RBM22, RNA recognition motif (RRM) found in Pre-mRNA-splicing factor RBM22 and similar proteins Back     alignment and domain information
>gnl|CDD|240671 cd12225, RRM1_2_CID8_like, RNA recognition motif 1 and 2 (RRM1, RRM2) in Arabidopsis thaliana CTC-interacting domain protein CID8, CID9, CID10, CID11, CID12, CID 13 and similar proteins Back     alignment and domain information
>gnl|CDD|240727 cd12281, RRM1_TatSF1_like, RNA recognition motif 1 in HIV Tat-specific factor 1 (Tat-SF1) and similar proteins Back     alignment and domain information
>gnl|CDD|241006 cd12562, RRM2_RBM5_like, RNA recognition motif 2 in RNA-binding protein 5 (RBM5) and similar proteins Back     alignment and domain information
>gnl|CDD|241201 cd12757, RRM1_hnRNPAB, RNA recognition motif 1 in heterogeneous nuclear ribonucleoprotein A/B (hnRNP A/B) and similar proteins Back     alignment and domain information
>gnl|CDD|241199 cd12755, RRM2_RBM5, RNA recognition motif 2 in vertebrate RNA-binding protein 5 (RBM5) Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 356
KOG0145|consensus360 100.0
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 100.0
KOG0117|consensus 506 100.0
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 100.0
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 100.0
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 100.0
TIGR01649 481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 100.0
KOG0144|consensus510 100.0
TIGR01622457 SF-CC1 splicing factor, CC1-like family. A homolog 100.0
KOG0127|consensus 678 100.0
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 100.0
TIGR01649481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 100.0
TIGR01642509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 100.0
KOG0148|consensus321 100.0
KOG0123|consensus 369 100.0
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 100.0
KOG0123|consensus369 100.0
TIGR01659346 sex-lethal sex-lethal family splicing factor. This 99.98
KOG0124|consensus 544 99.98
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 99.97
KOG0110|consensus725 99.97
KOG0147|consensus549 99.96
KOG0148|consensus321 99.96
TIGR01661 352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 99.96
TIGR01622 457 SF-CC1 splicing factor, CC1-like family. A homolog 99.96
KOG0144|consensus 510 99.95
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 99.95
KOG0146|consensus371 99.94
KOG0145|consensus 360 99.94
KOG0131|consensus203 99.94
KOG4212|consensus 608 99.94
KOG0127|consensus 678 99.94
KOG1190|consensus 492 99.94
TIGR01642 509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 99.94
KOG0131|consensus203 99.93
KOG0110|consensus 725 99.92
KOG0117|consensus506 99.91
KOG1456|consensus 494 99.9
KOG1190|consensus492 99.9
KOG4211|consensus 510 99.9
KOG0124|consensus 544 99.9
KOG0109|consensus 346 99.9
KOG0109|consensus346 99.89
KOG0147|consensus 549 99.84
KOG4205|consensus311 99.84
KOG0120|consensus500 99.82
KOG0146|consensus371 99.82
KOG1456|consensus494 99.81
KOG4206|consensus221 99.81
KOG0105|consensus241 99.81
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 99.81
KOG4206|consensus221 99.8
KOG4205|consensus 311 99.8
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 99.78
KOG1365|consensus 508 99.76
KOG0105|consensus241 99.76
KOG1548|consensus382 99.71
KOG0122|consensus270 99.7
KOG4211|consensus 510 99.69
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 99.68
KOG1457|consensus284 99.67
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 99.67
KOG1457|consensus284 99.66
KOG4307|consensus 944 99.66
KOG0122|consensus270 99.65
PLN03120 260 nucleic acid binding protein; Provisional 99.63
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 99.62
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 99.62
KOG0121|consensus153 99.62
KOG4207|consensus 256 99.62
KOG0125|consensus 376 99.59
KOG0130|consensus170 99.59
KOG0114|consensus124 99.59
KOG0121|consensus153 99.58
KOG0126|consensus219 99.58
KOG1548|consensus382 99.57
KOG4212|consensus 608 99.57
KOG0113|consensus 335 99.57
KOG0107|consensus195 99.57
KOG0106|consensus216 99.56
KOG0149|consensus 247 99.56
PLN03120260 nucleic acid binding protein; Provisional 99.55
KOG0106|consensus216 99.55
KOG0114|consensus124 99.55
KOG0107|consensus 195 99.54
KOG4207|consensus256 99.54
PLN03121 243 nucleic acid binding protein; Provisional 99.52
COG0724306 RNA-binding proteins (RRM domain) [General functio 99.52
KOG0126|consensus219 99.51
KOG0149|consensus247 99.5
PLN03213 759 repressor of silencing 3; Provisional 99.49
smart0036272 RRM_2 RNA recognition motif. 99.49
PLN03213 759 repressor of silencing 3; Provisional 99.49
smart0036071 RRM RNA recognition motif. 99.48
PLN03121243 nucleic acid binding protein; Provisional 99.48
smart0036272 RRM_2 RNA recognition motif. 99.47
KOG0120|consensus500 99.47
KOG0111|consensus 298 99.46
KOG0108|consensus 435 99.46
KOG0125|consensus376 99.45
KOG4660|consensus 549 99.45
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 99.44
KOG0111|consensus298 99.43
KOG0113|consensus335 99.43
smart0036071 RRM RNA recognition motif. 99.43
KOG0130|consensus170 99.42
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 99.42
smart0036170 RRM_1 RNA recognition motif. 99.42
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 99.38
KOG1365|consensus508 99.38
COG0724306 RNA-binding proteins (RRM domain) [General functio 99.36
KOG0128|consensus881 99.33
KOG0108|consensus435 99.33
KOG0415|consensus 479 99.32
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 99.32
smart0036170 RRM_1 RNA recognition motif. 99.28
KOG0129|consensus520 99.24
KOG0112|consensus 975 99.23
KOG4307|consensus 944 99.2
KOG4454|consensus267 99.19
KOG4208|consensus214 99.18
KOG4208|consensus214 99.16
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 99.15
KOG0415|consensus479 99.13
KOG0129|consensus520 99.11
KOG0153|consensus377 99.11
KOG0132|consensus 894 99.1
KOG4661|consensus 940 99.05
PF0405997 RRM_2: RNA recognition motif 2; InterPro: IPR00720 99.05
KOG4454|consensus267 99.03
KOG0132|consensus 894 99.0
KOG0128|consensus881 99.0
KOG0153|consensus377 98.99
KOG0112|consensus 975 98.98
KOG0226|consensus290 98.94
KOG4210|consensus285 98.92
KOG0151|consensus 877 98.79
KOG4661|consensus 940 98.76
KOG0533|consensus243 98.75
KOG4210|consensus285 98.74
KOG0533|consensus243 98.73
KOG4209|consensus231 98.71
KOG4660|consensus 549 98.66
KOG4676|consensus 479 98.65
KOG0151|consensus 877 98.65
KOG0116|consensus419 98.58
KOG4209|consensus231 98.51
KOG0116|consensus419 98.49
KOG4676|consensus 479 98.44
KOG2193|consensus 584 98.44
PF1160890 Limkain-b1: Limkain b1; InterPro: IPR024582 This e 98.43
KOG0226|consensus290 98.41
PF1160890 Limkain-b1: Limkain b1; InterPro: IPR024582 This e 98.31
KOG2193|consensus 584 98.3
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 98.26
COG5175480 MOT2 Transcriptional repressor [Transcription] 98.25
KOG1995|consensus 351 98.12
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 98.03
KOG2314|consensus 698 97.92
COG5175 480 MOT2 Transcriptional repressor [Transcription] 97.92
PF05172100 Nup35_RRM: Nup53/35/40-type RNA recognition motif; 97.88
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 97.76
KOG3152|consensus 278 97.73
KOG4849|consensus498 97.67
KOG3152|consensus278 97.64
KOG0115|consensus275 97.62
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 97.6
PF05172100 Nup35_RRM: Nup53/35/40-type RNA recognition motif; 97.59
KOG1996|consensus378 97.51
KOG1855|consensus 484 97.47
KOG4849|consensus 498 97.45
KOG1996|consensus378 97.4
KOG0115|consensus 275 97.33
KOG1995|consensus351 97.3
PF08952146 DUF1866: Domain of unknown function (DUF1866) ; In 97.27
PF08952146 DUF1866: Domain of unknown function (DUF1866) ; In 97.26
KOG2314|consensus 698 97.25
KOG1855|consensus484 97.24
KOG2202|consensus 260 97.16
PF1030962 DUF2414: Protein of unknown function (DUF2414); In 97.06
PF15023166 DUF4523: Protein of unknown function (DUF4523) 97.01
KOG2416|consensus718 96.83
PF0867587 RNA_bind: RNA binding domain; InterPro: IPR014789 96.82
KOG2202|consensus260 96.81
PF03467176 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 96.74
KOG2416|consensus 718 96.56
PF07576110 BRAP2: BRCA1-associated protein 2; InterPro: IPR01 96.36
KOG2068|consensus 327 96.32
PF1030962 DUF2414: Protein of unknown function (DUF2414); In 96.21
PF15023166 DUF4523: Protein of unknown function (DUF4523) 96.0
PF07576110 BRAP2: BRCA1-associated protein 2; InterPro: IPR01 95.94
PF04847 184 Calcipressin: Calcipressin; InterPro: IPR006931 Ca 95.79
KOG2135|consensus526 95.55
PF03467176 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 95.5
KOG2591|consensus 684 95.33
PF0867587 RNA_bind: RNA binding domain; InterPro: IPR014789 95.17
KOG2068|consensus327 95.13
KOG0804|consensus493 94.95
KOG4285|consensus350 94.83
KOG2135|consensus526 94.69
KOG0804|consensus 493 94.57
PF0729288 NID: Nmi/IFP 35 domain (NID); InterPro: IPR009909 93.92
PF04847184 Calcipressin: Calcipressin; InterPro: IPR006931 Ca 93.9
KOG2253|consensus 668 93.89
PF0388074 DbpA: DbpA RNA binding domain ; InterPro: IPR00558 93.57
KOG4574|consensus 1007 93.49
KOG2591|consensus 684 93.2
KOG2318|consensus 650 92.84
KOG4285|consensus350 92.42
KOG4574|consensus 1007 92.0
PF0729288 NID: Nmi/IFP 35 domain (NID); InterPro: IPR009909 91.32
PF0388074 DbpA: DbpA RNA binding domain ; InterPro: IPR00558 91.05
PF10567309 Nab6_mRNP_bdg: RNA-recognition motif; InterPro: IP 90.53
KOG2318|consensus 650 90.4
PF1176766 SET_assoc: Histone lysine methyltransferase SET as 90.05
PF1176766 SET_assoc: Histone lysine methyltransferase SET as 89.9
PF0753068 PRE_C2HC: Associated with zinc fingers; InterPro: 84.28
KOG4483|consensus528 83.78
PF14111153 DUF4283: Domain of unknown function (DUF4283) 81.06
>KOG0145|consensus Back     alignment and domain information
Probab=100.00  E-value=8e-53  Score=333.78  Aligned_cols=309  Identities=62%  Similarity=1.058  Sum_probs=270.1

Q ss_pred             CcCCCCceEEEcCCCCCCCHHHHHHHhhccCCceeEEEEecCCCCccceEEEEEecCHHHHHHHHHHhCCceeCCeEEEE
Q psy9313          21 DVNEQNSNLIVNYVPQTMTQEELQHLFSSVGEVESCKLIRDKTTAQSLGYGFVNYYRTEDAERAIIELNGLKLQNKSIKV  100 (356)
Q Consensus        21 ~~~~~~~~l~v~nlp~~~te~~l~~~f~~~g~i~~i~~~~~~~~~~~~g~afV~f~~~~~A~~a~~~l~g~~~~g~~l~v  100 (356)
                      +.+...+.|.|.-||..+|+++|+.+|...|+|++|++++|+.+|.+.||+||.|-+++||.+|+..|||..+..+.|+|
T Consensus        36 ~t~~skTNLIvNYLPQ~MTqdE~rSLF~SiGeiEScKLvRDKitGqSLGYGFVNYv~p~DAe~AintlNGLrLQ~KTIKV  115 (360)
T KOG0145|consen   36 DTDESKTNLIVNYLPQNMTQDELRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYVRPKDAEKAINTLNGLRLQNKTIKV  115 (360)
T ss_pred             CcCcccceeeeeecccccCHHHHHHHhhcccceeeeeeeeccccccccccceeeecChHHHHHHHhhhcceeeccceEEE
Confidence            45677889999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EecCCCcccccccceEEcCCCCCCCHHHHHHhhcccCCeEEEEEecccccccccccccCCCCCCCCCcccEEEEEeCCHH
Q psy9313         101 SYARPSSEAIKRANLYVSGLPKHMTQEDLENLFRPYGTIITSRILCDKMASENVRSFVSGTPEIPQISKGIGFVRFNQHI  180 (356)
Q Consensus       101 ~~~~~~~~~~~~~~l~v~nl~~~~t~~~l~~~f~~~g~i~~v~i~~~~~~~~~~~~~~~~~~~~~~~~~g~afV~f~~~~  180 (356)
                      .+++|.++..+..+|||.+||+.+|..||.++|++||.|...+|+.+..+               |.++|.+||.|....
T Consensus       116 SyARPSs~~Ik~aNLYvSGlPktMtqkelE~iFs~fGrIItSRiL~dqvt---------------g~srGVgFiRFDKr~  180 (360)
T KOG0145|consen  116 SYARPSSDSIKDANLYVSGLPKTMTQKELEQIFSPFGRIITSRILVDQVT---------------GLSRGVGFIRFDKRI  180 (360)
T ss_pred             EeccCChhhhcccceEEecCCccchHHHHHHHHHHhhhhhhhhhhhhccc---------------ceecceeEEEecchh
Confidence            99999999999999999999999999999999999999999999888644               479999999999999


Q ss_pred             HHHHHHHHhcCCCcCCCcccEEEEEccChhhhhHHHhhhhHHHHHHHHHHhhhhcccCCCCccccccc------------
Q psy9313         181 EAEHAMQELNGTIPEGASEPITVKFANSPAGRAKALAANLNAQAAAMRHFAAAMRHFGNPLHHSARFK------------  248 (356)
Q Consensus       181 ~a~~a~~~~~~~~~~~~~~~i~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~------------  248 (356)
                      +|+.||..++|....|+.-+|.|+++..+.....        +......+..+.+.+++|++++....            
T Consensus       181 EAe~AIk~lNG~~P~g~tepItVKFannPsq~t~--------~a~ls~ly~sp~rr~~Gp~hh~~~r~r~~~~~~~~~~~  252 (360)
T KOG0145|consen  181 EAEEAIKGLNGQKPSGCTEPITVKFANNPSQKTN--------QALLSQLYQSPARRYGGPMHHQAQRFRLDNLLNPHAAQ  252 (360)
T ss_pred             HHHHHHHhccCCCCCCCCCCeEEEecCCcccccc--------hhhhHHhhcCccccCCCcccchhhhhccccccchhhhh
Confidence            9999999999999999999999999988744332        33345556667788888888774221            


Q ss_pred             --cCccccccccC-CCCCCCCCCCCCcEEEEecCCCCCcHHHHHHhhcCCCceeEEEEeeCCCCCCcceEEEEEEccHHH
Q psy9313         249 --FAPLTADLLNN-SMLPPKSLHGSGWCIFVYNLAPETEDNVLWQLFGPFGAVQNVKVVRDPQTYKCKGFGFVCMTNYDE  325 (356)
Q Consensus       249 --~~~~~~~~~~~-~~~~~~~~~~~~~~l~V~nlp~~~t~~~L~~~f~~~G~v~~v~i~~~~~~~~~~g~afV~f~~~~~  325 (356)
                        ++|...+.... ....-...++.+++|||.||..++++.-||++|.+||.|..|++++|..|++++||+||.+.+.++
T Consensus       253 ~rfsP~~~d~m~~l~~~~lp~~~~~g~ciFvYNLspd~de~~LWQlFgpFGAv~nVKvirD~ttnkCKGfgFVtMtNYdE  332 (360)
T KOG0145|consen  253 ARFSPMTIDGMSGLAGVNLPGGPGGGWCIFVYNLSPDADESILWQLFGPFGAVTNVKVIRDFTTNKCKGFGFVTMTNYDE  332 (360)
T ss_pred             ccCCCccccccceeeeeccCCCCCCeeEEEEEecCCCchHhHHHHHhCcccceeeEEEEecCCcccccceeEEEecchHH
Confidence              22221111110 011112234478999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHhCCcccCCeeEEEEEecCCC
Q psy9313         326 AVFAIQSLNGYALGDRLLQVSFKTHKP  352 (356)
Q Consensus       326 A~~a~~~l~g~~l~gr~l~v~~a~~~~  352 (356)
                      |..|+..|||..+++|.|+|+|..+|+
T Consensus       333 AamAi~sLNGy~lg~rvLQVsFKtnk~  359 (360)
T KOG0145|consen  333 AAMAIASLNGYRLGDRVLQVSFKTNKA  359 (360)
T ss_pred             HHHHHHHhcCccccceEEEEEEecCCC
Confidence            999999999999999999999999875



>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>KOG0117|consensus Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>KOG0144|consensus Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>KOG0127|consensus Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>KOG0148|consensus Back     alignment and domain information
>KOG0123|consensus Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>KOG0123|consensus Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>KOG0124|consensus Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>KOG0110|consensus Back     alignment and domain information
>KOG0147|consensus Back     alignment and domain information
>KOG0148|consensus Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>KOG0144|consensus Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>KOG0146|consensus Back     alignment and domain information
>KOG0145|consensus Back     alignment and domain information
>KOG0131|consensus Back     alignment and domain information
>KOG4212|consensus Back     alignment and domain information
>KOG0127|consensus Back     alignment and domain information
>KOG1190|consensus Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>KOG0131|consensus Back     alignment and domain information
>KOG0110|consensus Back     alignment and domain information
>KOG0117|consensus Back     alignment and domain information
>KOG1456|consensus Back     alignment and domain information
>KOG1190|consensus Back     alignment and domain information
>KOG4211|consensus Back     alignment and domain information
>KOG0124|consensus Back     alignment and domain information
>KOG0109|consensus Back     alignment and domain information
>KOG0109|consensus Back     alignment and domain information
>KOG0147|consensus Back     alignment and domain information
>KOG4205|consensus Back     alignment and domain information
>KOG0120|consensus Back     alignment and domain information
>KOG0146|consensus Back     alignment and domain information
>KOG1456|consensus Back     alignment and domain information
>KOG4206|consensus Back     alignment and domain information
>KOG0105|consensus Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>KOG4206|consensus Back     alignment and domain information
>KOG4205|consensus Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>KOG1365|consensus Back     alignment and domain information
>KOG0105|consensus Back     alignment and domain information
>KOG1548|consensus Back     alignment and domain information
>KOG0122|consensus Back     alignment and domain information
>KOG4211|consensus Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>KOG1457|consensus Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>KOG1457|consensus Back     alignment and domain information
>KOG4307|consensus Back     alignment and domain information
>KOG0122|consensus Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>KOG0121|consensus Back     alignment and domain information
>KOG4207|consensus Back     alignment and domain information
>KOG0125|consensus Back     alignment and domain information
>KOG0130|consensus Back     alignment and domain information
>KOG0114|consensus Back     alignment and domain information
>KOG0121|consensus Back     alignment and domain information
>KOG0126|consensus Back     alignment and domain information
>KOG1548|consensus Back     alignment and domain information
>KOG4212|consensus Back     alignment and domain information
>KOG0113|consensus Back     alignment and domain information
>KOG0107|consensus Back     alignment and domain information
>KOG0106|consensus Back     alignment and domain information
>KOG0149|consensus Back     alignment and domain information
>PLN03120 nucleic acid binding protein; Provisional Back     alignment and domain information
>KOG0106|consensus Back     alignment and domain information
>KOG0114|consensus Back     alignment and domain information
>KOG0107|consensus Back     alignment and domain information
>KOG4207|consensus Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>KOG0126|consensus Back     alignment and domain information
>KOG0149|consensus Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>PLN03121 nucleic acid binding protein; Provisional Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>KOG0120|consensus Back     alignment and domain information
>KOG0111|consensus Back     alignment and domain information
>KOG0108|consensus Back     alignment and domain information
>KOG0125|consensus Back     alignment and domain information
>KOG4660|consensus Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>KOG0111|consensus Back     alignment and domain information
>KOG0113|consensus Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>KOG0130|consensus Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>KOG1365|consensus Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>KOG0128|consensus Back     alignment and domain information
>KOG0108|consensus Back     alignment and domain information
>KOG0415|consensus Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>KOG0129|consensus Back     alignment and domain information
>KOG0112|consensus Back     alignment and domain information
>KOG4307|consensus Back     alignment and domain information
>KOG4454|consensus Back     alignment and domain information
>KOG4208|consensus Back     alignment and domain information
>KOG4208|consensus Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>KOG0415|consensus Back     alignment and domain information
>KOG0129|consensus Back     alignment and domain information
>KOG0153|consensus Back     alignment and domain information
>KOG0132|consensus Back     alignment and domain information
>KOG4661|consensus Back     alignment and domain information
>PF04059 RRM_2: RNA recognition motif 2; InterPro: IPR007201 This RNA recognition motif 2 is found in Meiosis protein mei2 Back     alignment and domain information
>KOG4454|consensus Back     alignment and domain information
>KOG0132|consensus Back     alignment and domain information
>KOG0128|consensus Back     alignment and domain information
>KOG0153|consensus Back     alignment and domain information
>KOG0112|consensus Back     alignment and domain information
>KOG0226|consensus Back     alignment and domain information
>KOG4210|consensus Back     alignment and domain information
>KOG0151|consensus Back     alignment and domain information
>KOG4661|consensus Back     alignment and domain information
>KOG0533|consensus Back     alignment and domain information
>KOG4210|consensus Back     alignment and domain information
>KOG0533|consensus Back     alignment and domain information
>KOG4209|consensus Back     alignment and domain information
>KOG4660|consensus Back     alignment and domain information
>KOG4676|consensus Back     alignment and domain information
>KOG0151|consensus Back     alignment and domain information
>KOG0116|consensus Back     alignment and domain information
>KOG4209|consensus Back     alignment and domain information
>KOG0116|consensus Back     alignment and domain information
>KOG4676|consensus Back     alignment and domain information
>KOG2193|consensus Back     alignment and domain information
>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes Back     alignment and domain information
>KOG0226|consensus Back     alignment and domain information
>PF11608 Limkain-b1: Limkain b1; InterPro: IPR024582 This entry represents a conserved domain found in limkain b1, which is a novel human autoantigen, localised to a subset of ABCD3 and PXF marked peroxisomes Back     alignment and domain information
>KOG2193|consensus Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>KOG1995|consensus Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>COG5175 MOT2 Transcriptional repressor [Transcription] Back     alignment and domain information
>PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT [] Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>KOG3152|consensus Back     alignment and domain information
>KOG4849|consensus Back     alignment and domain information
>KOG3152|consensus Back     alignment and domain information
>KOG0115|consensus Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>PF05172 Nup35_RRM: Nup53/35/40-type RNA recognition motif; InterPro: IPR007846 The MPPN (Mitotic PhosphoProtein N end) family is uncharacterised however it probably plays a role in the cell cycle because the family includes mitotic phosphoproteins O13026 from SWISSPROT [] Back     alignment and domain information
>KOG1996|consensus Back     alignment and domain information
>KOG1855|consensus Back     alignment and domain information
>KOG4849|consensus Back     alignment and domain information
>KOG1996|consensus Back     alignment and domain information
>KOG0115|consensus Back     alignment and domain information
>KOG1995|consensus Back     alignment and domain information
>PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function Back     alignment and domain information
>PF08952 DUF1866: Domain of unknown function (DUF1866) ; InterPro: IPR015047 This domain, found in synaptojanin, has no known function Back     alignment and domain information
>KOG2314|consensus Back     alignment and domain information
>KOG1855|consensus Back     alignment and domain information
>KOG2202|consensus Back     alignment and domain information
>PF10309 DUF2414: Protein of unknown function (DUF2414); InterPro: IPR019416 This entry contains proteins that have no known function Back     alignment and domain information
>PF15023 DUF4523: Protein of unknown function (DUF4523) Back     alignment and domain information
>KOG2416|consensus Back     alignment and domain information
>PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN) Back     alignment and domain information
>KOG2202|consensus Back     alignment and domain information
>PF03467 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 Nonsense-mediated mRNA decay (NMD) is a surveillance mechanism by which eukaryotic cells detect and degrade transcripts containing premature termination codons Back     alignment and domain information
>KOG2416|consensus Back     alignment and domain information
>PF07576 BRAP2: BRCA1-associated protein 2; InterPro: IPR011422 These proteins include BRCA1-associated protein 2 (BRAP2), which binds nuclear localisation signals (NLSs) in vitro and in yeast two-hybrid screening [] Back     alignment and domain information
>KOG2068|consensus Back     alignment and domain information
>PF10309 DUF2414: Protein of unknown function (DUF2414); InterPro: IPR019416 This entry contains proteins that have no known function Back     alignment and domain information
>PF15023 DUF4523: Protein of unknown function (DUF4523) Back     alignment and domain information
>PF07576 BRAP2: BRCA1-associated protein 2; InterPro: IPR011422 These proteins include BRCA1-associated protein 2 (BRAP2), which binds nuclear localisation signals (NLSs) in vitro and in yeast two-hybrid screening [] Back     alignment and domain information
>PF04847 Calcipressin: Calcipressin; InterPro: IPR006931 Calcipressin 1 negatively regulates calcineurin (IPR015757 from INTERPRO) by direct binding and is essential for the survival of T helper type 1 cells Back     alignment and domain information
>KOG2135|consensus Back     alignment and domain information
>PF03467 Smg4_UPF3: Smg-4/UPF3 family; InterPro: IPR005120 Nonsense-mediated mRNA decay (NMD) is a surveillance mechanism by which eukaryotic cells detect and degrade transcripts containing premature termination codons Back     alignment and domain information
>KOG2591|consensus Back     alignment and domain information
>PF08675 RNA_bind: RNA binding domain; InterPro: IPR014789 This domain corresponds to the RNA binding domain of Poly(A)-specific ribonuclease (PARN) Back     alignment and domain information
>KOG2068|consensus Back     alignment and domain information
>KOG0804|consensus Back     alignment and domain information
>KOG4285|consensus Back     alignment and domain information
>KOG2135|consensus Back     alignment and domain information
>KOG0804|consensus Back     alignment and domain information
>PF07292 NID: Nmi/IFP 35 domain (NID); InterPro: IPR009909 This entry represents a domain of approximately 90 residues that is tandemly repeated within interferon-induced 35 kDa protein (IFP 35) and the homologous N-myc-interactor (Nmi) Back     alignment and domain information
>PF04847 Calcipressin: Calcipressin; InterPro: IPR006931 Calcipressin 1 negatively regulates calcineurin (IPR015757 from INTERPRO) by direct binding and is essential for the survival of T helper type 1 cells Back     alignment and domain information
>KOG2253|consensus Back     alignment and domain information
>PF03880 DbpA: DbpA RNA binding domain ; InterPro: IPR005580 This RNA binding domain is found at the C terminus of a number of DEAD helicase proteins [] Back     alignment and domain information
>KOG4574|consensus Back     alignment and domain information
>KOG2591|consensus Back     alignment and domain information
>KOG2318|consensus Back     alignment and domain information
>KOG4285|consensus Back     alignment and domain information
>KOG4574|consensus Back     alignment and domain information
>PF07292 NID: Nmi/IFP 35 domain (NID); InterPro: IPR009909 This entry represents a domain of approximately 90 residues that is tandemly repeated within interferon-induced 35 kDa protein (IFP 35) and the homologous N-myc-interactor (Nmi) Back     alignment and domain information
>PF03880 DbpA: DbpA RNA binding domain ; InterPro: IPR005580 This RNA binding domain is found at the C terminus of a number of DEAD helicase proteins [] Back     alignment and domain information
>PF10567 Nab6_mRNP_bdg: RNA-recognition motif; InterPro: IPR018885 This conserved domain is found in fungal proteins and appears to be involved in RNA-processing Back     alignment and domain information
>KOG2318|consensus Back     alignment and domain information
>PF11767 SET_assoc: Histone lysine methyltransferase SET associated; InterPro: IPR024636 The SET domain is a protein-protein interaction domain found in protein lysine methyltransferase enzymes Back     alignment and domain information
>PF11767 SET_assoc: Histone lysine methyltransferase SET associated; InterPro: IPR024636 The SET domain is a protein-protein interaction domain found in protein lysine methyltransferase enzymes Back     alignment and domain information
>PF07530 PRE_C2HC: Associated with zinc fingers; InterPro: IPR006579 This domain is present in proteins found exclusively in the arthropods, including a number of Drosophila species, the silk moth and the gypsy moth Back     alignment and domain information
>KOG4483|consensus Back     alignment and domain information
>PF14111 DUF4283: Domain of unknown function (DUF4283) Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query356
1fxl_A167 Crystal Structure Of Hud And Au-Rich Element Of The 3e-61
1fxl_A167 Crystal Structure Of Hud And Au-Rich Element Of The 8e-05
1fnx_H174 Solution Structure Of The Huc Rbd1-Rbd2 Complexed W 1e-60
1fnx_H174 Solution Structure Of The Huc Rbd1-Rbd2 Complexed W 3e-05
4ed5_A177 Crystal Structure Of The Two N-Terminal Rrm Domains 2e-57
4ed5_A177 Crystal Structure Of The Two N-Terminal Rrm Domains 1e-05
4ed5_A177 Crystal Structure Of The Two N-Terminal Rrm Domains 1e-04
4egl_A177 Crystal Structure Of Two Tandem Rna Recognition Mot 1e-56
4egl_A177 Crystal Structure Of Two Tandem Rna Recognition Mot 2e-05
4egl_A177 Crystal Structure Of Two Tandem Rna Recognition Mot 1e-04
1b7f_A168 Sxl-Lethal ProteinRNA COMPLEX Length = 168 3e-42
1b7f_A168 Sxl-Lethal ProteinRNA COMPLEX Length = 168 8e-04
3sxl_A184 Sex-Lethal Rna Recognition Domains 1 And 2 From Dro 2e-41
3sxl_A184 Sex-Lethal Rna Recognition Domains 1 And 2 From Dro 5e-04
1d8z_A89 Solution Structure Of The First Rna-Binding Domain 2e-29
1d8z_A89 Solution Structure Of The First Rna-Binding Domain 1e-04
3hi9_A84 The X-Ray Crystal Structure Of The First Rna Recogn 4e-29
3hi9_A84 The X-Ray Crystal Structure Of The First Rna Recogn 1e-05
3hi9_A84 The X-Ray Crystal Structure Of The First Rna Recogn 5e-05
4fxv_A99 Crystal Structure Of An Elav-Like Protein 1 (Elavl1 7e-29
4fxv_A99 Crystal Structure Of An Elav-Like Protein 1 (Elavl1 2e-04
1d9a_A85 Solution Structure Of The Second Rna-Binding Domain 2e-23
2sxl_A88 Sex-Lethal Rbd1, Nmr, Minimized Average Structure L 3e-21
1sxl_A97 Resonance Assignments And Solution Structure Of The 1e-18
4f02_A213 Crystal Structure Of The Pabp-Binding Site Of Eif4g 3e-16
4f02_A213 Crystal Structure Of The Pabp-Binding Site Of Eif4g 1e-05
1cvj_A190 X-Ray Crystal Structure Of The Poly(A)-Binding Prot 5e-16
1cvj_A190 X-Ray Crystal Structure Of The Poly(A)-Binding Prot 1e-05
1u6f_A139 Nmr Solution Structure Of Tcubp1, A Single Rbd-Unit 1e-13
1u6f_A139 Nmr Solution Structure Of Tcubp1, A Single Rbd-Unit 4e-06
3md3_A166 Crystal Structure Of The First Two Rrm Domains Of Y 2e-13
3md3_A166 Crystal Structure Of The First Two Rrm Domains Of Y 4e-04
2dhs_A187 Solution Structure Of Nucleic Acid Binding Protein 2e-10
2cpz_A115 Solution Structure Of Rna Binding Domain 3 In Cug T 2e-10
3nnc_A175 Crystal Structure Of Cugbp1 Rrm12-Rna Complex Lengt 2e-10
2dgo_A115 Solution Structure Of The Rna Binding Domain In Cyt 6e-10
2cq0_A103 Solution Structure Of Rna Binding Domain In Eukaryo 7e-10
2cq0_A103 Solution Structure Of Rna Binding Domain In Eukaryo 9e-06
2khc_A118 Bruno Rrm3+ Length = 118 1e-09
1x5t_A96 Solution Structure Of The Second Rrm Domain In Spli 2e-09
3sde_B261 Crystal Structure Of A Paraspeckle-Protein Heterodi 2e-09
3bs9_A87 X-Ray Structure Of Human Tia-1 Rrm2 Length = 87 2e-09
2dh7_A105 Solution Structure Of The Second Rna Binding Domain 2e-09
3nmr_A175 Crystal Structure Of Cugbp1 Rrm12-Rna Complex Lengt 5e-09
1x5o_A114 Solution Structure Of Rrm Domain In Rna Binding Mot 1e-08
1p1t_A104 Nmr Structure Of The N-Terminal Rrm Domain Of Cleav 7e-08
1p1t_A104 Nmr Structure Of The N-Terminal Rrm Domain Of Cleav 3e-04
1x5s_A102 Solution Structure Of Rrm Domain In A18 Hnrnp Lengt 8e-08
2jrs_A108 Solution Nmr Structure Of Caper Rrm2 Domain. Northe 1e-07
2jrs_A108 Solution Nmr Structure Of Caper Rrm2 Domain. Northe 5e-07
2kxf_A199 Solution Structure Of The First Two Rrm Domains Of 1e-07
2kxf_A199 Solution Structure Of The First Two Rrm Domains Of 7e-07
2kxf_A199 Solution Structure Of The First Two Rrm Domains Of 4e-06
2kxn_B129 Nmr Structure Of Human Tra2beta1 Rrm In Complex Wit 1e-07
2qfj_A216 Crystal Structure Of First Two Rrm Domains Of Fir B 2e-07
2qfj_A216 Crystal Structure Of First Two Rrm Domains Of Fir B 2e-06
2dnz_A95 Solution Structure Of The Second Rna Binding Domain 2e-07
2dnz_A95 Solution Structure Of The Second Rna Binding Domain 8e-07
3uwt_A200 Crystal Structure Of A Rna Binding Domain Of Poly-U 3e-07
3uwt_A200 Crystal Structure Of A Rna Binding Domain Of Poly-U 5e-06
3uwt_A200 Crystal Structure Of A Rna Binding Domain Of Poly-U 2e-05
2x1f_A96 Structure Of Rna15 Rrm With Bound Rna (Gu) Length = 6e-07
2x1a_A97 Structure Of Rna15 Rrm With Rna Bound (G) Length = 7e-07
2cpf_A98 Solution Structure Of The Penultimate Rna Recogniti 7e-07
3vf0_B285 Raver1 In Complex With Metavinculin L954 Deletion M 7e-07
3vf0_B285 Raver1 In Complex With Metavinculin L954 Deletion M 2e-05
2rrb_A96 Refinement Of Rna Binding Domain In Human Tra2 Beta 7e-07
3h2u_B283 Human Raver1 Rrm1, Rrm2, And Rrm3 Domains In Comple 7e-07
3h2u_B283 Human Raver1 Rrm1, Rrm2, And Rrm3 Domains In Comple 2e-05
3smz_A284 Human Raver1 Rrm1-3 Domains (Residues 39-320) Lengt 7e-07
3smz_A284 Human Raver1 Rrm1-3 Domains (Residues 39-320) Lengt 2e-05
2rra_A99 Solution Structure Of Rna Binding Domain In Human T 8e-07
1ha1_A184 Hnrnp A1 (Rbd1,2) From Homo Sapiens Length = 184 8e-07
1ha1_A184 Hnrnp A1 (Rbd1,2) From Homo Sapiens Length = 184 4e-04
1up1_A182 Up1, The Two Rna-Recognition Motif Domain Of Hnrnp 9e-07
1up1_A182 Up1, The Two Rna-Recognition Motif Domain Of Hnrnp 5e-04
2k8g_A95 Solution Structure Of Rrm2 Domain Of Pabp1 Length = 9e-07
2k8g_A95 Solution Structure Of Rrm2 Domain Of Pabp1 Length = 3e-05
2up1_A183 Structure Of Up1-Telomeric Dna Complex Length = 183 9e-07
2up1_A183 Structure Of Up1-Telomeric Dna Complex Length = 183 5e-04
1pgz_A195 Crystal Structure Of Up1 Complexed With D(Ttagggtta 9e-07
1pgz_A195 Crystal Structure Of Up1 Complexed With D(Ttagggtta 3e-04
1l3k_A196 Up1, The Two Rna-Recognition Motif Domain Of Hnrnp 1e-06
1l3k_A196 Up1, The Two Rna-Recognition Motif Domain Of Hnrnp 3e-04
2lyv_A197 Solution Structure Of The Two Rrm Domains Of Hnrnp 1e-06
2lyv_A197 Solution Structure Of The Two Rrm Domains Of Hnrnp 3e-04
4f25_A115 Crystal Structure Of The Second Rrm Domain Of Human 1e-06
4f25_A115 Crystal Structure Of The Second Rrm Domain Of Human 3e-05
2km8_B84 Interdomain Rrm Packing Contributes To Rna Recognit 1e-06
2dnh_A105 Solution Structure Of Rna Binding Domain In Bruno-L 1e-06
3sde_A261 Crystal Structure Of A Paraspeckle-Protein Heterodi 1e-06
3sde_A261 Crystal Structure Of A Paraspeckle-Protein Heterodi 3e-05
1x5u_A105 Solution Structure Of Rrm Domain In Splicing Factor 2e-06
2dno_A102 Solution Structure Of Rna Binding Domain In Trinucl 3e-06
2cqc_A95 Solution Structure Of The Rna Recognition Motif In 3e-06
2d9p_A103 Solution Structure Of Rna Binding Domain 4 In Polya 3e-06
2yh0_A198 Solution Structure Of The Closed Conformation Of Hu 4e-06
3vaf_A174 Structure Of U2af65 Variant With Bru3 Dna Length = 4e-06
2g4b_A172 Structure Of U2af65 Variant With Polyuridine Tract 5e-06
2lea_A135 Solution Structure Of Human Srsf2 (Sc35) Rrm Length 7e-06
2u2f_A85 Solution Structure Of The Second Rna-Binding Domain 1e-05
2krr_A180 Solution Structure Of The Rbd1,2 Domains From Human 1e-05
2ku7_A140 Solution Structure Of Mll1 Phd3-Cyp33 Rrm Chimeric 2e-05
2ki2_A90 Solution Structure Of Ss-Dna Binding Protein 12rnp2 2e-05
2ki2_A90 Solution Structure Of Ss-Dna Binding Protein 12rnp2 2e-04
2cqi_A103 Solution Structure Of The Rna Binding Domain Of Nuc 2e-05
2kyx_A83 Solution Structure Of The Rrm Domain Of Cyp33 Lengt 2e-05
3lpy_A79 Crystal Structure Of The Rrm Domain Of Cyp33 Length 2e-05
3mdf_A85 Crystal Structure Of The Rrm Domain Of Cyclophilin 2e-05
2cqb_A102 Solution Structure Of The Rna Recognition Motif In 2e-05
1h2t_Z156 Structure Of The Human Nuclear Cap-Binding-Complex 2e-05
2dh8_A105 Solution Structure Of The N-Terminal Rna Binding Do 2e-05
1hl6_A165 A Novel Mode Of Rbd-Protein Recognition In The Y14- 2e-05
2kn4_A158 The Structure Of The Rrm Domain Of Sc35 Length = 15 3e-05
2rs2_A109 1h, 13c, And 15n Chemical Shift Assignments For Mus 4e-05
2dgu_A103 Solution Structure Of The Rna Binding Domain In Het 4e-05
2ywk_A95 Crystal Structure Of Rrm-Domain Derived From Human 5e-05
2cph_A107 Solution Structure Of The C-Terminal Rna Recognitio 8e-05
2cpj_A99 Solution Structure Of The N-Terminal Rna Recognitio 1e-04
1x4g_A109 Solution Structure Of Rrm Domain In Nucleolysin Tia 1e-04
2cjk_A167 Structure Of The Rna Binding Domain Of Hrp1 In Comp 1e-04
2cjk_A167 Structure Of The Rna Binding Domain Of Hrp1 In Comp 1e-04
1h6k_Z98 Nuclear Cap Binding Complex Length = 98 1e-04
2dnk_A105 Solution Structure Of Rna Binding Domain In Bruno-L 2e-04
1oo0_B110 Crystal Structure Of The Drosophila Mago Nashi-Y14 3e-04
2mss_A75 Musashi1 Rbd2, Nmr Length = 75 4e-04
2dnp_A90 Solution Structure Of Rna Binding Domain 2 In Rna-B 4e-04
1x4e_A85 Solution Structure Of Rrm Domain In Rna Binding Mot 4e-04
3ex7_B126 The Crystal Structure Of Ejc In Its Transition Stat 4e-04
2cqg_A103 Solution Structure Of The Rna Binding Domain Of Tar 5e-04
2e5h_A94 Solution Structure Of Rna Binding Domain In Zinc Fi 5e-04
2fy1_A116 A Dual Mode Of Rna Recognition By The Rbmy Protein 5e-04
3md1_A83 Crystal Structure Of The Second Rrm Domain Of Yeast 6e-04
2xb2_D90 Crystal Structure Of The Core Mago-Y14-Eif4aiii-Bar 6e-04
1uaw_A77 Solution Structure Of The N-Terminal Rna-Binding Do 7e-04
2do4_A100 Solution Structure Of The Rna Binding Domain Of Squ 7e-04
1fje_B175 Solution Structure Of Nucleolin Rbd12 In Complex Wi 7e-04
2xs2_A102 Crystal Structure Of The Rrm Domain Of Mouse Delete 7e-04
2dnq_A90 Solution Structure Of Rna Binding Domain 1 In Rna-B 8e-04
>pdb|1FXL|A Chain A, Crystal Structure Of Hud And Au-Rich Element Of The C-Fos Rna Length = 167 Back     alignment and structure

Iteration: 1

Score = 232 bits (591), Expect = 3e-61, Method: Compositional matrix adjust. Identities = 112/180 (62%), Positives = 137/180 (76%), Gaps = 15/180 (8%) Query: 27 SNLIVNYVPQTMTQEELQHLFSSVGEVESCKLIRDKTTAQSLGYGFVNYYRTEDAERAII 86 +NLIVNY+PQ MTQEE + LF S+GE+ESCKL+RDK T QSLGYGFVNY +DAE+AI Sbjct: 3 TNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAIN 62 Query: 87 ELNGLKLQNKSIKVSYARPSSEAIKRANLYVSGLPKHMTQEDLENLFRPYGTIITSRILC 146 LNGL+LQ K+IKVSYARPSS +I+ ANLYVSGLPK MTQ++LE LF YG IITSRIL Sbjct: 63 TLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLFSQYGRIITSRILV 122 Query: 147 DKMASENVRSFVSGTPEIPQISKGIGFVRFNQHIEAEHAMQELNGTIPEGASEPITVKFA 206 D ++ +S+G+GF+RF++ IEAE A++ LNG P GA+EPITVKFA Sbjct: 123 D---------------QVTGVSRGVGFIRFDKRIEAEEAIKGLNGQKPSGATEPITVKFA 167
>pdb|1FXL|A Chain A, Crystal Structure Of Hud And Au-Rich Element Of The C-Fos Rna Length = 167 Back     alignment and structure
>pdb|1FNX|H Chain H, Solution Structure Of The Huc Rbd1-Rbd2 Complexed With The Au-Rich Element Length = 174 Back     alignment and structure
>pdb|1FNX|H Chain H, Solution Structure Of The Huc Rbd1-Rbd2 Complexed With The Au-Rich Element Length = 174 Back     alignment and structure
>pdb|4ED5|A Chain A, Crystal Structure Of The Two N-Terminal Rrm Domains Of Hur Complexed With Rna Length = 177 Back     alignment and structure
>pdb|4ED5|A Chain A, Crystal Structure Of The Two N-Terminal Rrm Domains Of Hur Complexed With Rna Length = 177 Back     alignment and structure
>pdb|4ED5|A Chain A, Crystal Structure Of The Two N-Terminal Rrm Domains Of Hur Complexed With Rna Length = 177 Back     alignment and structure
>pdb|4EGL|A Chain A, Crystal Structure Of Two Tandem Rna Recognition Motifs Of Human Antigen R Length = 177 Back     alignment and structure
>pdb|4EGL|A Chain A, Crystal Structure Of Two Tandem Rna Recognition Motifs Of Human Antigen R Length = 177 Back     alignment and structure
>pdb|4EGL|A Chain A, Crystal Structure Of Two Tandem Rna Recognition Motifs Of Human Antigen R Length = 177 Back     alignment and structure
>pdb|1B7F|A Chain A, Sxl-Lethal ProteinRNA COMPLEX Length = 168 Back     alignment and structure
>pdb|1B7F|A Chain A, Sxl-Lethal ProteinRNA COMPLEX Length = 168 Back     alignment and structure
>pdb|3SXL|A Chain A, Sex-Lethal Rna Recognition Domains 1 And 2 From Drosophila Melanogaster Length = 184 Back     alignment and structure
>pdb|3SXL|A Chain A, Sex-Lethal Rna Recognition Domains 1 And 2 From Drosophila Melanogaster Length = 184 Back     alignment and structure
>pdb|1D8Z|A Chain A, Solution Structure Of The First Rna-Binding Domain (Rbd1) Of Hu Antigen C (Huc) Length = 89 Back     alignment and structure
>pdb|1D8Z|A Chain A, Solution Structure Of The First Rna-Binding Domain (Rbd1) Of Hu Antigen C (Huc) Length = 89 Back     alignment and structure
>pdb|3HI9|A Chain A, The X-Ray Crystal Structure Of The First Rna Recognition Motif (Rrm1) Of The Au-Rich Element (Are) Binding Protein Hur At 2.0 Angstrom Resolution Length = 84 Back     alignment and structure
>pdb|3HI9|A Chain A, The X-Ray Crystal Structure Of The First Rna Recognition Motif (Rrm1) Of The Au-Rich Element (Are) Binding Protein Hur At 2.0 Angstrom Resolution Length = 84 Back     alignment and structure
>pdb|3HI9|A Chain A, The X-Ray Crystal Structure Of The First Rna Recognition Motif (Rrm1) Of The Au-Rich Element (Are) Binding Protein Hur At 2.0 Angstrom Resolution Length = 84 Back     alignment and structure
>pdb|4FXV|A Chain A, Crystal Structure Of An Elav-Like Protein 1 (Elavl1) From Homo Sapiens At 1.90 A Resolution Length = 99 Back     alignment and structure
>pdb|4FXV|A Chain A, Crystal Structure Of An Elav-Like Protein 1 (Elavl1) From Homo Sapiens At 1.90 A Resolution Length = 99 Back     alignment and structure
>pdb|1D9A|A Chain A, Solution Structure Of The Second Rna-Binding Domain (Rbd2) Of Hu Antigen C (Huc) Length = 85 Back     alignment and structure
>pdb|2SXL|A Chain A, Sex-Lethal Rbd1, Nmr, Minimized Average Structure Length = 88 Back     alignment and structure
>pdb|1SXL|A Chain A, Resonance Assignments And Solution Structure Of The Second Rna-Binding Domain Of Sex-Lethal Determined By Multidimensional Heteronuclear Magnetic Resonance Spectroscopy Length = 97 Back     alignment and structure
>pdb|4F02|A Chain A, Crystal Structure Of The Pabp-Binding Site Of Eif4g In Complex With Rrm1-2 Of Pabp And Poly(A) Length = 213 Back     alignment and structure
>pdb|4F02|A Chain A, Crystal Structure Of The Pabp-Binding Site Of Eif4g In Complex With Rrm1-2 Of Pabp And Poly(A) Length = 213 Back     alignment and structure
>pdb|1CVJ|A Chain A, X-Ray Crystal Structure Of The Poly(A)-Binding Protein In Complex With Polyadenylate Rna Length = 190 Back     alignment and structure
>pdb|1CVJ|A Chain A, X-Ray Crystal Structure Of The Poly(A)-Binding Protein In Complex With Polyadenylate Rna Length = 190 Back     alignment and structure
>pdb|1U6F|A Chain A, Nmr Solution Structure Of Tcubp1, A Single Rbd-Unit From Trypanosoma Cruzi Length = 139 Back     alignment and structure
>pdb|1U6F|A Chain A, Nmr Solution Structure Of Tcubp1, A Single Rbd-Unit From Trypanosoma Cruzi Length = 139 Back     alignment and structure
>pdb|3MD3|A Chain A, Crystal Structure Of The First Two Rrm Domains Of Yeast Poly Binding Protein (Pub1) Length = 166 Back     alignment and structure
>pdb|3MD3|A Chain A, Crystal Structure Of The First Two Rrm Domains Of Yeast Poly Binding Protein (Pub1) Length = 166 Back     alignment and structure
>pdb|2DHS|A Chain A, Solution Structure Of Nucleic Acid Binding Protein Cugbp1ab And Its Binding Study With Dna And Rna Length = 187 Back     alignment and structure
>pdb|2CPZ|A Chain A, Solution Structure Of Rna Binding Domain 3 In Cug Triplet Repeat Rna-Binding Protein 1 Length = 115 Back     alignment and structure
>pdb|3NNC|A Chain A, Crystal Structure Of Cugbp1 Rrm12-Rna Complex Length = 175 Back     alignment and structure
>pdb|2DGO|A Chain A, Solution Structure Of The Rna Binding Domain In Cytotoxic Granule-Associated Rna Binding Protein 1 Length = 115 Back     alignment and structure
>pdb|2CQ0|A Chain A, Solution Structure Of Rna Binding Domain In Eukaryotic Translation Initiation Factor 3 Subunit 4 Length = 103 Back     alignment and structure
>pdb|2CQ0|A Chain A, Solution Structure Of Rna Binding Domain In Eukaryotic Translation Initiation Factor 3 Subunit 4 Length = 103 Back     alignment and structure
>pdb|2KHC|A Chain A, Bruno Rrm3+ Length = 118 Back     alignment and structure
>pdb|1X5T|A Chain A, Solution Structure Of The Second Rrm Domain In Splicing Factor 3b Length = 96 Back     alignment and structure
>pdb|3SDE|B Chain B, Crystal Structure Of A Paraspeckle-Protein Heterodimer, Pspc1NONO Length = 261 Back     alignment and structure
>pdb|3BS9|A Chain A, X-Ray Structure Of Human Tia-1 Rrm2 Length = 87 Back     alignment and structure
>pdb|2DH7|A Chain A, Solution Structure Of The Second Rna Binding Domain In Nucleolysin Tiar Length = 105 Back     alignment and structure
>pdb|3NMR|A Chain A, Crystal Structure Of Cugbp1 Rrm12-Rna Complex Length = 175 Back     alignment and structure
>pdb|1X5O|A Chain A, Solution Structure Of Rrm Domain In Rna Binding Motif, Single-Stranded Interacting Protein 1 Length = 114 Back     alignment and structure
>pdb|1P1T|A Chain A, Nmr Structure Of The N-Terminal Rrm Domain Of Cleavage Stimulation Factor 64 Kda Subunit Length = 104 Back     alignment and structure
>pdb|1P1T|A Chain A, Nmr Structure Of The N-Terminal Rrm Domain Of Cleavage Stimulation Factor 64 Kda Subunit Length = 104 Back     alignment and structure
>pdb|1X5S|A Chain A, Solution Structure Of Rrm Domain In A18 Hnrnp Length = 102 Back     alignment and structure
>pdb|2JRS|A Chain A, Solution Nmr Structure Of Caper Rrm2 Domain. Northeast Structural Genomics Target Hr4730a Length = 108 Back     alignment and structure
>pdb|2JRS|A Chain A, Solution Nmr Structure Of Caper Rrm2 Domain. Northeast Structural Genomics Target Hr4730a Length = 108 Back     alignment and structure
>pdb|2KXF|A Chain A, Solution Structure Of The First Two Rrm Domains Of Fbp-Interacting Repressor (Fir) Length = 199 Back     alignment and structure
>pdb|2KXF|A Chain A, Solution Structure Of The First Two Rrm Domains Of Fbp-Interacting Repressor (Fir) Length = 199 Back     alignment and structure
>pdb|2KXF|A Chain A, Solution Structure Of The First Two Rrm Domains Of Fbp-Interacting Repressor (Fir) Length = 199 Back     alignment and structure
>pdb|2KXN|B Chain B, Nmr Structure Of Human Tra2beta1 Rrm In Complex With Aagaac Rna Length = 129 Back     alignment and structure
>pdb|2QFJ|A Chain A, Crystal Structure Of First Two Rrm Domains Of Fir Bound To Ssdna From A Portion Of Fuse Length = 216 Back     alignment and structure
>pdb|2QFJ|A Chain A, Crystal Structure Of First Two Rrm Domains Of Fir Bound To Ssdna From A Portion Of Fuse Length = 216 Back     alignment and structure
>pdb|2DNZ|A Chain A, Solution Structure Of The Second Rna Binding Domain Of Rna Binding Motif Protein 23 Length = 95 Back     alignment and structure
>pdb|2DNZ|A Chain A, Solution Structure Of The Second Rna Binding Domain Of Rna Binding Motif Protein 23 Length = 95 Back     alignment and structure
>pdb|3UWT|A Chain A, Crystal Structure Of A Rna Binding Domain Of Poly-U Binding Splicing Factor 60kda (Puf60) From Homo Sapiens At 2.50 A Resolution Length = 200 Back     alignment and structure
>pdb|3UWT|A Chain A, Crystal Structure Of A Rna Binding Domain Of Poly-U Binding Splicing Factor 60kda (Puf60) From Homo Sapiens At 2.50 A Resolution Length = 200 Back     alignment and structure
>pdb|3UWT|A Chain A, Crystal Structure Of A Rna Binding Domain Of Poly-U Binding Splicing Factor 60kda (Puf60) From Homo Sapiens At 2.50 A Resolution Length = 200 Back     alignment and structure
>pdb|2X1F|A Chain A, Structure Of Rna15 Rrm With Bound Rna (Gu) Length = 96 Back     alignment and structure
>pdb|2X1A|A Chain A, Structure Of Rna15 Rrm With Rna Bound (G) Length = 97 Back     alignment and structure
>pdb|2CPF|A Chain A, Solution Structure Of The Penultimate Rna Recognition Motif Of Hypothetical Rna-Binding Protein Rbm19 Length = 98 Back     alignment and structure
>pdb|3VF0|B Chain B, Raver1 In Complex With Metavinculin L954 Deletion Mutant Length = 285 Back     alignment and structure
>pdb|3VF0|B Chain B, Raver1 In Complex With Metavinculin L954 Deletion Mutant Length = 285 Back     alignment and structure
>pdb|2RRB|A Chain A, Refinement Of Rna Binding Domain In Human Tra2 Beta Protein Length = 96 Back     alignment and structure
>pdb|3H2U|B Chain B, Human Raver1 Rrm1, Rrm2, And Rrm3 Domains In Complex With Human Vinculin Tail Domain Vt Length = 283 Back     alignment and structure
>pdb|3H2U|B Chain B, Human Raver1 Rrm1, Rrm2, And Rrm3 Domains In Complex With Human Vinculin Tail Domain Vt Length = 283 Back     alignment and structure
>pdb|3SMZ|A Chain A, Human Raver1 Rrm1-3 Domains (Residues 39-320) Length = 284 Back     alignment and structure
>pdb|3SMZ|A Chain A, Human Raver1 Rrm1-3 Domains (Residues 39-320) Length = 284 Back     alignment and structure
>pdb|2RRA|A Chain A, Solution Structure Of Rna Binding Domain In Human Tra2 Beta Protein In Complex With Rna (Gaagaa) Length = 99 Back     alignment and structure
>pdb|1HA1|A Chain A, Hnrnp A1 (Rbd1,2) From Homo Sapiens Length = 184 Back     alignment and structure
>pdb|1HA1|A Chain A, Hnrnp A1 (Rbd1,2) From Homo Sapiens Length = 184 Back     alignment and structure
>pdb|1UP1|A Chain A, Up1, The Two Rna-Recognition Motif Domain Of Hnrnp A1 Length = 182 Back     alignment and structure
>pdb|1UP1|A Chain A, Up1, The Two Rna-Recognition Motif Domain Of Hnrnp A1 Length = 182 Back     alignment and structure
>pdb|2K8G|A Chain A, Solution Structure Of Rrm2 Domain Of Pabp1 Length = 95 Back     alignment and structure
>pdb|2K8G|A Chain A, Solution Structure Of Rrm2 Domain Of Pabp1 Length = 95 Back     alignment and structure
>pdb|2UP1|A Chain A, Structure Of Up1-Telomeric Dna Complex Length = 183 Back     alignment and structure
>pdb|2UP1|A Chain A, Structure Of Up1-Telomeric Dna Complex Length = 183 Back     alignment and structure
>pdb|1PGZ|A Chain A, Crystal Structure Of Up1 Complexed With D(Ttagggttag(6-Mi) G); A Human Telomeric Repeat Containing 6-Methyl-8-(2- Deoxy-Beta-Ribofuranosyl)isoxanthopteridine (6-Mi) Length = 195 Back     alignment and structure
>pdb|1PGZ|A Chain A, Crystal Structure Of Up1 Complexed With D(Ttagggttag(6-Mi) G); A Human Telomeric Repeat Containing 6-Methyl-8-(2- Deoxy-Beta-Ribofuranosyl)isoxanthopteridine (6-Mi) Length = 195 Back     alignment and structure
>pdb|1L3K|A Chain A, Up1, The Two Rna-Recognition Motif Domain Of Hnrnp A1 Length = 196 Back     alignment and structure
>pdb|1L3K|A Chain A, Up1, The Two Rna-Recognition Motif Domain Of Hnrnp A1 Length = 196 Back     alignment and structure
>pdb|2LYV|A Chain A, Solution Structure Of The Two Rrm Domains Of Hnrnp A1 (up1) Using Segmental Isotope Labeling Length = 197 Back     alignment and structure
>pdb|2LYV|A Chain A, Solution Structure Of The Two Rrm Domains Of Hnrnp A1 (up1) Using Segmental Isotope Labeling Length = 197 Back     alignment and structure
>pdb|4F25|A Chain A, Crystal Structure Of The Second Rrm Domain Of Human Pabpc1 At Ph 6.0 Length = 115 Back     alignment and structure
>pdb|4F25|A Chain A, Crystal Structure Of The Second Rrm Domain Of Human Pabpc1 At Ph 6.0 Length = 115 Back     alignment and structure
>pdb|2KM8|B Chain B, Interdomain Rrm Packing Contributes To Rna Recognition In The Rna15, Hrp1, Anchor Rna 3' Processing Ternary Complex Length = 84 Back     alignment and structure
>pdb|2DNH|A Chain A, Solution Structure Of Rna Binding Domain In Bruno-Like 5 Rna Binding Protein Length = 105 Back     alignment and structure
>pdb|3SDE|A Chain A, Crystal Structure Of A Paraspeckle-Protein Heterodimer, Pspc1NONO Length = 261 Back     alignment and structure
>pdb|3SDE|A Chain A, Crystal Structure Of A Paraspeckle-Protein Heterodimer, Pspc1NONO Length = 261 Back     alignment and structure
>pdb|1X5U|A Chain A, Solution Structure Of Rrm Domain In Splicing Factor 3b Length = 105 Back     alignment and structure
>pdb|2DNO|A Chain A, Solution Structure Of Rna Binding Domain In Trinucleotide Repeat Containing 4 Variant Length = 102 Back     alignment and structure
>pdb|2CQC|A Chain A, Solution Structure Of The Rna Recognition Motif In ArginineSERINE-Rich Splicing Factor 10 Length = 95 Back     alignment and structure
>pdb|2D9P|A Chain A, Solution Structure Of Rna Binding Domain 4 In Polyadenylation Binding Protein 3 Length = 103 Back     alignment and structure
>pdb|2YH0|A Chain A, Solution Structure Of The Closed Conformation Of Human U2af65 Tandem Rrm1 And Rrm2 Domains Length = 198 Back     alignment and structure
>pdb|3VAF|A Chain A, Structure Of U2af65 Variant With Bru3 Dna Length = 174 Back     alignment and structure
>pdb|2G4B|A Chain A, Structure Of U2af65 Variant With Polyuridine Tract Length = 172 Back     alignment and structure
>pdb|2LEA|A Chain A, Solution Structure Of Human Srsf2 (Sc35) Rrm Length = 135 Back     alignment and structure
>pdb|2U2F|A Chain A, Solution Structure Of The Second Rna-Binding Domain Of Hu2af65 Length = 85 Back     alignment and structure
>pdb|2KRR|A Chain A, Solution Structure Of The Rbd1,2 Domains From Human Nucleoli Length = 180 Back     alignment and structure
>pdb|2KU7|A Chain A, Solution Structure Of Mll1 Phd3-Cyp33 Rrm Chimeric Protein Length = 140 Back     alignment and structure
>pdb|2KI2|A Chain A, Solution Structure Of Ss-Dna Binding Protein 12rnp2 Precursor, Hp0827(O25501_helpy) Form Helicobacter Pylori Length = 90 Back     alignment and structure
>pdb|2KI2|A Chain A, Solution Structure Of Ss-Dna Binding Protein 12rnp2 Precursor, Hp0827(O25501_helpy) Form Helicobacter Pylori Length = 90 Back     alignment and structure
>pdb|2CQI|A Chain A, Solution Structure Of The Rna Binding Domain Of Nucleolysin Tiar Length = 103 Back     alignment and structure
>pdb|2KYX|A Chain A, Solution Structure Of The Rrm Domain Of Cyp33 Length = 83 Back     alignment and structure
>pdb|3LPY|A Chain A, Crystal Structure Of The Rrm Domain Of Cyp33 Length = 79 Back     alignment and structure
>pdb|3MDF|A Chain A, Crystal Structure Of The Rrm Domain Of Cyclophilin 33 Length = 85 Back     alignment and structure
>pdb|2CQB|A Chain A, Solution Structure Of The Rna Recognition Motif In Peptidyl- Prolyl Cis-Trans Isomerase E Length = 102 Back     alignment and structure
>pdb|1H2T|Z Chain Z, Structure Of The Human Nuclear Cap-Binding-Complex (Cbc) In Complex With A Cap Analogue M7gpppg Length = 156 Back     alignment and structure
>pdb|2DH8|A Chain A, Solution Structure Of The N-Terminal Rna Binding Domain In Daz-Associated Protein 1 Length = 105 Back     alignment and structure
>pdb|1HL6|A Chain A, A Novel Mode Of Rbd-Protein Recognition In The Y14-Mago Complex Length = 165 Back     alignment and structure
>pdb|2KN4|A Chain A, The Structure Of The Rrm Domain Of Sc35 Length = 158 Back     alignment and structure
>pdb|2RS2|A Chain A, 1h, 13c, And 15n Chemical Shift Assignments For Musashi1 Rbd1:r(Guagu) Complex Length = 109 Back     alignment and structure
>pdb|2DGU|A Chain A, Solution Structure Of The Rna Binding Domain In Heterogeneous Nuclear Ribonucleoprotein Q Length = 103 Back     alignment and structure
>pdb|2YWK|A Chain A, Crystal Structure Of Rrm-Domain Derived From Human Putative Rna-Binding Protein 11 Length = 95 Back     alignment and structure
>pdb|2CPH|A Chain A, Solution Structure Of The C-Terminal Rna Recognition Motif Of Hypothetical Rna-Binding Protein Rbm19 Length = 107 Back     alignment and structure
>pdb|2CPJ|A Chain A, Solution Structure Of The N-Terminal Rna Recognition Motif Of Nono Length = 99 Back     alignment and structure
>pdb|1X4G|A Chain A, Solution Structure Of Rrm Domain In Nucleolysin Tiar Length = 109 Back     alignment and structure
>pdb|2CJK|A Chain A, Structure Of The Rna Binding Domain Of Hrp1 In Complex With Rna Length = 167 Back     alignment and structure
>pdb|2CJK|A Chain A, Structure Of The Rna Binding Domain Of Hrp1 In Complex With Rna Length = 167 Back     alignment and structure
>pdb|1H6K|Z Chain Z, Nuclear Cap Binding Complex Length = 98 Back     alignment and structure
>pdb|2DNK|A Chain A, Solution Structure Of Rna Binding Domain In Bruno-Like 4 Rna Binding Protein Length = 105 Back     alignment and structure
>pdb|1OO0|B Chain B, Crystal Structure Of The Drosophila Mago Nashi-Y14 Complex Length = 110 Back     alignment and structure
>pdb|2MSS|A Chain A, Musashi1 Rbd2, Nmr Length = 75 Back     alignment and structure
>pdb|2DNP|A Chain A, Solution Structure Of Rna Binding Domain 2 In Rna-Binding Protein 14 Length = 90 Back     alignment and structure
>pdb|1X4E|A Chain A, Solution Structure Of Rrm Domain In Rna Binding Motif, Single-Stranded Interacting Protein 2 Length = 85 Back     alignment and structure
>pdb|3EX7|B Chain B, The Crystal Structure Of Ejc In Its Transition State Length = 126 Back     alignment and structure
>pdb|2CQG|A Chain A, Solution Structure Of The Rna Binding Domain Of Tar Dna- Binding Protein-43 Length = 103 Back     alignment and structure
>pdb|2E5H|A Chain A, Solution Structure Of Rna Binding Domain In Zinc Finger Cchc-Type And Rna Binding Motif 1 Length = 94 Back     alignment and structure
>pdb|2FY1|A Chain A, A Dual Mode Of Rna Recognition By The Rbmy Protein Length = 116 Back     alignment and structure
>pdb|3MD1|A Chain A, Crystal Structure Of The Second Rrm Domain Of Yeast Poly(U)-Binding Protein (Pub1) Length = 83 Back     alignment and structure
>pdb|2XB2|D Chain D, Crystal Structure Of The Core Mago-Y14-Eif4aiii-Barentsz- Upf3b Assembly Shows How The Ejc Is Bridged To The Nmd Machinery Length = 90 Back     alignment and structure
>pdb|1UAW|A Chain A, Solution Structure Of The N-Terminal Rna-Binding Domain Of Mouse Musashi1 Length = 77 Back     alignment and structure
>pdb|2DO4|A Chain A, Solution Structure Of The Rna Binding Domain Of Squamous Cell Carcinoma Antigen Recognized By T Cells 3 Length = 100 Back     alignment and structure
>pdb|1FJE|B Chain B, Solution Structure Of Nucleolin Rbd12 In Complex With Snre Rna Length = 175 Back     alignment and structure
>pdb|2XS2|A Chain A, Crystal Structure Of The Rrm Domain Of Mouse Deleted In Azoospermia-Like In Complex With Rna, Uuguucuu Length = 102 Back     alignment and structure
>pdb|2DNQ|A Chain A, Solution Structure Of Rna Binding Domain 1 In Rna-Binding Protein 30 Length = 90 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query356
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 2e-77
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 7e-20
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 5e-19
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 4e-18
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 4e-76
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 1e-20
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 8e-20
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 2e-19
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 7e-74
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 5e-59
3smz_A 284 Protein raver-1, ribonucleoprotein PTB-binding 1; 3e-21
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 3e-19
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 1e-67
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 1e-25
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 1e-18
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 8e-63
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 1e-30
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 2e-23
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 3e-60
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 3e-16
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 1e-52
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 2e-16
3sde_A 261 Paraspeckle component 1; RRM, anti parallel right 2e-16
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 1e-14
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 3e-14
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 1e-51
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 4e-25
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 1e-18
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 5e-16
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 1e-42
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 5e-26
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 4e-16
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 5e-15
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 2e-41
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 4e-39
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 1e-37
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 4e-26
2adc_A 229 Polypyrimidine tract-binding protein 1; RBD, RRM, 9e-15
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 5e-12
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 1e-37
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 4e-22
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 1e-18
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 9e-36
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 2e-29
1qm9_A 198 Polypyrimidine tract-binding protein; ribonucleopr 4e-15
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 3e-12
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 2e-35
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 4e-21
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 6e-20
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 2e-12
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 2e-08
1x5o_A114 RNA binding motif, single-stranded interacting pro 1e-34
1x5o_A114 RNA binding motif, single-stranded interacting pro 1e-23
1x5o_A114 RNA binding motif, single-stranded interacting pro 5e-20
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 2e-34
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 4e-27
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 1e-14
3tyt_A 205 Heterogeneous nuclear ribonucleoprotein L; ferredo 5e-13
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 2e-33
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 3e-32
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 2e-21
2yh0_A 198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 2e-13
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 6e-33
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 6e-29
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 2e-18
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 5e-32
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 1e-30
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 2e-19
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 3e-31
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 4e-22
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 2e-17
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 2e-30
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 2e-13
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 4e-13
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 4e-30
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 3e-12
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 4e-12
3pgw_A 282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 8e-12
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 2e-09
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 1e-28
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 5e-27
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 1e-14
1x4e_A85 RNA binding motif, single-stranded interacting pro 4e-27
1x4e_A85 RNA binding motif, single-stranded interacting pro 2e-25
1x4e_A85 RNA binding motif, single-stranded interacting pro 2e-17
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 1e-26
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 3e-21
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 6e-14
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 2e-26
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 3e-20
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 2e-26
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 1e-21
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 6e-18
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 5e-26
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 9e-22
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 1e-14
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 2e-25
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 7e-20
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 7e-12
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 2e-25
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 1e-20
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 9e-12
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 6e-25
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 3e-20
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 6e-15
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 1e-24
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 3e-18
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 1e-13
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 1e-24
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 2e-21
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 1e-14
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 1e-24
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 5e-20
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 2e-12
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 4e-24
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 4e-17
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 7e-13
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 5e-24
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 3e-19
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 1e-10
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 1e-23
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 4e-20
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 2e-13
2div_A99 TRNA selenocysteine associated protein; structural 3e-23
2div_A99 TRNA selenocysteine associated protein; structural 1e-19
2div_A99 TRNA selenocysteine associated protein; structural 4e-11
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 6e-23
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 8e-20
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 1e-11
2cph_A107 RNA binding motif protein 19; RNA recognition moti 1e-22
2cph_A107 RNA binding motif protein 19; RNA recognition moti 4e-18
2cph_A107 RNA binding motif protein 19; RNA recognition moti 3e-13
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 1e-22
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 4e-18
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 2e-13
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 1e-22
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 1e-16
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 6e-16
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 2e-22
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 1e-20
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 1e-12
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 2e-22
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 9e-21
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 5e-17
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 2e-22
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 2e-19
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 2e-12
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 3e-22
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 1e-19
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 4e-14
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 4e-22
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 1e-20
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 2e-15
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 4e-22
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 4e-21
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 4e-15
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 6e-22
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 5e-20
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 1e-15
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 1e-21
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 5e-21
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 2e-16
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 2e-21
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 7e-18
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 1e-10
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 2e-21
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 4e-21
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 8e-15
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 2e-21
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 2e-18
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 6e-14
2cpj_A99 Non-POU domain-containing octamer-binding protein; 4e-21
2cpj_A99 Non-POU domain-containing octamer-binding protein; 3e-20
2cpj_A99 Non-POU domain-containing octamer-binding protein; 4e-16
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 4e-21
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 2e-20
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 6e-14
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 4e-21
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 2e-20
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 2e-13
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 4e-21
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 2e-20
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 1e-13
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 5e-21
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 1e-17
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 2e-16
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 5e-21
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 5e-17
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 7e-15
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 5e-21
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 1e-19
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 4e-14
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 8e-21
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 6e-20
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 2e-12
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 9e-21
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 3e-19
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 3e-15
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 1e-20
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 2e-20
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 2e-15
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 1e-20
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 5e-20
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 1e-17
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 2e-20
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 1e-18
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 1e-14
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 2e-20
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 9e-20
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 1e-16
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 2e-20
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 1e-19
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 3e-12
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 3e-20
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 2e-19
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 3e-16
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 3e-20
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 6e-19
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 1e-13
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 3e-20
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 5e-20
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 1e-17
2kt5_A124 RNA and export factor-binding protein 2; chaperone 3e-20
2kt5_A124 RNA and export factor-binding protein 2; chaperone 1e-17
2kt5_A124 RNA and export factor-binding protein 2; chaperone 6e-17
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 3e-20
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 2e-18
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 4e-15
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 5e-20
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 3e-18
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 8e-15
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 7e-20
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 9e-18
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 1e-12
2f3j_A177 RNA and export factor binding protein 2; RRM domai 7e-20
2f3j_A177 RNA and export factor binding protein 2; RRM domai 5e-17
2f3j_A177 RNA and export factor binding protein 2; RRM domai 5e-16
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 9e-20
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 4e-18
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 2e-17
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 1e-19
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 6e-19
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 5e-16
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 2e-19
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 1e-18
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 3e-15
1x5p_A97 Negative elongation factor E; structure genomics, 4e-19
1x5p_A97 Negative elongation factor E; structure genomics, 9e-18
1x5p_A97 Negative elongation factor E; structure genomics, 2e-12
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 4e-19
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 4e-14
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 5e-14
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 6e-19
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 3e-17
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 2e-11
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} Len 7e-19
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} Len 2e-18
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} Len 7e-13
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 8e-19
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 3e-18
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 7e-13
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 2e-18
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 4e-17
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 5e-11
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 2e-18
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 5e-16
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 9e-14
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 2e-18
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 6e-16
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 3e-11
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 3e-18
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 1e-17
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 5e-11
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 3e-18
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 3e-17
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 2e-10
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 6e-18
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 6e-18
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 9e-12
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 1e-17
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 1e-16
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 6e-12
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 1e-17
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 1e-17
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 1e-14
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 2e-17
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 3e-14
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 2e-13
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 2e-17
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 8e-17
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 1e-10
2la6_A99 RNA-binding protein FUS; structural genomics, nort 5e-17
2la6_A99 RNA-binding protein FUS; structural genomics, nort 1e-16
2la6_A99 RNA-binding protein FUS; structural genomics, nort 1e-09
3q2s_C229 Cleavage and polyadenylation specificity factor S; 5e-17
3q2s_C229 Cleavage and polyadenylation specificity factor S; 2e-15
3q2s_C229 Cleavage and polyadenylation specificity factor S; 2e-14
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 8e-17
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 5e-16
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 2e-13
3p5t_L90 Cleavage and polyadenylation specificity factor S; 9e-17
3p5t_L90 Cleavage and polyadenylation specificity factor S; 8e-16
3p5t_L90 Cleavage and polyadenylation specificity factor S; 5e-15
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 1e-16
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 5e-15
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 1e-12
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 1e-16
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 7e-16
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 2e-10
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 2e-16
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 6e-16
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 6e-13
2dis_A109 Unnamed protein product; structural genomics, RRM 4e-16
2dis_A109 Unnamed protein product; structural genomics, RRM 3e-15
2dis_A109 Unnamed protein product; structural genomics, RRM 8e-11
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 4e-16
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 6e-14
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 2e-09
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 4e-16
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 4e-15
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 4e-13
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 7e-16
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 2e-14
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 1e-08
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 9e-16
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 9e-16
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 1e-15
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 9e-16
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 7e-15
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 1e-07
3n9u_C156 Cleavage and polyadenylation specificity factor S; 1e-15
3n9u_C156 Cleavage and polyadenylation specificity factor S; 5e-15
3n9u_C156 Cleavage and polyadenylation specificity factor S; 1e-13
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 1e-15
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 1e-13
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 5e-09
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 1e-15
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 1e-14
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 1e-10
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 2e-15
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 5e-14
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 2e-07
2cqd_A116 RNA-binding region containing protein 1; RNA recog 6e-15
2cqd_A116 RNA-binding region containing protein 1; RNA recog 3e-14
2cqd_A116 RNA-binding region containing protein 1; RNA recog 4e-09
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 1e-14
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 1e-11
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 7e-11
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 1e-14
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 5e-14
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 2e-08
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 1e-14
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 6e-14
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 3e-13
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 1e-14
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 2e-12
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 7e-09
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 2e-14
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 2e-11
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 2e-08
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 4e-14
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 3e-12
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 2e-06
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 5e-14
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 1e-13
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 2e-13
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 5e-14
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 7e-11
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 3e-09
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 1e-13
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 7e-13
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 4e-08
2i2y_A150 Fusion protein consists of immunoglobin G- binding 1e-13
2i2y_A150 Fusion protein consists of immunoglobin G- binding 7e-13
2i2y_A150 Fusion protein consists of immunoglobin G- binding 6e-12
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 2e-13
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 3e-08
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 5e-06
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 3e-13
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 3e-13
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 4e-12
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 3e-13
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 3e-12
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 2e-09
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 3e-13
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 8e-12
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 3e-10
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 6e-13
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 7e-09
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 2e-08
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 1e-12
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 8e-12
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 3e-11
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 1e-12
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 5e-12
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 3e-10
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 4e-12
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 1e-10
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 2e-07
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 4e-12
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 3e-11
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 6e-09
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 5e-12
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 1e-09
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 2e-09
2krb_A81 Eukaryotic translation initiation factor 3 subunit 5e-12
2krb_A81 Eukaryotic translation initiation factor 3 subunit 1e-08
2krb_A81 Eukaryotic translation initiation factor 3 subunit 1e-05
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 5e-12
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 4e-10
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 1e-08
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 5e-12
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 8e-12
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 8e-08
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 8e-12
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 2e-09
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 5e-07
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 9e-12
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 6e-10
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 5e-09
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 1e-11
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 4e-10
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 3e-06
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 1e-11
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 3e-10
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 2e-07
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 3e-11
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 1e-09
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 2e-08
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 3e-11
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 3e-10
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 8e-10
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 4e-11
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 2e-09
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 6e-09
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 5e-11
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 2e-09
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 6e-09
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 5e-11
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 4e-10
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 2e-06
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 1e-10
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 1e-09
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 1e-06
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 1e-10
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 4e-10
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 2e-06
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 1e-10
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 3e-09
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 4e-09
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 1e-10
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 2e-10
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 3e-06
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 4e-10
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 2e-09
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 1e-06
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 4e-10
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 5e-08
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 7e-06
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 1e-09
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 2e-08
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 2e-05
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 2e-09
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 1e-07
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 8e-06
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 3e-09
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 2e-05
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 2e-04
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 3e-09
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 3e-09
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 3e-06
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 5e-09
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 6e-06
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 7e-05
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 6e-09
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 8e-08
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 2e-04
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 8e-09
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 7e-06
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 1e-04
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 9e-09
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 2e-06
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 1e-08
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 2e-06
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 2e-04
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 3e-08
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 5e-07
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 1e-05
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 4e-08
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 9e-08
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 1e-05
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 5e-08
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 6e-04
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 6e-08
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 3e-04
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 8e-08
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 2e-07
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 3e-04
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 1e-07
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 2e-06
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 3e-04
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 2e-07
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 2e-06
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 7e-07
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 5e-05
2dnl_A114 Cytoplasmic polyadenylation element binding protei 2e-06
2dnl_A114 Cytoplasmic polyadenylation element binding protei 3e-04
2dnl_A114 Cytoplasmic polyadenylation element binding protei 4e-04
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 2e-06
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 4e-05
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 5e-06
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 7e-06
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 6e-06
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 7e-05
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 1e-05
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 2e-04
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 7e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-05
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 3e-05
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 8e-05
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 2e-04
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 5e-04
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 4e-04
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 5e-04
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
 Score =  234 bits (599), Expect = 2e-77
 Identities = 113/181 (62%), Positives = 138/181 (76%), Gaps = 15/181 (8%)

Query: 26  NSNLIVNYVPQTMTQEELQHLFSSVGEVESCKLIRDKTTAQSLGYGFVNYYRTEDAERAI 85
            +NLIVNY+PQ MTQEE + LF S+GE+ESCKL+RDK T QSLGYGFVNY   +DAE+AI
Sbjct: 2   KTNLIVNYLPQNMTQEEFRSLFGSIGEIESCKLVRDKITGQSLGYGFVNYIDPKDAEKAI 61

Query: 86  IELNGLKLQNKSIKVSYARPSSEAIKRANLYVSGLPKHMTQEDLENLFRPYGTIITSRIL 145
             LNGL+LQ K+IKVSYARPSS +I+ ANLYVSGLPK MTQ++LE LF  YG IITSRIL
Sbjct: 62  NTLNGLRLQTKTIKVSYARPSSASIRDANLYVSGLPKTMTQKELEQLFSQYGRIITSRIL 121

Query: 146 CDKMASENVRSFVSGTPEIPQISKGIGFVRFNQHIEAEHAMQELNGTIPEGASEPITVKF 205
            D++         +G       S+G+GF+RF++ IEAE A++ LNG  P GA+EPITVKF
Sbjct: 122 VDQV---------TGV------SRGVGFIRFDKRIEAEEAIKGLNGQKPSGATEPITVKF 166

Query: 206 A 206
           A
Sbjct: 167 A 167


>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Length = 167 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Length = 168 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3h2u_B 3h2v_E Length = 284 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Length = 175 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Length = 213 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Length = 292 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Length = 261 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Length = 166 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Length = 175 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Length = 216 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Length = 229 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Length = 139 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Length = 139 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Length = 139 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Length = 198 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Length = 172 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Length = 205 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Length = 198 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Length = 118 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Length = 118 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Length = 118 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Length = 115 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Length = 115 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Length = 115 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Length = 105 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Length = 105 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Length = 105 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Length = 167 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Length = 282 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 85 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 85 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 85 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Length = 87 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Length = 87 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Length = 87 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Length = 196 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Length = 106 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Length = 106 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Length = 106 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Length = 115 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Length = 115 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Length = 115 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Length = 126 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Length = 126 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Length = 126 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Length = 106 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Length = 106 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Length = 106 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} Length = 83 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} Length = 83 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} Length = 83 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Length = 115 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Length = 115 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Length = 115 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Length = 165 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Length = 165 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Length = 165 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 96 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Length = 110 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Length = 110 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Length = 110 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Length = 96 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Length = 96 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Length = 96 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 107 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 107 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 107 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Length = 140 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Length = 108 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Length = 108 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Length = 108 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 115 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 115 Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 115 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Length = 110 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ALT splicing, mRNA processing, mRNA splicing; 1.85A {Homo sapiens} PDB: 2kyx_A 3lpy_A* Length = 85 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ALT splicing, mRNA processing, mRNA splicing; 1.85A {Homo sapiens} PDB: 2kyx_A 3lpy_A* Length = 85 Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ALT splicing, mRNA processing, mRNA splicing; 1.85A {Homo sapiens} PDB: 2kyx_A 3lpy_A* Length = 85 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 95 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 95 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 95 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Length = 95 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Length = 95 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Length = 95 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Length = 158 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Length = 158 Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Length = 158 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Length = 129 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Length = 129 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Length = 129 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Length = 156 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Length = 156 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Length = 156 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Length = 103 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Length = 103 Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Length = 103 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 99 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Length = 108 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 103 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Length = 135 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Length = 135 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Length = 135 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Length = 124 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Length = 124 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Length = 124 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} PDB: 2f9d_A 2f9j_A 2fho_B Length = 115 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Length = 177 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Length = 177 Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Length = 177 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Length = 107 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Length = 107 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Length = 107 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Length = 92 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Length = 92 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Length = 92 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 85 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Length = 124 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Length = 124 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Length = 124 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Length = 95 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Length = 90 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Length = 90 Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Length = 90 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Length = 89 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Length = 89 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Length = 89 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 104 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 113 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 113 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 113 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Length = 116 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 102 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Length = 88 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Length = 88 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Length = 88 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Length = 143 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Length = 143 Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Length = 143 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Length = 229 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Length = 90 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Length = 90 Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Length = 90 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 93 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 93 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 93 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 92 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 90 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Length = 97 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Length = 97 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Length = 97 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 97 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 103 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 103 Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 103 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Length = 156 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Length = 156 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Length = 156 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 108 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 108 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 108 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Length = 102 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Length = 102 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Length = 102 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Length = 110 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Length = 110 Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Length = 110 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Length = 115 Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Length = 115 Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Length = 115 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Length = 127 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Length = 100 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Length = 100 Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Length = 100 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 109 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Length = 95 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Length = 95 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Length = 95 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 99 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Length = 150 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Length = 150 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Length = 150 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Length = 111 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Length = 98 Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Length = 88 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Length = 88 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Length = 88 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Length = 437 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Length = 96 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Length = 96 Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Length = 96 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 119 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 119 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 119 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Length = 97 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Length = 97 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Length = 97 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 103 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Length = 75 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Length = 75 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Length = 75 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 105 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Length = 77 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Length = 77 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Length = 77 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Length = 75 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Length = 75 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Length = 75 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Length = 100 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Length = 100 Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Length = 100 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 97 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 101 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 116 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Length = 87 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Length = 87 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Length = 87 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Length = 109 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Length = 109 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Length = 109 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Length = 111 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Length = 111 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Length = 111 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 105 Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Length = 87 Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Length = 87 Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Length = 87 Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Length = 240 Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Length = 240 Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Length = 240 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 94 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 124 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 124 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 124 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 102 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 114 Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Length = 193 Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Length = 193 Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Length = 193 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 109 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 91 Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Length = 130 Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Length = 130 Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Length = 164 Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Length = 164 Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Length = 164 Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Length = 89 Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Length = 89 Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Length = 89 Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 88 Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 88 Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 88 Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 124 Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 124 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Length = 139 Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Length = 139 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Length = 126 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Length = 126 Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Length = 126 Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Length = 96 Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 118 Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Length = 118 Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 114 Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Length = 136 Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Length = 136 Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Length = 104 Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Length = 104 Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Length = 107 Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Length = 107 Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 123 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Length = 89 Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Length = 104 Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 112 Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Length = 112 Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Length = 105 Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Length = 105 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query356
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 100.0
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 100.0
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 100.0
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 100.0
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 100.0
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 100.0
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 100.0
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 100.0
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 100.0
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 100.0
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 100.0
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 100.0
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 100.0
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 100.0
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 100.0
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 100.0
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 100.0
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 100.0
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.97
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.97
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 99.97
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 99.97
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.97
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.97
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 99.97
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.97
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.97
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.97
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 99.97
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 99.97
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 99.97
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.97
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 99.97
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 99.96
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 99.96
3sde_A261 Paraspeckle component 1; RRM, anti parallel right 99.96
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 99.91
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 99.89
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 99.89
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 99.88
2i2y_A150 Fusion protein consists of immunoglobin G- binding 99.87
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 99.85
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 99.85
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 99.85
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 99.85
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 99.84
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 99.84
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.84
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 99.84
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 99.84
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 99.84
3p5t_L90 Cleavage and polyadenylation specificity factor S; 99.84
2i2y_A150 Fusion protein consists of immunoglobin G- binding 99.84
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 99.84
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 99.83
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 99.83
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 99.83
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 99.83
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 99.83
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 99.83
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 99.83
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 99.83
2la6_A99 RNA-binding protein FUS; structural genomics, nort 99.83
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 99.83
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 99.83
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 99.83
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 99.82
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 99.82
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 99.82
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 99.82
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 99.82
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 99.82
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 99.82
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 99.82
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 99.82
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 99.82
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 99.82
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 99.82
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 99.82
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 99.82
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 99.82
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.82
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 99.82
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 99.82
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 99.81
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 99.81
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 99.81
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 99.81
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 99.81
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 99.81
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 99.81
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 99.81
2cph_A107 RNA binding motif protein 19; RNA recognition moti 99.81
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 99.81
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 99.81
2div_A99 TRNA selenocysteine associated protein; structural 99.81
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 99.81
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 99.81
2cph_A107 RNA binding motif protein 19; RNA recognition moti 99.81
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.81
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 99.81
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 99.81
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 99.81
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 99.81
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 99.81
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 99.81
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 99.81
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 99.81
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 99.81
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 99.81
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 99.81
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 99.81
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 99.8
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 99.8
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 99.8
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 99.8
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 99.8
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 99.8
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 99.8
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 99.8
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 99.8
2la6_A99 RNA-binding protein FUS; structural genomics, nort 99.8
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 99.8
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 99.8
2cqd_A116 RNA-binding region containing protein 1; RNA recog 99.8
2kt5_A124 RNA and export factor-binding protein 2; chaperone 99.8
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 99.8
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 99.8
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 99.8
2div_A99 TRNA selenocysteine associated protein; structural 99.8
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 99.8
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 99.8
1x4e_A85 RNA binding motif, single-stranded interacting pro 99.8
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 99.8
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 99.8
3p5t_L90 Cleavage and polyadenylation specificity factor S; 99.8
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 99.8
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 99.8
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 99.8
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 99.8
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 99.8
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 99.8
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 99.8
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 99.8
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 99.79
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 99.79
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.79
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 99.79
2cqd_A116 RNA-binding region containing protein 1; RNA recog 99.79
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 99.79
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 99.79
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 99.79
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 99.79
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 99.79
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 99.79
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 99.79
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 99.79
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 99.79
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 99.79
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.79
3n9u_C156 Cleavage and polyadenylation specificity factor S; 99.79
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 99.79
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 99.79
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 99.79
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 99.79
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 99.79
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 99.79
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 99.79
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 99.78
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.78
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 99.78
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 99.78
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 99.78
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 99.78
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 99.78
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 99.78
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 99.78
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 99.78
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 99.78
2kt5_A124 RNA and export factor-binding protein 2; chaperone 99.78
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 99.78
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 99.78
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.78
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 99.78
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 99.78
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 99.78
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 99.78
2dis_A109 Unnamed protein product; structural genomics, RRM 99.78
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 99.78
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 99.78
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 99.78
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 99.78
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 99.78
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 99.78
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 99.77
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 99.77
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 99.77
2cpj_A99 Non-POU domain-containing octamer-binding protein; 99.77
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 99.77
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 99.77
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 99.77
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 99.77
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 99.77
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 99.77
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 99.77
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 99.77
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 99.77
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 99.77
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 99.77
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 99.77
3n9u_C156 Cleavage and polyadenylation specificity factor S; 99.77
1x5o_A114 RNA binding motif, single-stranded interacting pro 99.76
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 99.76
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 99.76
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 99.76
1x4e_A85 RNA binding motif, single-stranded interacting pro 99.76
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.76
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 99.76
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 99.76
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 99.76
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 99.76
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 99.76
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 99.76
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 99.76
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 99.76
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 99.76
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 99.76
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 99.76
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 99.76
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 99.76
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 99.76
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 99.76
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.75
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 99.75
1x5o_A114 RNA binding motif, single-stranded interacting pro 99.75
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 99.75
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 99.75
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 99.75
2cpj_A99 Non-POU domain-containing octamer-binding protein; 99.75
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 99.75
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 99.75
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 99.75
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 99.75
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 99.75
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 99.75
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 99.75
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 99.75
2krb_A81 Eukaryotic translation initiation factor 3 subunit 99.75
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 99.75
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 99.75
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 99.75
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 99.75
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 99.75
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 99.75
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 99.75
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 99.75
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 99.74
2dis_A109 Unnamed protein product; structural genomics, RRM 99.74
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 99.74
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 99.74
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 99.74
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 99.74
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 99.74
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 99.74
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 99.74
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 99.74
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 99.74
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 99.74
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 99.74
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 99.73
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 99.73
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 99.73
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 99.73
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 99.73
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.73
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 99.73
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 99.73
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 99.73
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 99.73
2f3j_A177 RNA and export factor binding protein 2; RRM domai 99.73
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 99.73
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 99.73
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 99.73
3q2s_C229 Cleavage and polyadenylation specificity factor S; 99.73
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 99.72
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 99.72
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 99.72
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 99.72
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 99.72
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 99.72
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 99.72
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 99.72
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 99.72
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 99.72
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 99.72
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 99.56
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 99.72
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 99.72
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 99.72
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 99.72
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 99.72
2krb_A81 Eukaryotic translation initiation factor 3 subunit 99.71
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 99.71
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 99.71
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 99.71
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 99.71
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 99.71
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 99.71
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 99.71
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 99.71
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 99.71
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 99.7
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 99.7
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 99.7
1x5p_A97 Negative elongation factor E; structure genomics, 99.7
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 99.7
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 99.7
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 99.7
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 99.7
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 99.7
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 99.7
3q2s_C229 Cleavage and polyadenylation specificity factor S; 99.7
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 99.53
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 99.7
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 99.7
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 99.69
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 99.69
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 99.69
2f3j_A177 RNA and export factor binding protein 2; RRM domai 99.69
1x5p_A97 Negative elongation factor E; structure genomics, 99.69
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 99.69
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 99.68
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 99.68
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 99.68
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 99.67
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 99.67
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 99.67
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 99.66
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 99.66
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 99.66
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 99.65
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 99.65
2dnl_A114 Cytoplasmic polyadenylation element binding protei 99.65
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 99.64
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 99.64
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 99.64
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 99.64
2dnl_A114 Cytoplasmic polyadenylation element binding protei 99.63
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 99.63
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 99.63
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 99.63
3pgw_S437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 99.63
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 99.62
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 99.61
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 99.61
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 99.61
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 99.61
2dit_A112 HIV TAT specific factor 1 variant; structural geno 99.6
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 99.6
2dit_A112 HIV TAT specific factor 1 variant; structural geno 99.59
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 99.58
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 99.56
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 99.54
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 99.53
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 99.5
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 99.5
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 99.5
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 99.45
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 99.42
3tht_A 345 Alkylated DNA repair protein ALKB homolog 8; struc 99.39
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 99.36
3tht_A345 Alkylated DNA repair protein ALKB homolog 8; struc 99.31
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 99.29
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 99.23
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 99.17
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 99.16
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 99.14
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 99.08
1ufw_A95 Synaptojanin 2; RNP domain, structural genomics, r 99.05
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 98.89
3dxb_A222 Thioredoxin N-terminally fused to PUF60(UHM); spli 98.84
2l9w_A117 U4/U6 snRNA-associated-splicing factor PRP24; RRM, 98.58
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 98.46
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 98.06
1uw4_A91 UPF3X; nonsense mediated mRNA decay protein, RNA-b 98.05
1wey_A104 Calcipressin 1; structural genomics, RRM domain, r 97.87
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 97.86
2dhx_A104 Poly (ADP-ribose) polymerase family, member 10 var 97.85
1uw4_A91 UPF3X; nonsense mediated mRNA decay protein, RNA-b 97.77
1wwh_A119 Nucleoporin 35, nucleoporin; structural genomics, 97.6
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 97.58
1wwh_A119 Nucleoporin 35, nucleoporin; structural genomics, 97.56
3ctr_A101 Poly(A)-specific ribonuclease PARN; protein-RNA-co 97.4
3ctr_A101 Poly(A)-specific ribonuclease PARN; protein-RNA-co 97.35
2l08_A97 Regulator of nonsense transcripts 3A; NESG, nonsen 97.31
3p3d_A132 Nucleoporin 53; structural genomics, PSI-2, protei 96.97
3p3d_A132 Nucleoporin 53; structural genomics, PSI-2, protei 96.81
2l08_A97 Regulator of nonsense transcripts 3A; NESG, nonsen 96.68
3pq1_A464 Poly(A) RNA polymerase; nucleotidyl transferase, R 96.1
3pq1_A 464 Poly(A) RNA polymerase; nucleotidyl transferase, R 95.99
3d45_A507 Poly(A)-specific ribonuclease PARN; CAP analogue, 92.54
3d45_A507 Poly(A)-specific ribonuclease PARN; CAP analogue, 86.66
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
Probab=100.00  E-value=3.3e-48  Score=339.70  Aligned_cols=259  Identities=20%  Similarity=0.342  Sum_probs=216.4

Q ss_pred             CCCCCCcCCCCceEEEcCCCCCCCHHHHHHHhhccCCceeEEEEecCCCCccceEEEEEecCHHHHHHHHHHhCCceeCC
Q psy9313          16 STYQSDVNEQNSNLIVNYVPQTMTQEELQHLFSSVGEVESCKLIRDKTTAQSLGYGFVNYYRTEDAERAIIELNGLKLQN   95 (356)
Q Consensus        16 ~~~~~~~~~~~~~l~v~nlp~~~te~~l~~~f~~~g~i~~i~~~~~~~~~~~~g~afV~f~~~~~A~~a~~~l~g~~~~g   95 (356)
                      .......++++++|||+|||.++++++|+++|+.||.|.+|.++++.. + ++|||||+|.+.++|.+|+ .++|..+.|
T Consensus        31 ~~~~~~~~~~~~~l~V~nLp~~~t~~~l~~~F~~~G~i~~v~i~~~~~-~-~~g~afV~f~~~~~A~~A~-~~~~~~~~g  107 (292)
T 2ghp_A           31 ANEALTRNRELTTVLVKNLPKSYNQNKVYKYFKHCGPIIHVDVADSLK-K-NFRFARIEFARYDGALAAI-TKTHKVVGQ  107 (292)
T ss_dssp             -----------CEEEEEEECTTCCHHHHHHHHGGGSCEEEEEEEECTT-S-SSEEEEEEESSHHHHHHHH-TTTTCEETT
T ss_pred             cccccccCCCCCEEEEeCCCCCCCHHHHHHHHHhcCCeEEEEEEECCC-C-CcEEEEEEECCHHHHHHHH-HhCCcEeCC
Confidence            344556688899999999999999999999999999999999999863 2 5799999999999999999 599999999


Q ss_pred             eEEEEEecCCCcccccccceEEcCCCCCCCHHHHHHhhcccC-CeEEEEEecccccccccccccCCCCCCCCCcccEEEE
Q psy9313          96 KSIKVSYARPSSEAIKRANLYVSGLPKHMTQEDLENLFRPYG-TIITSRILCDKMASENVRSFVSGTPEIPQISKGIGFV  174 (356)
Q Consensus        96 ~~l~v~~~~~~~~~~~~~~l~v~nl~~~~t~~~l~~~f~~~g-~i~~v~i~~~~~~~~~~~~~~~~~~~~~~~~~g~afV  174 (356)
                      +.|.|.++.       .++|||+|||..+++++|+++|+.|| .|..+.++.+..+                .++|+|||
T Consensus       108 ~~i~v~~~~-------~~~l~v~nlp~~~t~~~l~~~f~~~G~~i~~v~i~~~~~~----------------~~~g~afV  164 (292)
T 2ghp_A          108 NEIIVSHLT-------ECTLWMTNFPPSYTQRNIRDLLQDINVVALSIRLPSLRFN----------------TSRRFAYI  164 (292)
T ss_dssp             EECEEEECC-------SCEEEEECCCTTCCHHHHHHHHHHTTCCCCEEECC-----------------------CCEEEE
T ss_pred             cEEEEEECC-------CCEEEEECCCCCCCHHHHHHHHHHhCCCeEEEEEEeCCCC----------------CcceEEEE
Confidence            999999874       78899999999999999999999999 9999999887643                57999999


Q ss_pred             EeCCHHHHHHHHHHhcCCCcCCCcccEEEEEccChhhhhHHHhhhhHHHHHHHHHHhhhhcccCCCCccccccccCcccc
Q psy9313         175 RFNQHIEAEHAMQELNGTIPEGASEPITVKFANSPAGRAKALAANLNAQAAAMRHFAAAMRHFGNPLHHSARFKFAPLTA  254 (356)
Q Consensus       175 ~f~~~~~a~~a~~~~~~~~~~~~~~~i~v~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  254 (356)
                      +|.+.++|.+|+..++|..+.|  +.+.+.++.+.......                                       
T Consensus       165 ~f~~~~~a~~A~~~l~g~~~~g--~~l~v~~a~~~~~~~~~---------------------------------------  203 (292)
T 2ghp_A          165 DVTSKEDARYCVEKLNGLKIEG--YTLVTKVSNPLEKSKRT---------------------------------------  203 (292)
T ss_dssp             ECSSHHHHHHHHHHHTTCEETT--EECEEEECCCC---------------------------------------------
T ss_pred             EECCHHHHHHHHHHhCCCEeCC--cEEEEEECCCCcccccc---------------------------------------
Confidence            9999999999999999999999  88999887654322110                                       


Q ss_pred             ccccCCCCCCCCCCCCCcEEEEecCCCC-CcHHHHHHhhcCCCceeEEEEeeCCC-CCCcceEEEEEEccHHHHHHHHHH
Q psy9313         255 DLLNNSMLPPKSLHGSGWCIFVYNLAPE-TEDNVLWQLFGPFGAVQNVKVVRDPQ-TYKCKGFGFVCMTNYDEAVFAIQS  332 (356)
Q Consensus       255 ~~~~~~~~~~~~~~~~~~~l~V~nlp~~-~t~~~L~~~f~~~G~v~~v~i~~~~~-~~~~~g~afV~f~~~~~A~~a~~~  332 (356)
                                ......+++|+|+|||+. +++++|+++|++||.|.+|.++.++. ||.++|+|||+|.+.++|.+|+ .
T Consensus       204 ----------~~~~~~~~~l~v~nlp~~~~t~~~l~~~F~~~G~v~~v~i~~~~~~tg~~~g~afV~F~~~~~A~~A~-~  272 (292)
T 2ghp_A          204 ----------DSATLEGREIMIRNLSTELLDENLLRESFEGFGSIEKINIPAGQKEHSFNNCCAFMVFENKDSAERAL-Q  272 (292)
T ss_dssp             -------------CCTTTEEEEEEECTTTCCHHHHHHHHGGGSCEEEEECCSCCC---CCCEEEEEEESSHHHHHHHG-G
T ss_pred             ----------cccCCCCceEEEECCCcccCCHHHHHHHHhccCCeeEEEEEecCCcCCCCceEEEEEeCCHHHHHHHH-H
Confidence                      001225668999999999 99999999999999999999999877 6899999999999999999999 9


Q ss_pred             hCCcccCCeeEEEEEecCCC
Q psy9313         333 LNGYALGDRLLQVSFKTHKP  352 (356)
Q Consensus       333 l~g~~l~gr~l~v~~a~~~~  352 (356)
                      |||..|+|+.|.|.||.+++
T Consensus       273 l~g~~~~g~~i~V~~a~~k~  292 (292)
T 2ghp_A          273 MNRSLLGNREISVSLADKKP  292 (292)
T ss_dssp             GTTEEETTEEEEEEECCCCC
T ss_pred             hcCCEECCcEEEEEEecCCC
Confidence            99999999999999999875



>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1ufw_A Synaptojanin 2; RNP domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>2l9w_A U4/U6 snRNA-associated-splicing factor PRP24; RRM, U6 snRNP, RNA binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 Back     alignment and structure
>1wey_A Calcipressin 1; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure
>2dhx_A Poly (ADP-ribose) polymerase family, member 10 variant; RRM domain, RNA- binding, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1uw4_A UPF3X; nonsense mediated mRNA decay protein, RNA-binding protein, N domain, MIF4G domain; 1.95A {Homo sapiens} SCOP: d.58.7.4 Back     alignment and structure
>1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure
>1wwh_A Nucleoporin 35, nucleoporin; structural genomics, MPPN, riken structural genomics/proteomics initiative, RSGI, protein transport; 2.70A {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} Back     alignment and structure
>3ctr_A Poly(A)-specific ribonuclease PARN; protein-RNA-complex, M7G-CAP, M7GTP, RNA recognition motif, RRM, cytoplasm, exonuclease, hydrolase, magnesium; HET: MGP; 2.10A {Homo sapiens} Back     alignment and structure
>2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii} Back     alignment and structure
>3p3d_A Nucleoporin 53; structural genomics, PSI-2, protein structure initiative, NE structural genomix research consortium, nysgxrc; 2.35A {Pichia guilliermondii} Back     alignment and structure
>2l08_A Regulator of nonsense transcripts 3A; NESG, nonsense regulator, structural genomics, PSI-2, protei structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} Back     alignment and structure
>3pq1_A Poly(A) RNA polymerase; nucleotidyl transferase, RNP-type RNA binding domain, poly(A polymerase, mitochondria, transferase; 3.10A {Homo sapiens} Back     alignment and structure
>3d45_A Poly(A)-specific ribonuclease PARN; CAP analogue, exonuclease, hydrolase, magnesium, metal nonsense-mediated mRNA decay, nucleus; HET: 7MG GDP; 3.00A {Mus musculus} Back     alignment and structure
>3d45_A Poly(A)-specific ribonuclease PARN; CAP analogue, exonuclease, hydrolase, magnesium, metal nonsense-mediated mRNA decay, nucleus; HET: 7MG GDP; 3.00A {Mus musculus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 356
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 2e-18
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 6e-16
d1b7fa285 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophil 3e-13
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 4e-18
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 1e-13
d2f9da1114 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p 3e-11
d1fxla285 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho 1e-17
d1fxla285 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho 2e-14
d1fxla285 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Ho 5e-11
d1wf2a_98 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 2e-17
d1wf2a_98 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 2e-13
d1wf2a_98 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 3e-10
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 2e-17
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 1e-15
d1cvja180 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human 3e-13
d1b7fa182 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil 4e-17
d1b7fa182 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil 7e-12
d1b7fa182 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophil 6e-10
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 5e-17
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 8e-14
d2cpha194 d.58.7.1 (A:454-547) Probable RNA-binding protein 9e-12
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 2e-16
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 1e-12
d1u1qa_183 d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1 1e-11
d1h2vz_93 d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro 2e-16
d1h2vz_93 d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro 6e-14
d1h2vz_93 d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding pro 4e-10
d2cqga190 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD 8e-16
d2cqga190 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD 4e-11
d2cqga190 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TD 3e-10
d1x5ua193 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu 9e-16
d1x5ua193 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu 1e-11
d1x5ua193 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Hu 2e-11
d1x4ga196 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s 1e-15
d1x4ga196 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s 6e-13
d1x4ga196 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo s 2e-08
d2cq0a190 d.58.7.1 (A:231-320) Eukaryotic translation initia 4e-15
d2cq0a190 d.58.7.1 (A:231-320) Eukaryotic translation initia 8e-11
d2cq0a190 d.58.7.1 (A:231-320) Eukaryotic translation initia 4e-09
d1fxla182 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom 5e-15
d1fxla182 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom 6e-11
d1fxla182 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Hom 1e-08
d2u2fa_85 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 3e-14
d2u2fa_85 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 8e-13
d2u2fa_85 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 7e-10
d1cvja289 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human 5e-14
d1cvja289 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human 1e-11
d1cvja289 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human 2e-10
d2cqba189 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer 7e-14
d2cqba189 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer 9e-12
d2cqba189 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomer 1e-08
d2cpea1101 d.58.7.1 (A:353-453) RNA-binding protein EWS {Huma 1e-13
d2cpea1101 d.58.7.1 (A:353-453) RNA-binding protein EWS {Huma 2e-11
d2cpea1101 d.58.7.1 (A:353-453) RNA-binding protein EWS {Huma 4e-09
d2cpza1102 d.58.7.1 (A:383-484) CUG triplet repeat RNA-bindin 1e-13
d2cpza1102 d.58.7.1 (A:383-484) CUG triplet repeat RNA-bindin 9e-11
d2cpza1102 d.58.7.1 (A:383-484) CUG triplet repeat RNA-bindin 5e-09
d2cqia190 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sa 2e-13
d2cqia190 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sa 1e-09
d2cqia190 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sa 4e-09
d1whwa_99 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 3e-13
d1whwa_99 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 5e-11
d1whwa_99 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 3e-09
d1no8a_78 d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu 3e-13
d1no8a_78 d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu 7e-13
d1no8a_78 d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus muscu 8e-11
d1uawa_77 d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax 3e-13
d1uawa_77 d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax 1e-10
d1uawa_77 d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [Tax 8e-10
d1x5ta183 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Hu 6e-13
d1x5ta183 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Hu 7e-13
d1x5ta183 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Hu 1e-10
d2cpfa185 d.58.7.1 (A:362-446) Probable RNA-binding protein 6e-13
d2cpfa185 d.58.7.1 (A:362-446) Probable RNA-binding protein 2e-12
d2cpfa185 d.58.7.1 (A:362-446) Probable RNA-binding protein 2e-11
d2cpda186 d.58.7.1 (A:223-308) APOBEC1 stimulating protein { 7e-13
d2cpda186 d.58.7.1 (A:223-308) APOBEC1 stimulating protein { 1e-10
d2cpda186 d.58.7.1 (A:223-308) APOBEC1 stimulating protein { 6e-08
d1x4ba1103 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucle 7e-13
d1x4ba1103 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucle 4e-11
d1x4ba1103 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucle 6e-10
d2adba1108 d.58.7.1 (A:177-284) Polypyrimidine tract-binding 8e-13
d2adba1108 d.58.7.1 (A:177-284) Polypyrimidine tract-binding 7e-10
d2adba1108 d.58.7.1 (A:177-284) Polypyrimidine tract-binding 4e-09
d1rk8a_88 d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Dr 9e-13
d1rk8a_88 d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Dr 1e-12
d1rk8a_88 d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Dr 3e-08
d2cqca183 d.58.7.1 (A:109-191) Arginine/serine-rich splicing 1e-12
d2cqca183 d.58.7.1 (A:109-191) Arginine/serine-rich splicing 6e-12
d2cqca183 d.58.7.1 (A:109-191) Arginine/serine-rich splicing 8e-08
d1nu4a_91 d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo 1e-12
d1nu4a_91 d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo 1e-09
d1nu4a_91 d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo 1e-07
d2cq3a193 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human 2e-12
d2cq3a193 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human 7e-10
d2cq3a193 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human 2e-09
d2cpja186 d.58.7.1 (A:65-150) Non-POU domain-containing octa 2e-12
d2cpja186 d.58.7.1 (A:65-150) Non-POU domain-containing octa 7e-11
d2cpja186 d.58.7.1 (A:65-150) Non-POU domain-containing octa 4e-10
d2cq4a1101 d.58.7.1 (A:132-232) RNA binding protein 23 {Human 3e-12
d2cq4a1101 d.58.7.1 (A:132-232) RNA binding protein 23 {Human 2e-10
d2cq4a1101 d.58.7.1 (A:132-232) RNA binding protein 23 {Human 1e-07
d2disa196 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 { 4e-12
d2disa196 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 { 5e-11
d2disa196 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 { 9e-10
d2cqpa186 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mous 5e-12
d2cqpa186 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mous 3e-11
d2cqpa186 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mous 2e-08
d2dita199 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Huma 8e-12
d2dita199 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Huma 8e-10
d2dita199 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Huma 1e-04
d1hd0a_75 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 8e-12
d1hd0a_75 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 2e-10
d1hd0a_75 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 2e-06
d2cpxa1102 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 9e-12
d2cpxa1102 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 3e-09
d2cpxa1102 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 3e-06
d1x4aa195 d.58.7.1 (A:9-103) Splicing factor, arginine/serin 2e-11
d1x4aa195 d.58.7.1 (A:9-103) Splicing factor, arginine/serin 3e-10
d1x4aa195 d.58.7.1 (A:9-103) Splicing factor, arginine/serin 2e-08
d2ghpa181 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splici 2e-11
d2ghpa181 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splici 7e-10
d2ghpa181 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splici 1e-07
d1fjca_96 d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice 2e-11
d1fjca_96 d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice 8e-10
d1fjca_96 d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocrice 2e-08
d1u2fa_90 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 3e-11
d1u2fa_90 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 7e-09
d1u2fa_90 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 3e-06
d1x4ha198 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse ( 5e-11
d1x4ha198 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse ( 1e-07
d1x4ha198 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse ( 1e-06
d1x0fa175 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 6e-11
d1x0fa175 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 2e-10
d1x0fa175 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 4e-08
d1u6fa1139 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypa 8e-11
d1u6fa1139 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypa 8e-08
d1u6fa1139 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypa 3e-06
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 d.58.7.3 (A:) 9e-11
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 d.58.7.3 (A:) 6e-10
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 d.58.7.3 (A:) 1e-06
d1o0pa_104 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 1e-10
d1o0pa_104 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 9e-07
d1o0pa_104 d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit 0.004
d2adca1109 d.58.7.1 (A:335-443) Polypyrimidine tract-binding 1e-10
d2adca1109 d.58.7.1 (A:335-443) Polypyrimidine tract-binding 2e-08
d2adca1109 d.58.7.1 (A:335-443) Polypyrimidine tract-binding 0.002
d1l3ka184 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RN 1e-10
d1l3ka184 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RN 3e-09
d1l3ka184 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RN 2e-07
d1weya_104 d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) 2e-10
d1weya_104 d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) 7e-06
d1weya_104 d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) 1e-05
d1x5sa190 d.58.7.1 (A:8-97) Cold-inducible RNA-binding prote 2e-10
d1x5sa190 d.58.7.1 (A:8-97) Cold-inducible RNA-binding prote 7e-10
d1x5sa190 d.58.7.1 (A:8-97) Cold-inducible RNA-binding prote 3e-07
d1wf0a_88 d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 { 3e-10
d1wf0a_88 d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 { 2e-07
d1wf0a_88 d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 { 1e-05
d2msta_75 d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 5e-10
d2msta_75 d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 3e-09
d2msta_75 d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 1e-06
d2cqda1103 d.58.7.1 (A:1-103) RNA-binding region containing p 7e-10
d2cqda1103 d.58.7.1 (A:1-103) RNA-binding region containing p 2e-09
d2cqda1103 d.58.7.1 (A:1-103) RNA-binding region containing p 2e-07
d2bz2a179 d.58.7.1 (A:35-113) Negative elongation factor E, 8e-10
d2bz2a179 d.58.7.1 (A:35-113) Negative elongation factor E, 1e-09
d1p1ta_104 d.58.7.1 (A:) Cleavage stimulation factor, 64 kda 2e-09
d1p1ta_104 d.58.7.1 (A:) Cleavage stimulation factor, 64 kda 1e-08
d1p1ta_104 d.58.7.1 (A:) Cleavage stimulation factor, 64 kda 5e-07
d2cqha180 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 is 2e-09
d2cqha180 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 is 4e-09
d2cqha180 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 is 4e-08
d2cpia189 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase C 2e-09
d2cpia189 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase C 2e-08
d2cpia189 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase C 1e-05
d2cpya1103 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human 4e-09
d2cpya1103 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human 4e-07
d2cpya1103 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human 3e-04
d1wg1a_88 d.58.7.1 (A:) Probable RNA-binding protein KIAA157 5e-09
d1wg1a_88 d.58.7.1 (A:) Probable RNA-binding protein KIAA157 1e-07
d1wg1a_88 d.58.7.1 (A:) Probable RNA-binding protein KIAA157 2e-06
d1wi8a_104 d.58.7.1 (A:) Eukaryotic translation initiation fa 6e-09
d1wi8a_104 d.58.7.1 (A:) Eukaryotic translation initiation fa 3e-08
d1wi8a_104 d.58.7.1 (A:) Eukaryotic translation initiation fa 1e-05
d1x5oa1101 d.58.7.1 (A:8-108) RNA-binding motif, single-stran 1e-08
d1x5oa1101 d.58.7.1 (A:8-108) RNA-binding motif, single-stran 2e-07
d1x5oa1101 d.58.7.1 (A:8-108) RNA-binding motif, single-stran 2e-05
d1wg5a_104 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 1e-08
d2ghpa386 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splici 1e-08
d2ghpa386 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splici 6e-08
d2ghpa386 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splici 5e-05
d1wg4a_98 d.58.7.1 (A:) Splicing factor, arginine/serine-ric 2e-08
d1wg4a_98 d.58.7.1 (A:) Splicing factor, arginine/serine-ric 1e-06
d1wg4a_98 d.58.7.1 (A:) Splicing factor, arginine/serine-ric 5e-04
d1l3ka279 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 2e-08
d1l3ka279 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 4e-08
d1l3ka279 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 9e-06
d2cq2a1101 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 2e-08
d2cq2a1101 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 4e-08
d2cq2a1101 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 1e-06
d1whya_97 d.58.7.1 (A:) Putative RNA-binding protein 15B, Rb 4e-08
d1whya_97 d.58.7.1 (A:) Putative RNA-binding protein 15B, Rb 5e-08
d1whya_97 d.58.7.1 (A:) Putative RNA-binding protein 15B, Rb 2e-07
d1weza_102 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 9e-08
d1x4ea172 d.58.7.1 (A:8-79) RNA-binding motif, single-strand 2e-07
d1x4ea172 d.58.7.1 (A:8-79) RNA-binding motif, single-strand 2e-07
d1x4ea172 d.58.7.1 (A:8-79) RNA-binding motif, single-strand 2e-04
d1wwha181 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus mu 3e-07
d1wwha181 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus mu 0.001
d1x4da189 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [ 7e-07
d1x4da189 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [ 2e-05
d1x4da189 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [ 3e-05
d1fjeb191 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesoc 8e-07
d1fjeb191 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesoc 0.002
d2b0ga183 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosoph 3e-06
d1wela1112 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human 5e-06
d2adca288 d.58.7.1 (A:444-531) Polypyrimidine tract-binding 6e-06
d2adca288 d.58.7.1 (A:444-531) Polypyrimidine tract-binding 3e-05
d2adca288 d.58.7.1 (A:444-531) Polypyrimidine tract-binding 3e-04
d1wexa_104 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 8e-06
d1wexa_104 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 1e-05
d1wexa_104 d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprot 4e-05
d1whxa_111 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 1e-05
d1whxa_111 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 7e-04
d1whxa_111 d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm 0.004
d1zh5a285 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo 4e-05
d1zh5a285 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo 8e-05
d2cq1a188 d.58.7.1 (A:51-138) Polypyrimidine tract-binding p 8e-05
d2cq1a188 d.58.7.1 (A:51-138) Polypyrimidine tract-binding p 2e-04
d2cq1a188 d.58.7.1 (A:51-138) Polypyrimidine tract-binding p 7e-04
d3begb187 d.58.7.1 (B:121-207) Splicing factor, arginine/ser 9e-05
d3begb187 d.58.7.1 (B:121-207) Splicing factor, arginine/ser 2e-04
d1owxa_113 d.58.7.1 (A:) Lupus LA protein {Human (Homo sapien 1e-04
d2ghpa275 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicin 2e-04
d1wi6a175 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 0.002
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Sex-lethal protein
species: Drosophila melanogaster [TaxId: 7227]
 Score = 76.9 bits (189), Expect = 2e-18
 Identities = 37/99 (37%), Positives = 57/99 (57%), Gaps = 15/99 (15%)

Query: 108 EAIKRANLYVSGLPKHMTQEDLENLFRPYGTIITSRILCDKMASENVRSFVSGTPEIPQI 167
           E+IK  NLYV+ LP+ +T + L+ +F  YG+I+   IL DK+                  
Sbjct: 2   ESIKDTNLYVTNLPRTITDDQLDTIFGKYGSIVQKNILRDKL---------------TGR 46

Query: 168 SKGIGFVRFNQHIEAEHAMQELNGTIPEGASEPITVKFA 206
            +G+ FVR+N+  EA+ A+  LN  IPEG S+P++V+ A
Sbjct: 47  PRGVAFVRYNKREEAQEAISALNNVIPEGGSQPLSVRLA 85


>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 85 Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Length = 114 Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Length = 98 Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Length = 82 Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 94 Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 183 Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Length = 82 Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 89 Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 99 Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Length = 78 Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 77 Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 85 Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 108 Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 88 Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 88 Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 88 Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Length = 83 Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Length = 91 Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Length = 96 Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Length = 86 Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 95 Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 81 Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 96 Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Length = 75 Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Length = 139 Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Length = 139 Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Length = 139 Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 109 Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 90 Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Length = 104 Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 86 Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Length = 98 Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Length = 79 Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Length = 101 Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Length = 102 Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Length = 72 Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Length = 81 Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 89 Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 91 Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Length = 91 Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Length = 83 Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Length = 112 Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Length = 104 Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Length = 111 Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 85 Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 87 Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Length = 87 Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Length = 113 Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 75 Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 75 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query356
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.97
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.97
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 99.88
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.88
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 99.88
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.87
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 99.87
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 99.87
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.87
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.87
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 99.87
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 99.87
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 99.87
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.87
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 99.87
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 99.87
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.86
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 99.86
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.86
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.86
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 99.86
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 99.86
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 99.86
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 99.86
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.85
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.85
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.85
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.85
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.85
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 99.85
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 99.85
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.85
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.85
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 99.85
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.84
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 99.84
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 99.84
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 99.84
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.84
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.84
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.84
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.84
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 99.84
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.84
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 99.84
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 99.84
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 99.84
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.84
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 99.84
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.84
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.83
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 99.83
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 99.83
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.83
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 99.83
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 99.83
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 99.83
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 99.83
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 99.83
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 99.82
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 99.82
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 99.82
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.82
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 99.82
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.82
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 99.82
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 99.81
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 99.81
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.81
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.81
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 99.81
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 99.81
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 99.81
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 99.81
d2cpja186 Non-POU domain-containing octamer-binding protein, 99.81
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 99.81
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 99.8
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 99.8
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 99.8
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 99.8
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.8
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 99.8
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 99.8
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 99.79
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.79
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 99.79
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 99.79
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 99.79
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.79
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.79
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 99.79
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.79
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.79
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 99.78
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 99.78
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 99.78
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 99.78
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 99.78
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.78
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 99.78
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 99.78
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 99.78
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 99.77
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 99.77
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 99.77
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 99.77
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.77
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 99.77
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 99.77
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 99.77
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 99.77
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 99.77
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 99.77
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 99.76
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 99.76
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.76
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 99.76
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 99.76
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 99.76
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.76
d2cpja186 Non-POU domain-containing octamer-binding protein, 99.76
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 99.76
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 99.76
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 99.76
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 99.76
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 99.76
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 99.76
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 99.76
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 99.76
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 99.75
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 99.75
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 99.75
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 99.75
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.74
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.74
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 99.74
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.73
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.73
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 99.73
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 99.73
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 99.73
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.73
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 99.73
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 99.73
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.72
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 99.72
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 99.72
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.72
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 99.72
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 99.71
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 99.71
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 99.71
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 99.71
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 99.7
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.69
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 99.67
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.66
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 99.65
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 99.61
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.61
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 99.58
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 99.57
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 99.55
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 99.55
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.54
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.52
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 99.48
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 99.46
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 99.44
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 99.43
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 99.39
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 99.36
d2dgxa173 Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 98.16
d1ufwa_95 Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] 98.14
d1uw4a_91 RNA processing protein UPF3x, RRM domain {Human (H 98.06
d1ufwa_95 Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606] 97.71
d1uw4a_91 RNA processing protein UPF3x, RRM domain {Human (H 97.68
d2dgxa173 Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 960 97.29
d1whva_100 Poly(A)-specific ribonuclease PARN {Mouse (Mus mus 96.48
d1whva_100 Poly(A)-specific ribonuclease PARN {Mouse (Mus mus 95.14
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ferredoxin-like
superfamily: RNA-binding domain, RBD
family: Canonical RBD
domain: Nuclear ribonucleoprotein A1 (RNP A1, UP1)
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.97  E-value=1.4e-30  Score=209.84  Aligned_cols=169  Identities=24%  Similarity=0.424  Sum_probs=150.0

Q ss_pred             CCCCceEEEcCCCCCCCHHHHHHHhhccCCceeEEEEecCCCCccceEEEEEecCHHHHHHHHHHhCCceeCCeEEEEEe
Q psy9313          23 NEQNSNLIVNYVPQTMTQEELQHLFSSVGEVESCKLIRDKTTAQSLGYGFVNYYRTEDAERAIIELNGLKLQNKSIKVSY  102 (356)
Q Consensus        23 ~~~~~~l~v~nlp~~~te~~l~~~f~~~g~i~~i~~~~~~~~~~~~g~afV~f~~~~~A~~a~~~l~g~~~~g~~l~v~~  102 (356)
                      +...++|||+|||+.+|+++|+++|++||.|.++.++.+..++.++|+|||+|.+.++|.+|+ .+.+..+.++.+.+.+
T Consensus         3 p~~~r~lfV~nLp~~~te~~L~~~F~~~G~v~~~~~~~~~~~~~~~g~afv~f~~~~~a~~a~-~~~~~~~~~~~~~~~~   81 (183)
T d1u1qa_           3 PEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPNTKRSRGFGFVTYATVEEVDAAM-NARPHKVDGRVVEPKR   81 (183)
T ss_dssp             CHHHHEEEEESCCTTCCHHHHHHHHGGGSCEEEEEEEECTTTCCEEEEEEEEESSHHHHHHHH-HTCSCEETTEECEEEE
T ss_pred             CCCCCEEEEECCCCCCCHHHHHHHHHHcCCEEEEEeeecccCCCccCceecccCCHHHHHHHH-HhcCCcccccchhhhh
Confidence            345689999999999999999999999999999999999999999999999999999999999 5678889999998887


Q ss_pred             cCCCcc------cccccceEEcCCCCCCCHHHHHHhhcccCCeEEEEEecccccccccccccCCCCCCCCCcccEEEEEe
Q psy9313         103 ARPSSE------AIKRANLYVSGLPKHMTQEDLENLFRPYGTIITSRILCDKMASENVRSFVSGTPEIPQISKGIGFVRF  176 (356)
Q Consensus       103 ~~~~~~------~~~~~~l~v~nl~~~~t~~~l~~~f~~~g~i~~v~i~~~~~~~~~~~~~~~~~~~~~~~~~g~afV~f  176 (356)
                      ..+...      ....++|||+|||..+|+++|+++|+.||.|..+.++.+..++               .++|+|||+|
T Consensus        82 ~~~~~~~~~~~~~~~~~~i~V~~lp~~~te~~L~~~f~~~G~v~~~~i~~~~~~~---------------~~~g~~fV~f  146 (183)
T d1u1qa_          82 AVSREDSQRPGAHLTVKKIFVGGIKEDTEEHHLRDYFEQYGKIEVIEIMTDRGSG---------------KKRGFAFVTF  146 (183)
T ss_dssp             CCCTTGGGSTTTTCCCSEEEEECCCTTCCHHHHHHHHGGGSCEEEEEEEECTTTC---------------CEEEEEEEEE
T ss_pred             hhhcccccccccccccceeEEccCCCcCCHHHHhhhhccCCceeeeeeecccccC---------------ccceeEEEEE
Confidence            765433      3445789999999999999999999999999999999876553               4789999999


Q ss_pred             CCHHHHHHHHHHhcCCCcCCCcccEEEEEccChh
Q psy9313         177 NQHIEAEHAMQELNGTIPEGASEPITVKFANSPA  210 (356)
Q Consensus       177 ~~~~~a~~a~~~~~~~~~~~~~~~i~v~~~~~~~  210 (356)
                      .+.++|++|++ +++..+.|  +++.|.++.++.
T Consensus       147 ~~~e~A~~Al~-~~~~~~~G--~~i~V~~A~~k~  177 (183)
T d1u1qa_         147 DDHDSVDKIVI-QKYHTVNG--HNCEVRKALSKQ  177 (183)
T ss_dssp             SCHHHHHHHHT-SSCEEETT--EEEEEEECCCHH
T ss_pred             CCHHHHHHHHH-hCCCeECC--EEEEEEecCCcc
Confidence            99999999997 68888888  889999887653



>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ufwa_ d.58.7.1 (A:) Synaptojanin 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uw4a_ d.58.7.4 (A:) RNA processing protein UPF3x, RRM domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dgxa1 d.58.7.1 (A:563-635) Limkain-b1, LKAP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whva_ d.58.7.1 (A:) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whva_ d.58.7.1 (A:) Poly(A)-specific ribonuclease PARN {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure