Psyllid ID: psy9351
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 297 | ||||||
| 237681141 | 516 | glycerol kinase-like [Tribolium castaneu | 0.949 | 0.546 | 0.674 | 1e-110 | |
| 350401134 | 552 | PREDICTED: putative glycerol kinase 3-li | 0.959 | 0.516 | 0.641 | 1e-109 | |
| 340709553 | 552 | PREDICTED: putative glycerol kinase 3-li | 0.959 | 0.516 | 0.641 | 1e-109 | |
| 156553984 | 553 | PREDICTED: putative glycerol kinase 3-li | 0.973 | 0.522 | 0.642 | 1e-108 | |
| 157107705 | 517 | glycerol kinase [Aedes aegypti] gi|10887 | 0.959 | 0.551 | 0.671 | 1e-108 | |
| 168823402 | 514 | glycerol kinase [Bombyx mori] gi|1680853 | 0.976 | 0.564 | 0.651 | 1e-108 | |
| 307206432 | 517 | Glycerol kinase [Harpegnathos saltator] | 0.942 | 0.541 | 0.655 | 1e-108 | |
| 307204946 | 546 | Glycerol kinase [Harpegnathos saltator] | 0.956 | 0.520 | 0.636 | 1e-108 | |
| 322788409 | 515 | hypothetical protein SINV_09388 [Solenop | 0.939 | 0.541 | 0.657 | 1e-108 | |
| 383865305 | 515 | PREDICTED: putative glycerol kinase 3-li | 0.966 | 0.557 | 0.643 | 1e-107 |
| >gi|237681141|ref|NP_001153713.1| glycerol kinase-like [Tribolium castaneum] gi|270003063|gb|EEZ99510.1| hypothetical protein TcasGA2_TC000091 [Tribolium castaneum] | Back alignment and taxonomy information |
|---|
Score = 404 bits (1037), Expect = e-110, Method: Compositional matrix adjust.
Identities = 195/289 (67%), Positives = 229/289 (79%), Gaps = 7/289 (2%)
Query: 9 GPLVGAIDEGTSSCRFIVFSALTGKLVAKHQISLGQTFPTEGWVEQDPMEILAVVNGTIE 68
GPLVGAIDEGTSS RFI+F A T ++VA HQ L Q +P EGWVEQ+PMEIL VVN IE
Sbjct: 9 GPLVGAIDEGTSSARFILFKAGTTQVVASHQKELSQIYPQEGWVEQNPMEILDVVNECIE 68
Query: 69 ACQFSACVEKLKEQGIEPTDIVAVGVTNQRESTIAWDKITGEPLYNSIVWLDARTTSTLE 128
A ++KL G DIV+VGVTNQRESTI WDK TGEPLYNSIVWLD RT++T++
Sbjct: 69 AT-----IDKLIALGGTVNDIVSVGVTNQRESTIVWDKTTGEPLYNSIVWLDVRTSTTVD 123
Query: 129 KILEVVPNK--NKNYLAPLCGLPLSPYFSALKINWLMNNVPKVKEAIDQNRCCIGTVDTW 186
++L+ VPNK NKNYL PLCGLP+SPYFSA+K+ WL +NVPKVK+A+ C GTVD+W
Sbjct: 124 QLLDKVPNKTRNKNYLKPLCGLPMSPYFSAVKLKWLQDNVPKVKKAMAAKNCLFGTVDSW 183
Query: 187 IIWNLTGGKDGGKYITDVSNASRTMLMNIETLEWDPMLCGFFTIPMDILPTICSSSEIYG 246
+IWNLTGGKDGG ++TDVSNASRTMLMNI+TL+WDP+L FF +P ILP I SSSE+YG
Sbjct: 184 LIWNLTGGKDGGVHVTDVSNASRTMLMNIDTLKWDPVLLNFFELPTSILPAIKSSSEVYG 243
Query: 247 HFVSGPLKGVPISGCLGDQHAALLGQNCLKPGLAKSTYGTGCFLLYNTG 295
G L+ +PISGCLGDQ AAL+GQ CL G AK+TYGTGCFLLYNTG
Sbjct: 244 KIKEGALQNIPISGCLGDQQAALVGQQCLDRGQAKATYGTGCFLLYNTG 292
|
Source: Tribolium castaneum Species: Tribolium castaneum Genus: Tribolium Family: Tenebrionidae Order: Coleoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|350401134|ref|XP_003486058.1| PREDICTED: putative glycerol kinase 3-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|340709553|ref|XP_003393370.1| PREDICTED: putative glycerol kinase 3-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|156553984|ref|XP_001603134.1| PREDICTED: putative glycerol kinase 3-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|157107705|ref|XP_001649900.1| glycerol kinase [Aedes aegypti] gi|108879512|gb|EAT43737.1| AAEL004853-PA [Aedes aegypti] | Back alignment and taxonomy information |
|---|
| >gi|168823402|ref|NP_001108335.1| glycerol kinase [Bombyx mori] gi|168085334|dbj|BAG09482.1| glycerol kinase [Bombyx mori] | Back alignment and taxonomy information |
|---|
| >gi|307206432|gb|EFN84470.1| Glycerol kinase [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|307204946|gb|EFN83485.1| Glycerol kinase [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|322788409|gb|EFZ14080.1| hypothetical protein SINV_09388 [Solenopsis invicta] | Back alignment and taxonomy information |
|---|
| >gi|383865305|ref|XP_003708115.1| PREDICTED: putative glycerol kinase 3-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 297 | ||||||
| ZFIN|ZDB-GENE-080204-72 | 534 | zgc:172295 "zgc:172295" [Danio | 0.949 | 0.528 | 0.616 | 4.8e-94 | |
| UNIPROTKB|F1NRQ6 | 552 | GK "Uncharacterized protein" [ | 0.949 | 0.510 | 0.602 | 7.8e-94 | |
| RGD|70893 | 524 | Gk "glycerol kinase" [Rattus n | 0.962 | 0.545 | 0.592 | 1.1e-92 | |
| UNIPROTKB|Q63060 | 524 | Gk "Glycerol kinase" [Rattus n | 0.962 | 0.545 | 0.592 | 1.1e-92 | |
| UNIPROTKB|D4A354 | 559 | Gk "Glycerol kinase" [Rattus n | 0.962 | 0.511 | 0.583 | 3.5e-91 | |
| UNIPROTKB|E2QSE8 | 554 | E2QSE8 "Uncharacterized protei | 0.959 | 0.514 | 0.584 | 7.3e-91 | |
| UNIPROTKB|E2RNT9 | 524 | GK "Uncharacterized protein" [ | 0.959 | 0.543 | 0.584 | 7.3e-91 | |
| UNIPROTKB|F1SPV0 | 524 | LOC100523928 "Uncharacterized | 0.959 | 0.543 | 0.591 | 7.3e-91 | |
| UNIPROTKB|Q2NKZ8 | 553 | LOC538702 "Uncharacterized pro | 0.962 | 0.517 | 0.582 | 1.5e-90 | |
| UNIPROTKB|Q14409 | 553 | GK3P "Putative glycerol kinase | 0.962 | 0.517 | 0.585 | 1.5e-90 |
| ZFIN|ZDB-GENE-080204-72 zgc:172295 "zgc:172295" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
Score = 936 (334.5 bits), Expect = 4.8e-94, P = 4.8e-94
Identities = 177/287 (61%), Positives = 218/287 (75%)
Query: 9 GPLVGAIDEGTSSCRFIVFSALTGKLVAKHQISLGQTFPTEGWVEQDPMEILAVVNGTIE 68
GPLV AID+GTSS RF+VF+A T +L++ HQ+ + Q+FP EGWVE+DP EIL ++
Sbjct: 15 GPLVAAIDQGTSSTRFLVFNAKTAELLSHHQVEIKQSFPKEGWVEEDPKEILQ----SVY 70
Query: 69 ACQFSACVEKLKEQGIEPTDIVAVGVTNQRESTIAWDKITGEPLYNSIVWLDARTTSTLE 128
C C EKL + I+ ++I AVGVTNQRE+T+ WDK TGEPLYN+IVWLD RT ST+E
Sbjct: 71 ECMDRTC-EKLTQLNIDVSNIKAVGVTNQRETTLVWDKQTGEPLYNAIVWLDLRTQSTVE 129
Query: 129 KILEVVPNKNKNYLAPLCGLPLSPYFSALKINWLMNNVPKVKEAIDQNRCCIGTVDTWII 188
+++ P KNKN+L GLP+S YFSA+K+ WLM+NV KV EA+ +R GTVD+W+I
Sbjct: 130 RLINKTPGKNKNHLKDKTGLPISTYFSAVKLRWLMDNVEKVHEAVLSHRAMFGTVDSWLI 189
Query: 189 WNLTGGKDGGKYITDVSNASRTMLMNIETLEWDPMLCGFFTIPMDILPTICSSSEIYGHF 248
W LTGGK+GG + TDV+NASRTML NI T++WDP LC +F IPM ILP + SSSEIYG
Sbjct: 190 WCLTGGKNGGVHCTDVTNASRTMLFNIHTMDWDPELCIYFDIPMGILPKVRSSSEIYGLM 249
Query: 249 VSGPLKGVPISGCLGDQHAALLGQNCLKPGLAKSTYGTGCFLLYNTG 295
SGPL GVPISGCLGDQ AAL+GQ C K G AK+TYGTGCFLL N G
Sbjct: 250 KSGPLTGVPISGCLGDQSAALVGQMCFKDGQAKNTYGTGCFLLKNVG 296
|
|
| UNIPROTKB|F1NRQ6 GK "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| RGD|70893 Gk "glycerol kinase" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q63060 Gk "Glycerol kinase" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|D4A354 Gk "Glycerol kinase" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2QSE8 E2QSE8 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E2RNT9 GK "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SPV0 LOC100523928 "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q2NKZ8 LOC538702 "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q14409 GK3P "Putative glycerol kinase 3" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 297 | |||
| cd07792 | 504 | cd07792, FGGY_GK1-3_metazoa, Metazoan glycerol kin | 1e-179 | |
| TIGR01311 | 493 | TIGR01311, glycerol_kin, glycerol kinase | 1e-152 | |
| cd07769 | 484 | cd07769, FGGY_GK, Glycerol kinases; a subfamily of | 1e-149 | |
| PTZ00294 | 504 | PTZ00294, PTZ00294, glycerol kinase-like protein; | 1e-134 | |
| PLN02295 | 512 | PLN02295, PLN02295, glycerol kinase | 1e-131 | |
| cd07795 | 496 | cd07795, FGGY_ScGut1p_like, Saccharomyces cerevisi | 1e-130 | |
| COG0554 | 499 | COG0554, GlpK, Glycerol kinase [Energy production | 1e-128 | |
| cd07786 | 486 | cd07786, FGGY_EcGK_like, Escherichia coli glycerol | 1e-126 | |
| PRK00047 | 498 | PRK00047, glpK, glycerol kinase; Provisional | 1e-121 | |
| cd07789 | 495 | cd07789, FGGY_CsGK_like, Cellulomonas sp | 1e-117 | |
| cd07796 | 503 | cd07796, FGGY_NHO1_plant, Arabidopsis NHO1 and rel | 1e-105 | |
| cd10427 | 487 | cd10427, FGGY_GK_1, Uncharacterized subgroup; belo | 1e-104 | |
| cd07791 | 484 | cd07791, FGGY_GK2_bacteria, bacterial glycerol kin | 4e-81 | |
| cd07794 | 470 | cd07794, FGGY_GK_like_proteobact, Proteobacterial | 1e-77 | |
| pfam00370 | 245 | pfam00370, FGGY_N, FGGY family of carbohydrate kin | 9e-77 | |
| cd00366 | 435 | cd00366, FGGY, FGGY family of carbohydrate kinases | 5e-66 | |
| cd07793 | 504 | cd07793, FGGY_GK5_metazoa, metazoan glycerol kinas | 1e-58 | |
| COG1070 | 502 | COG1070, XylB, Sugar (pentulose and hexulose) kina | 1e-47 | |
| cd07804 | 492 | cd07804, FGGY_XK_like_1, uncharacterized xylulose | 3e-43 | |
| cd07808 | 482 | cd07808, FGGY_D-XK_EcXK-like, Escherichia coli xyl | 5e-35 | |
| cd07779 | 488 | cd07779, FGGY_ygcE_like, uncharacterized ygcE-like | 2e-32 | |
| cd07805 | 514 | cd07805, FGGY_XK_like_2, uncharacterized xylulose | 7e-32 | |
| cd07803 | 482 | cd07803, FGGY_D-XK, D-xylulose kinases; a subgroup | 2e-31 | |
| TIGR01312 | 481 | TIGR01312, XylB, D-xylulose kinase | 5e-30 | |
| cd07770 | 440 | cd07770, FGGY_GntK, Gluconate kinases; a subfamily | 4e-27 | |
| cd07802 | 447 | cd07802, FGGY_L-XK, L-xylulose kinases; a subfamil | 1e-25 | |
| cd07774 | 430 | cd07774, FGGY_1, uncharacterized subgroup; belongs | 4e-25 | |
| cd07809 | 487 | cd07809, FGGY_D-XK_1, D-xylulose kinases, subgroup | 4e-21 | |
| TIGR01314 | 505 | TIGR01314, gntK_FGGY, gluconate kinase, FGGY type | 1e-20 | |
| cd07811 | 493 | cd07811, FGGY_D-XK_3, D-xylulose kinases, subgroup | 8e-19 | |
| cd07775 | 452 | cd07775, FGGY_AI-2K, Autoinducer-2 kinases; a subf | 7e-18 | |
| cd07777 | 448 | cd07777, FGGY_SHK_like, sedoheptulokinase-like pro | 3e-13 | |
| cd07768 | 465 | cd07768, FGGY_RBK_like, Ribulokinase-like carbohyd | 5e-12 | |
| cd07810 | 490 | cd07810, FGGY_D-XK_2, D-xylulose kinases, subgroup | 7e-12 | |
| PRK10939 | 520 | PRK10939, PRK10939, autoinducer-2 (AI-2) kinase; P | 2e-11 | |
| cd07783 | 484 | cd07783, FGGY_CarbK-RPE_like, Carbohydrate kinase | 2e-11 | |
| COG1069 | 544 | COG1069, AraB, Ribulose kinase [Energy production | 8e-11 | |
| PRK15027 | 484 | PRK15027, PRK15027, xylulokinase; Provisional | 6e-09 | |
| cd07781 | 498 | cd07781, FGGY_RBK, Ribulokinases; belongs to the F | 1e-08 | |
| cd07771 | 440 | cd07771, FGGY_RhuK, L-rhamnulose kinases; a subfam | 9e-08 | |
| cd07798 | 437 | cd07798, FGGY_AI-2K_like, Autoinducer-2 kinase-lik | 1e-07 | |
| TIGR01315 | 541 | TIGR01315, 5C_CHO_kinase, FGGY-family pentulose ki | 2e-07 | |
| cd07782 | 536 | cd07782, FGGY_YpCarbK_like, Yersinia Pseudotubercu | 9e-07 | |
| TIGR02628 | 465 | TIGR02628, fuculo_kin_coli, L-fuculokinase | 2e-06 | |
| cd07773 | 448 | cd07773, FGGY_FK, L-fuculose kinases; a subfamily | 2e-05 | |
| PRK10331 | 470 | PRK10331, PRK10331, L-fuculokinase; Provisional | 2e-04 |
| >gnl|CDD|212664 cd07792, FGGY_GK1-3_metazoa, Metazoan glycerol kinase 1 and 3-like proteins; belongs to the FGGY family of carbohydrate kinases | Back alignment and domain information |
|---|
Score = 504 bits (1300), Expect = e-179
Identities = 188/286 (65%), Positives = 232/286 (81%), Gaps = 5/286 (1%)
Query: 10 PLVGAIDEGTSSCRFIVFSALTGKLVAKHQISLGQTFPTEGWVEQDPMEILAVVNGTIEA 69
PLVGAID+GTSS RF+VF+A T +L++ HQ+ + Q FP EGWVEQDP EIL V IE
Sbjct: 1 PLVGAIDQGTSSTRFLVFNAKTAELLSSHQVEIKQIFPKEGWVEQDPKEILNSVYECIE- 59
Query: 70 CQFSACVEKLKEQGIEPTDIVAVGVTNQRESTIAWDKITGEPLYNSIVWLDARTTSTLEK 129
C +KLKE I+ +DI A+G+TNQRE+T+ WDK TGEPLYN+IVWLD RT ST++K
Sbjct: 60 ---KTC-KKLKELNIDVSDIKAIGITNQRETTVVWDKYTGEPLYNAIVWLDIRTQSTVDK 115
Query: 130 ILEVVPNKNKNYLAPLCGLPLSPYFSALKINWLMNNVPKVKEAIDQNRCCIGTVDTWIIW 189
+L +P+KNKNYL +CGLP+S YFSA+K+ WL++NVP+V++A+++ RC GTVD+W+IW
Sbjct: 116 LLAKIPDKNKNYLKSICGLPISTYFSAVKLRWLLDNVPEVRKAVEEKRCLFGTVDSWLIW 175
Query: 190 NLTGGKDGGKYITDVSNASRTMLMNIETLEWDPMLCGFFTIPMDILPTICSSSEIYGHFV 249
NLTGG +GG +ITDV+NASRTMLMNIETLEWDP LC FF IPM+ILP I SSSEIYG+
Sbjct: 176 NLTGGPNGGVHITDVTNASRTMLMNIETLEWDPELCKFFGIPMEILPEIRSSSEIYGYIK 235
Query: 250 SGPLKGVPISGCLGDQHAALLGQNCLKPGLAKSTYGTGCFLLYNTG 295
GPL+G+PISG LGDQ AAL+GQ C K G AK+TYGTGCFLLYNTG
Sbjct: 236 EGPLEGIPISGILGDQQAALVGQMCFKKGQAKNTYGTGCFLLYNTG 281
|
This subgroup corresponds to a group of metazoan glycerol kinases (GKs), coded by X chromosome-linked GK genes, and glycerol kinase (GK)-like proteins, coded by autosomal testis-specific GK-like genes (GK-like genes, GK1 and GK3). Sequence comparison shows that metazoan GKs and GK-like proteins in this family are closely related to the bacterial GKs, which catalyze the Mg-ATP dependent phosphorylation of glycerol to yield glycerol 3-phosphate (G3P). The metazoan GKs do have GK enzymatic activity. However, the GK-like metazoan proteins do not exhibit GK activity and their biological functions are not yet clear. Some of them lack important functional residues involved in the binding of ADP and Mg2+, which may result in the loss of GK catalytic function. Others that have conserved catalytic residues have lost their GK activity as well; the reason remains unclear. It has been suggested the conserved catalytic residues might facilitate them performing a distinct function. GKs belong to the FGGY family of carbohydrate kinases, the monomers of which contain two large domains, which are separated by a deep cleft that forms the active site. This model includes both the N-terminal domain, which adopts a ribonuclease H-like fold, and the structurally related C-terminal domain. Length = 504 |
| >gnl|CDD|233353 TIGR01311, glycerol_kin, glycerol kinase | Back alignment and domain information |
|---|
| >gnl|CDD|198347 cd07769, FGGY_GK, Glycerol kinases; a subfamily of the FGGY family of carbohydrate kinases | Back alignment and domain information |
|---|
| >gnl|CDD|240348 PTZ00294, PTZ00294, glycerol kinase-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215166 PLN02295, PLN02295, glycerol kinase | Back alignment and domain information |
|---|
| >gnl|CDD|198367 cd07795, FGGY_ScGut1p_like, Saccharomyces cerevisiae Gut1p and related proteins; belongs to the FGGY family of carbohydrate kinases | Back alignment and domain information |
|---|
| >gnl|CDD|223628 COG0554, GlpK, Glycerol kinase [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|198361 cd07786, FGGY_EcGK_like, Escherichia coli glycerol kinase-like proteins; belongs to the FGGY family of carbohydrate kinases | Back alignment and domain information |
|---|
| >gnl|CDD|234594 PRK00047, glpK, glycerol kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|198362 cd07789, FGGY_CsGK_like, Cellulomonas sp | Back alignment and domain information |
|---|
| >gnl|CDD|198368 cd07796, FGGY_NHO1_plant, Arabidopsis NHO1 and related proteins; belongs to the FGGY family of carbohydrate kinases | Back alignment and domain information |
|---|
| >gnl|CDD|198378 cd10427, FGGY_GK_1, Uncharacterized subgroup; belongs to the glycerol kinases subfamily of the FGGY family of carbohydrate kinases | Back alignment and domain information |
|---|
| >gnl|CDD|198363 cd07791, FGGY_GK2_bacteria, bacterial glycerol kinase 2-like proteins; belongs to the FGGY family of carbohydrate kinases | Back alignment and domain information |
|---|
| >gnl|CDD|198366 cd07794, FGGY_GK_like_proteobact, Proteobacterial glycerol kinase-like proteins; belongs to the FGGY family of carbohydrate kinases | Back alignment and domain information |
|---|
| >gnl|CDD|215880 pfam00370, FGGY_N, FGGY family of carbohydrate kinases, N-terminal domain | Back alignment and domain information |
|---|
| >gnl|CDD|212658 cd00366, FGGY, FGGY family of carbohydrate kinases | Back alignment and domain information |
|---|
| >gnl|CDD|212665 cd07793, FGGY_GK5_metazoa, metazoan glycerol kinase 5-like proteins; belongs to the FGGY family of carbohydrate kinases | Back alignment and domain information |
|---|
| >gnl|CDD|223996 COG1070, XylB, Sugar (pentulose and hexulose) kinases [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|198372 cd07804, FGGY_XK_like_1, uncharacterized xylulose kinase-like proteins; a subgroup of the FGGY family of carbohydrate kinases | Back alignment and domain information |
|---|
| >gnl|CDD|198374 cd07808, FGGY_D-XK_EcXK-like, Escherichia coli xylulokinase-like D-xylulose kinases; a subgroup of the FGGY family of carbohydrate kinases | Back alignment and domain information |
|---|
| >gnl|CDD|212662 cd07779, FGGY_ygcE_like, uncharacterized ygcE-like proteins | Back alignment and domain information |
|---|
| >gnl|CDD|198373 cd07805, FGGY_XK_like_2, uncharacterized xylulose kinase-like proteins; a subgroup of the FGGY family of carbohydrate kinases | Back alignment and domain information |
|---|
| >gnl|CDD|198371 cd07803, FGGY_D-XK, D-xylulose kinases; a subgroup of the FGGY family of carbohydrate kinases | Back alignment and domain information |
|---|
| >gnl|CDD|233354 TIGR01312, XylB, D-xylulose kinase | Back alignment and domain information |
|---|
| >gnl|CDD|212659 cd07770, FGGY_GntK, Gluconate kinases; a subfamily of the FGGY family of carbohydrate kinases | Back alignment and domain information |
|---|
| >gnl|CDD|212666 cd07802, FGGY_L-XK, L-xylulose kinases; a subfamily of the FGGY family of carbohydrate kinases | Back alignment and domain information |
|---|
| >gnl|CDD|198352 cd07774, FGGY_1, uncharacterized subgroup; belongs to the FGGY family of carbohydrate kinases | Back alignment and domain information |
|---|
| >gnl|CDD|198375 cd07809, FGGY_D-XK_1, D-xylulose kinases, subgroup 1; members of the FGGY family of carbohydrate kinases | Back alignment and domain information |
|---|
| >gnl|CDD|130381 TIGR01314, gntK_FGGY, gluconate kinase, FGGY type | Back alignment and domain information |
|---|
| >gnl|CDD|198377 cd07811, FGGY_D-XK_3, D-xylulose kinases, subgroup 3; members of the FGGY family of carbohydrate kinases | Back alignment and domain information |
|---|
| >gnl|CDD|198353 cd07775, FGGY_AI-2K, Autoinducer-2 kinases; a subfamily of the FGGY family of carbohydrate kinases | Back alignment and domain information |
|---|
| >gnl|CDD|212661 cd07777, FGGY_SHK_like, sedoheptulokinase-like proteins; a subfamily of the FGGY family of carbohydrate kinases | Back alignment and domain information |
|---|
| >gnl|CDD|198346 cd07768, FGGY_RBK_like, Ribulokinase-like carbohydrate kinases; a subfamily of the FGGY family of carbohydrate kinases | Back alignment and domain information |
|---|
| >gnl|CDD|198376 cd07810, FGGY_D-XK_2, D-xylulose kinases, subgroup 2; members of the FGGY family of carbohydrate kinases | Back alignment and domain information |
|---|
| >gnl|CDD|182853 PRK10939, PRK10939, autoinducer-2 (AI-2) kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|198360 cd07783, FGGY_CarbK-RPE_like, Carbohydrate kinase and ribulose-phosphate 3-epimerase fusion proteins-like; belongs to the FGGY family of carbohydrate kinases | Back alignment and domain information |
|---|
| >gnl|CDD|223995 COG1069, AraB, Ribulose kinase [Energy production and conversion] | Back alignment and domain information |
|---|
| >gnl|CDD|184987 PRK15027, PRK15027, xylulokinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|198358 cd07781, FGGY_RBK, Ribulokinases; belongs to the FGGY family of carbohydrate kinases | Back alignment and domain information |
|---|
| >gnl|CDD|198349 cd07771, FGGY_RhuK, L-rhamnulose kinases; a subfamily of the FGGY family of carbohydrate kinases | Back alignment and domain information |
|---|
| >gnl|CDD|198369 cd07798, FGGY_AI-2K_like, Autoinducer-2 kinase-like proteins; belongs to the FGGY family of carbohydrate kinases | Back alignment and domain information |
|---|
| >gnl|CDD|233356 TIGR01315, 5C_CHO_kinase, FGGY-family pentulose kinase | Back alignment and domain information |
|---|
| >gnl|CDD|212663 cd07782, FGGY_YpCarbK_like, Yersinia Pseudotuberculosis carbohydrate kinase-like subgroup; belongs to the FGGY family of carbohydrate kinases | Back alignment and domain information |
|---|
| >gnl|CDD|131676 TIGR02628, fuculo_kin_coli, L-fuculokinase | Back alignment and domain information |
|---|
| >gnl|CDD|198351 cd07773, FGGY_FK, L-fuculose kinases; a subfamily of the FGGY family of carbohydrate kinases | Back alignment and domain information |
|---|
| >gnl|CDD|182383 PRK10331, PRK10331, L-fuculokinase; Provisional | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 297 | |||
| COG0554 | 499 | GlpK Glycerol kinase [Energy production and conver | 100.0 | |
| PTZ00294 | 504 | glycerol kinase-like protein; Provisional | 100.0 | |
| PRK00047 | 498 | glpK glycerol kinase; Provisional | 100.0 | |
| PLN02295 | 512 | glycerol kinase | 100.0 | |
| PRK10331 | 470 | L-fuculokinase; Provisional | 100.0 | |
| TIGR01314 | 505 | gntK_FGGY gluconate kinase, FGGY type. Gluconate i | 100.0 | |
| COG1070 | 502 | XylB Sugar (pentulose and hexulose) kinases [Carbo | 100.0 | |
| PF00370 | 245 | FGGY_N: FGGY family of carbohydrate kinases, N-ter | 100.0 | |
| TIGR02628 | 465 | fuculo_kin_coli L-fuculokinase. Members of this fa | 100.0 | |
| TIGR01311 | 493 | glycerol_kin glycerol kinase. This model describes | 100.0 | |
| PRK10939 | 520 | autoinducer-2 (AI-2) kinase; Provisional | 100.0 | |
| PRK15027 | 484 | xylulokinase; Provisional | 100.0 | |
| TIGR01312 | 481 | XylB D-xylulose kinase. D-xylulose kinase (XylB) g | 100.0 | |
| PLN02669 | 556 | xylulokinase | 100.0 | |
| TIGR02627 | 454 | rhamnulo_kin rhamnulokinase. This model describes | 100.0 | |
| PRK04123 | 548 | ribulokinase; Provisional | 100.0 | |
| TIGR01234 | 536 | L-ribulokinase L-ribulokinase. This enzyme catalyz | 100.0 | |
| TIGR01315 | 541 | 5C_CHO_kinase FGGY-family pentulose kinase. This m | 100.0 | |
| PRK10640 | 471 | rhaB rhamnulokinase; Provisional | 100.0 | |
| KOG2517|consensus | 516 | 100.0 | ||
| COG1069 | 544 | AraB Ribulose kinase [Energy production and conver | 100.0 | |
| KOG2531|consensus | 545 | 99.96 | ||
| TIGR00241 | 248 | CoA_E_activ CoA-substrate-specific enzyme activase | 98.6 | |
| PRK09698 | 302 | D-allose kinase; Provisional | 98.42 | |
| TIGR00744 | 318 | ROK_glcA_fam ROK family protein (putative glucokin | 98.32 | |
| PRK13311 | 256 | N-acetyl-D-glucosamine kinase; Provisional | 98.26 | |
| PF00480 | 179 | ROK: ROK family; InterPro: IPR000600 A family of b | 98.24 | |
| COG1940 | 314 | NagC Transcriptional regulator/sugar kinase [Trans | 98.19 | |
| PRK09557 | 301 | fructokinase; Reviewed | 98.14 | |
| PRK13310 | 303 | N-acetyl-D-glucosamine kinase; Provisional | 98.13 | |
| smart00732 | 99 | YqgFc Likely ribonuclease with RNase H fold. YqgF | 97.77 | |
| PRK05082 | 291 | N-acetylmannosamine kinase; Provisional | 97.76 | |
| PRK00292 | 316 | glk glucokinase; Provisional | 97.61 | |
| TIGR03192 | 293 | benz_CoA_bzdQ benzoyl-CoA reductase, bzd-type, Q s | 97.51 | |
| PRK12408 | 336 | glucokinase; Provisional | 97.46 | |
| TIGR03286 | 404 | methan_mark_15 putative methanogenesis marker prot | 97.43 | |
| PF14574 | 412 | DUF4445: Domain of unknown function (DUF4445); PDB | 97.42 | |
| TIGR02261 | 262 | benz_CoA_red_D benzoyl-CoA reductase, bcr type, su | 97.34 | |
| PF01869 | 271 | BcrAD_BadFG: BadF/BadG/BcrA/BcrD ATPase family; In | 97.27 | |
| PRK13321 | 256 | pantothenate kinase; Reviewed | 97.23 | |
| COG2971 | 301 | Predicted N-acetylglucosamine kinase [Carbohydrate | 97.2 | |
| PRK13318 | 258 | pantothenate kinase; Reviewed | 97.14 | |
| PRK14101 | 638 | bifunctional glucokinase/RpiR family transcription | 97.01 | |
| COG1924 | 396 | Activator of 2-hydroxyglutaryl-CoA dehydratase (HS | 96.93 | |
| PF05378 | 176 | Hydant_A_N: Hydantoinase/oxoprolinase N-terminal r | 96.84 | |
| PF00349 | 206 | Hexokinase_1: Hexokinase; InterPro: IPR022672 Hexo | 96.34 | |
| TIGR02259 | 432 | benz_CoA_red_A benzoyl-CoA reductase, bcr type, su | 96.23 | |
| smart00842 | 187 | FtsA Cell division protein FtsA. FtsA is essential | 95.63 | |
| PTZ00288 | 405 | glucokinase 1; Provisional | 95.58 | |
| KOG1794|consensus | 336 | 95.47 | ||
| TIGR02707 | 351 | butyr_kinase butyrate kinase. This model represent | 95.35 | |
| PRK09472 | 420 | ftsA cell division protein FtsA; Reviewed | 95.1 | |
| TIGR00749 | 316 | glk glucokinase, proteobacterial type. This model | 94.98 | |
| PRK15080 | 267 | ethanolamine utilization protein EutJ; Provisional | 94.48 | |
| TIGR01174 | 371 | ftsA cell division protein FtsA. This bacterial ce | 94.4 | |
| PF13941 | 457 | MutL: MutL protein | 94.25 | |
| PRK13324 | 258 | pantothenate kinase; Reviewed | 93.82 | |
| COG4972 | 354 | PilM Tfp pilus assembly protein, ATPase PilM [Cell | 93.2 | |
| PLN02596 | 490 | hexokinase-like | 92.91 | |
| PLN02914 | 490 | hexokinase | 92.75 | |
| TIGR01175 | 348 | pilM type IV pilus assembly protein PilM. This pro | 92.57 | |
| PLN02362 | 509 | hexokinase | 92.56 | |
| PLN02405 | 497 | hexokinase | 92.31 | |
| PRK13317 | 277 | pantothenate kinase; Provisional | 92.12 | |
| PRK11031 | 496 | guanosine pentaphosphate phosphohydrolase; Provisi | 92.09 | |
| TIGR03123 | 318 | one_C_unchar_1 probable H4MPT-linked C1 transfer p | 92.0 | |
| PRK10854 | 513 | exopolyphosphatase; Provisional | 91.87 | |
| PRK13320 | 244 | pantothenate kinase; Reviewed | 91.83 | |
| COG0849 | 418 | ftsA Cell division ATPase FtsA [Cell division and | 91.62 | |
| PRK03011 | 358 | butyrate kinase; Provisional | 91.4 | |
| PTZ00107 | 464 | hexokinase; Provisional | 90.53 | |
| TIGR00555 | 279 | panK_eukar pantothenate kinase, eukaryotic/staphyl | 90.51 | |
| PRK13331 | 251 | pantothenate kinase; Reviewed | 90.38 | |
| TIGR02529 | 239 | EutJ ethanolamine utilization protein EutJ family | 90.37 | |
| TIGR03706 | 300 | exo_poly_only exopolyphosphatase. It appears that | 90.27 | |
| PF11104 | 340 | PilM_2: Type IV pilus assembly protein PilM;; PDB: | 89.9 | |
| TIGR00671 | 243 | baf pantothenate kinase, type III. This model desc | 88.53 | |
| PF02685 | 316 | Glucokinase: Glucokinase; InterPro: IPR003836 Gluc | 87.76 | |
| PRK13326 | 262 | pantothenate kinase; Reviewed | 86.91 | |
| PTZ00340 | 345 | O-sialoglycoprotein endopeptidase-like protein; Pr | 86.9 | |
| PF14450 | 120 | FtsA: Cell division protein FtsA; PDB: 1E4F_T 4A2B | 86.4 | |
| PF00871 | 388 | Acetate_kinase: Acetokinase family; InterPro: IPR0 | 85.89 | |
| COG3894 | 614 | Uncharacterized metal-binding protein [General fun | 85.12 | |
| PRK12440 | 397 | acetate kinase; Reviewed | 85.09 | |
| COG4820 | 277 | EutJ Ethanolamine utilization protein, possible ch | 84.63 | |
| COG5026 | 466 | Hexokinase [Carbohydrate transport and metabolism] | 84.23 | |
| PRK09604 | 332 | UGMP family protein; Validated | 84.12 | |
| TIGR01319 | 463 | glmL_fam conserved hypothetical protein. This smal | 83.69 | |
| COG0145 | 674 | HyuA N-methylhydantoinase A/acetone carboxylase, b | 83.51 | |
| COG0837 | 320 | Glk Glucokinase [Carbohydrate transport and metabo | 83.02 | |
| COG3734 | 306 | DgoK 2-keto-3-deoxy-galactonokinase [Carbohydrate | 82.49 | |
| COG1521 | 251 | Pantothenate kinase type III (Bvg accessory factor | 81.72 | |
| PRK09605 | 535 | bifunctional UGMP family protein/serine/threonine | 81.69 | |
| PLN02666 | 1275 | 5-oxoprolinase | 81.2 | |
| COG1214 | 220 | Inactive homolog of metal-dependent proteases, put | 80.58 |
| >COG0554 GlpK Glycerol kinase [Energy production and conversion] | Back alignment and domain information |
|---|
Probab=100.00 E-value=1.6e-57 Score=422.67 Aligned_cols=273 Identities=50% Similarity=0.881 Sum_probs=257.9
Q ss_pred CCEEEEEecCCCcceEEEEeCCCCeEEEEEEeeeccccCCCCeeEeCHHHHHHHHHHHHHhhhhHHHHHHHHHcCCCCCC
Q psy9351 9 GPLVGAIDEGTSSCRFIVFSALTGKLVAKHQISLGQTFPTEGWVEQDPMEILAVVNGTIEACQFSACVEKLKEQGIEPTD 88 (297)
Q Consensus 9 ~~~~lgIDiGtt~ik~~l~d~~~g~v~~~~~~~~~~~~~~~g~~e~d~~~~~~~i~~~i~~~~~~~~~~~l~~~~~~~~~ 88 (297)
++|+++||.||||+|+++||. +|++++..+.+++.+||++||+||||.++|..+..+++ + + +.++++++.+
T Consensus 4 ~~yIlAiDqGTTssRaivfd~-~g~iva~~q~e~~Q~yP~~GWVEhDp~eIw~~~~~~l~----~-a---~~~~~i~~~~ 74 (499)
T COG0554 4 DKYILAIDQGTTSSRAIVFDE-DGNIVAIAQREFTQIYPQPGWVEHDPLEIWASVRSVLK----E-A---LAKAGIKPGE 74 (499)
T ss_pred ccEEEEEecCCcceeEEEECC-CCCchhhhhhhhhhhCCCCCccccCHHHHHHHHHHHHH----H-H---HHHcCCCccc
Confidence 579999999999999999996 99999999999999999999999999999999999999 6 6 5668999999
Q ss_pred eeEEEEcCccceEEEEeCCCCccccccccccccCCHHHHHHHHHhCCCChhhhHHhhhCCCCCCcchHHHHHHHHHhChh
Q psy9351 89 IVAVGVTNQRESTIAWDKITGEPLYNSIVWLDARTTSTLEKILEVVPNKNKNYLAPLCGLPLSPYFSALKINWLMNNVPK 168 (297)
Q Consensus 89 I~~Igis~~~~~~v~vd~~~g~~~~~~i~w~D~R~~~~~~~l~~~~~~~~~~~~~~~tG~~~~~~~~~~kl~wl~~~~p~ 168 (297)
|.+|||+.|+++.|+||+++|+|++|+|.|+|.|+.+.|++|++. +. .+.+.++||.++.|+|+..|+.|+.+|.|.
T Consensus 75 iaaIGITNQRETtvvWdk~tG~Pi~naIvWQdrRTa~~c~~L~~~-g~--~~~i~~kTGL~~dpYFSatKi~WiLdnv~g 151 (499)
T COG0554 75 IAAIGITNQRETTVVWDKETGKPIYNAIVWQDRRTADICEELKAD-GY--EERIREKTGLVLDPYFSATKIKWILDNVPG 151 (499)
T ss_pred eEEEEeeccceeEEEEeCCCCCCcccceeeeccchHHHHHHHHhc-ch--hhhhhhhcCCccCCCccchhhhHHHhhChh
Confidence 999999999999999999999999999999999999999999987 22 468999999999999999999999999999
Q ss_pred hHhhhhcCceeeeChhHHHHHHHcCCCCCCceEeeccccccccCccCCCCCCcHHHhcccCCCCCCCCCcccCCcceeec
Q psy9351 169 VKEAIDQNRCCIGTVDTWIIWNLTGGKDGGKYITDVSNASRTMLMNIETLEWDPMLCGFFTIPMDILPTICSSSEIYGHF 248 (297)
Q Consensus 169 ~~~~~~~~~~~~~~~~dyi~~~LtG~~~~~~~~~d~s~a~~tgl~d~~~~~w~~~~l~~~gi~~~~LP~l~~~g~~~G~i 248 (297)
..++.+.+...|.++..||.|+|||. +.+++|+||||+|+|||+.+.+||+++|+.||||+++||++.++.++.|.+
T Consensus 152 ~r~~ae~Gel~fGTiDtWLiw~LTgg---~~h~TD~sNASRT~L~ni~~l~WD~elL~il~Ip~~~LPev~~ss~~~G~t 228 (499)
T COG0554 152 ARERAEKGELLFGTIDTWLIWKLTGG---KVHVTDYSNASRTMLFNIHSLEWDDELLELLGIPRSMLPEVRPSSEIYGVT 228 (499)
T ss_pred hhhHhhcCCeEEecchhhheeeccCC---ceeccccchhHHHhcccccccCCCHHHHHHhCCChHhCccccccccccccc
Confidence 99999999999999999999999995 449999999999999999999999999999999999999999999999998
Q ss_pred ccC-CCCCCcEEEecchHHHHHHhcCCCCCCcEEEEecccccccccccC
Q psy9351 249 VSG-PLKGVPISGCLGDQHAALLGQNCLKPGLAKSTYGTGCFLLYNTGN 296 (297)
Q Consensus 249 ~~G-l~~g~pV~~g~~D~~aa~~g~g~~~~g~~~~~~GTs~~v~~~t~~ 296 (297)
..+ +...+||..-.||+|||+||.||++||++..+.||.+++.++||.
T Consensus 229 ~~~~~g~~vPI~g~~GDQQAALfGq~c~~pG~~K~TYGTG~F~l~ntG~ 277 (499)
T COG0554 229 GIGFLGAEVPITGVAGDQQAALFGQGCFEPGMAKNTYGTGCFLLMNTGE 277 (499)
T ss_pred cccccCCceeeccccchhHHHHhhcccCCcCccccccccceeeeeccCC
Confidence 654 446799999999999999999999999999999999999999985
|
|
| >PTZ00294 glycerol kinase-like protein; Provisional | Back alignment and domain information |
|---|
| >PRK00047 glpK glycerol kinase; Provisional | Back alignment and domain information |
|---|
| >PLN02295 glycerol kinase | Back alignment and domain information |
|---|
| >PRK10331 L-fuculokinase; Provisional | Back alignment and domain information |
|---|
| >TIGR01314 gntK_FGGY gluconate kinase, FGGY type | Back alignment and domain information |
|---|
| >COG1070 XylB Sugar (pentulose and hexulose) kinases [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PF00370 FGGY_N: FGGY family of carbohydrate kinases, N-terminal domain; InterPro: IPR018484 It has been shown [] that four different type of carbohydrate kinases seem to be evolutionary related | Back alignment and domain information |
|---|
| >TIGR02628 fuculo_kin_coli L-fuculokinase | Back alignment and domain information |
|---|
| >TIGR01311 glycerol_kin glycerol kinase | Back alignment and domain information |
|---|
| >PRK10939 autoinducer-2 (AI-2) kinase; Provisional | Back alignment and domain information |
|---|
| >PRK15027 xylulokinase; Provisional | Back alignment and domain information |
|---|
| >TIGR01312 XylB D-xylulose kinase | Back alignment and domain information |
|---|
| >PLN02669 xylulokinase | Back alignment and domain information |
|---|
| >TIGR02627 rhamnulo_kin rhamnulokinase | Back alignment and domain information |
|---|
| >PRK04123 ribulokinase; Provisional | Back alignment and domain information |
|---|
| >TIGR01234 L-ribulokinase L-ribulokinase | Back alignment and domain information |
|---|
| >TIGR01315 5C_CHO_kinase FGGY-family pentulose kinase | Back alignment and domain information |
|---|
| >PRK10640 rhaB rhamnulokinase; Provisional | Back alignment and domain information |
|---|
| >KOG2517|consensus | Back alignment and domain information |
|---|
| >COG1069 AraB Ribulose kinase [Energy production and conversion] | Back alignment and domain information |
|---|
| >KOG2531|consensus | Back alignment and domain information |
|---|
| >TIGR00241 CoA_E_activ CoA-substrate-specific enzyme activase, putative | Back alignment and domain information |
|---|
| >PRK09698 D-allose kinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00744 ROK_glcA_fam ROK family protein (putative glucokinase) | Back alignment and domain information |
|---|
| >PRK13311 N-acetyl-D-glucosamine kinase; Provisional | Back alignment and domain information |
|---|
| >PF00480 ROK: ROK family; InterPro: IPR000600 A family of bacterial proteins has been described which groups transcriptional repressors, sugar kinases and yet uncharacterised open reading frames [] | Back alignment and domain information |
|---|
| >COG1940 NagC Transcriptional regulator/sugar kinase [Transcription / Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09557 fructokinase; Reviewed | Back alignment and domain information |
|---|
| >PRK13310 N-acetyl-D-glucosamine kinase; Provisional | Back alignment and domain information |
|---|
| >smart00732 YqgFc Likely ribonuclease with RNase H fold | Back alignment and domain information |
|---|
| >PRK05082 N-acetylmannosamine kinase; Provisional | Back alignment and domain information |
|---|
| >PRK00292 glk glucokinase; Provisional | Back alignment and domain information |
|---|
| >TIGR03192 benz_CoA_bzdQ benzoyl-CoA reductase, bzd-type, Q subunit | Back alignment and domain information |
|---|
| >PRK12408 glucokinase; Provisional | Back alignment and domain information |
|---|
| >TIGR03286 methan_mark_15 putative methanogenesis marker protein 15 | Back alignment and domain information |
|---|
| >PF14574 DUF4445: Domain of unknown function (DUF4445); PDB: 3ZYY_X | Back alignment and domain information |
|---|
| >TIGR02261 benz_CoA_red_D benzoyl-CoA reductase, bcr type, subunit D | Back alignment and domain information |
|---|
| >PF01869 BcrAD_BadFG: BadF/BadG/BcrA/BcrD ATPase family; InterPro: IPR002731 This domain is found in the BadF (O07462 from SWISSPROT) and BadG (O07463 from SWISSPROT) proteins that are two subunits of Benzoyl-CoA reductase, that may be involved in ATP hydrolysis | Back alignment and domain information |
|---|
| >PRK13321 pantothenate kinase; Reviewed | Back alignment and domain information |
|---|
| >COG2971 Predicted N-acetylglucosamine kinase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK13318 pantothenate kinase; Reviewed | Back alignment and domain information |
|---|
| >PRK14101 bifunctional glucokinase/RpiR family transcriptional regulator; Provisional | Back alignment and domain information |
|---|
| >COG1924 Activator of 2-hydroxyglutaryl-CoA dehydratase (HSP70-class ATPase domain) [Lipid metabolism] | Back alignment and domain information |
|---|
| >PF05378 Hydant_A_N: Hydantoinase/oxoprolinase N-terminal region; InterPro: IPR008040 This domain is found at the N terminus of the hydantoinase/oxoprolinase IPR002821 from INTERPRO family | Back alignment and domain information |
|---|
| >PF00349 Hexokinase_1: Hexokinase; InterPro: IPR022672 Hexokinase is an important enzyme that catalyses the ATP-dependent conversion of aldo- and keto-hexose sugars to the hexose-6-phosphate (H6P) | Back alignment and domain information |
|---|
| >TIGR02259 benz_CoA_red_A benzoyl-CoA reductase, bcr type, subunit A | Back alignment and domain information |
|---|
| >smart00842 FtsA Cell division protein FtsA | Back alignment and domain information |
|---|
| >PTZ00288 glucokinase 1; Provisional | Back alignment and domain information |
|---|
| >KOG1794|consensus | Back alignment and domain information |
|---|
| >TIGR02707 butyr_kinase butyrate kinase | Back alignment and domain information |
|---|
| >PRK09472 ftsA cell division protein FtsA; Reviewed | Back alignment and domain information |
|---|
| >TIGR00749 glk glucokinase, proteobacterial type | Back alignment and domain information |
|---|
| >PRK15080 ethanolamine utilization protein EutJ; Provisional | Back alignment and domain information |
|---|
| >TIGR01174 ftsA cell division protein FtsA | Back alignment and domain information |
|---|
| >PF13941 MutL: MutL protein | Back alignment and domain information |
|---|
| >PRK13324 pantothenate kinase; Reviewed | Back alignment and domain information |
|---|
| >COG4972 PilM Tfp pilus assembly protein, ATPase PilM [Cell motility and secretion / Intracellular trafficking and secretion] | Back alignment and domain information |
|---|
| >PLN02596 hexokinase-like | Back alignment and domain information |
|---|
| >PLN02914 hexokinase | Back alignment and domain information |
|---|
| >TIGR01175 pilM type IV pilus assembly protein PilM | Back alignment and domain information |
|---|
| >PLN02362 hexokinase | Back alignment and domain information |
|---|
| >PLN02405 hexokinase | Back alignment and domain information |
|---|
| >PRK13317 pantothenate kinase; Provisional | Back alignment and domain information |
|---|
| >PRK11031 guanosine pentaphosphate phosphohydrolase; Provisional | Back alignment and domain information |
|---|
| >TIGR03123 one_C_unchar_1 probable H4MPT-linked C1 transfer pathway protein | Back alignment and domain information |
|---|
| >PRK10854 exopolyphosphatase; Provisional | Back alignment and domain information |
|---|
| >PRK13320 pantothenate kinase; Reviewed | Back alignment and domain information |
|---|
| >COG0849 ftsA Cell division ATPase FtsA [Cell division and chromosome partitioning] | Back alignment and domain information |
|---|
| >PRK03011 butyrate kinase; Provisional | Back alignment and domain information |
|---|
| >PTZ00107 hexokinase; Provisional | Back alignment and domain information |
|---|
| >TIGR00555 panK_eukar pantothenate kinase, eukaryotic/staphyloccocal type | Back alignment and domain information |
|---|
| >PRK13331 pantothenate kinase; Reviewed | Back alignment and domain information |
|---|
| >TIGR02529 EutJ ethanolamine utilization protein EutJ family protein | Back alignment and domain information |
|---|
| >TIGR03706 exo_poly_only exopolyphosphatase | Back alignment and domain information |
|---|
| >PF11104 PilM_2: Type IV pilus assembly protein PilM;; PDB: 2YCH_A | Back alignment and domain information |
|---|
| >TIGR00671 baf pantothenate kinase, type III | Back alignment and domain information |
|---|
| >PF02685 Glucokinase: Glucokinase; InterPro: IPR003836 Glucokinases 2 | Back alignment and domain information |
|---|
| >PRK13326 pantothenate kinase; Reviewed | Back alignment and domain information |
|---|
| >PTZ00340 O-sialoglycoprotein endopeptidase-like protein; Provisional | Back alignment and domain information |
|---|
| >PF14450 FtsA: Cell division protein FtsA; PDB: 1E4F_T 4A2B_A 4A2A_A 1E4G_T | Back alignment and domain information |
|---|
| >PF00871 Acetate_kinase: Acetokinase family; InterPro: IPR000890 Acetate kinase, which is predominantly found in micro-organisms, facilitates the production of acetyl-CoA by phosphorylating acetate in the presence of ATP and a divalent cation [, ] | Back alignment and domain information |
|---|
| >COG3894 Uncharacterized metal-binding protein [General function prediction only] | Back alignment and domain information |
|---|
| >PRK12440 acetate kinase; Reviewed | Back alignment and domain information |
|---|
| >COG4820 EutJ Ethanolamine utilization protein, possible chaperonin [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >COG5026 Hexokinase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >PRK09604 UGMP family protein; Validated | Back alignment and domain information |
|---|
| >TIGR01319 glmL_fam conserved hypothetical protein | Back alignment and domain information |
|---|
| >COG0145 HyuA N-methylhydantoinase A/acetone carboxylase, beta subunit [Amino acid transport and metabolism / Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >COG0837 Glk Glucokinase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG3734 DgoK 2-keto-3-deoxy-galactonokinase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >COG1521 Pantothenate kinase type III (Bvg accessory factor family protein) [Transcription] | Back alignment and domain information |
|---|
| >PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated | Back alignment and domain information |
|---|
| >PLN02666 5-oxoprolinase | Back alignment and domain information |
|---|
| >COG1214 Inactive homolog of metal-dependent proteases, putative molecular chaperone [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 297 | ||||
| 2d4w_A | 504 | Crystal Structure Of Glycerol Kinase From Cellulomo | 3e-67 | ||
| 1gla_G | 501 | Structure Of The Regulatory Complex Of Escherichia | 9e-64 | ||
| 1bu6_O | 501 | Crystal Structures Of Escherichia Coli Glycerol Kin | 1e-63 | ||
| 1bwf_Y | 501 | Escherichia Coli Glycerol Kinase Mutant With Bound | 4e-63 | ||
| 3ezw_A | 526 | Crystal Structure Of A Hyperactive Escherichia Coli | 5e-63 | ||
| 3h45_X | 506 | Glycerol Kinase H232e With Ethylene Glycol Length = | 5e-62 | ||
| 3flc_O | 518 | Crystal Structure Of The His-Tagged H232r Mutant Of | 5e-62 | ||
| 3d7e_O | 505 | Enterococcus Casseliflavus Glycerol Kinase Mutant H | 6e-62 | ||
| 3h3n_X | 506 | Glycerol Kinase H232r With Glycerol Length = 506 | 6e-62 | ||
| 1r59_O | 505 | Enterococcus Casseliflavus Glycerol Kinase Length = | 8e-62 | ||
| 1xup_O | 487 | Enterococcus Casseliflavus Glycerol Kinase Complexe | 1e-61 | ||
| 2dpn_A | 495 | Crystal Structure Of The Glycerol Kinase From Therm | 1e-60 | ||
| 4e1j_A | 520 | Crystal Structure Of Glycerol Kinase In Complex Wit | 2e-58 | ||
| 2zf5_O | 497 | Crystal Structure Of Highly Thermostable Glycerol K | 3e-58 | ||
| 3g25_A | 501 | 1.9 Angstrom Crystal Structure Of Glycerol Kinase ( | 5e-58 | ||
| 2w40_A | 503 | Crystal Structure Of Plasmodium Falciparum Glycerol | 3e-51 | ||
| 2w41_A | 507 | Crystal Structure Of Plasmodium Falciparum Glycerol | 3e-51 | ||
| 3gbt_A | 504 | Crystal Structure Of Gluconate Kinase From Lactobac | 4e-09 | ||
| 2itm_A | 484 | Crystal Structure Of The E. Coli Xylulose Kinase Co | 4e-09 | ||
| 3hz6_A | 511 | Crystal Structure Of Xylulokinase From Chromobacter | 6e-05 |
| >pdb|2D4W|A Chain A, Crystal Structure Of Glycerol Kinase From Cellulomonas Sp. Nt3060 Length = 504 | Back alignment and structure |
|
| >pdb|1GLA|G Chain G, Structure Of The Regulatory Complex Of Escherichia Coli Iiiglc With Glycerol Kinase Length = 501 | Back alignment and structure |
| >pdb|1BU6|O Chain O, Crystal Structures Of Escherichia Coli Glycerol Kinase And The Mutant A65t In An Inactive Tetramer: Conformational Changes And Implications For Allosteric Regulation Length = 501 | Back alignment and structure |
| >pdb|1BWF|Y Chain Y, Escherichia Coli Glycerol Kinase Mutant With Bound Atp Analog Showing Substantial Domain Motion Length = 501 | Back alignment and structure |
| >pdb|3EZW|A Chain A, Crystal Structure Of A Hyperactive Escherichia Coli Glycerol Kinase Mutant Gly230 --> Asp Obtained Using Microfluidic Crystallization Devices Length = 526 | Back alignment and structure |
| >pdb|3H45|X Chain X, Glycerol Kinase H232e With Ethylene Glycol Length = 506 | Back alignment and structure |
| >pdb|3FLC|O Chain O, Crystal Structure Of The His-Tagged H232r Mutant Of Glycerol Kinase From Enterococcus Casseliflavus With Glycerol Length = 518 | Back alignment and structure |
| >pdb|3D7E|O Chain O, Enterococcus Casseliflavus Glycerol Kinase Mutant His232ala Complexed With Glycerol Length = 505 | Back alignment and structure |
| >pdb|3H3N|X Chain X, Glycerol Kinase H232r With Glycerol Length = 506 | Back alignment and structure |
| >pdb|1R59|O Chain O, Enterococcus Casseliflavus Glycerol Kinase Length = 505 | Back alignment and structure |
| >pdb|1XUP|O Chain O, Enterococcus Casseliflavus Glycerol Kinase Complexed With Glycerol Length = 487 | Back alignment and structure |
| >pdb|2DPN|A Chain A, Crystal Structure Of The Glycerol Kinase From Thermus Thermophilus Hb8 Length = 495 | Back alignment and structure |
| >pdb|4E1J|A Chain A, Crystal Structure Of Glycerol Kinase In Complex With Glycerol From Sinorhizobium Meliloti 1021 Length = 520 | Back alignment and structure |
| >pdb|2ZF5|O Chain O, Crystal Structure Of Highly Thermostable Glycerol Kinase From A Hyperthermophilic Archaeon Length = 497 | Back alignment and structure |
| >pdb|3G25|A Chain A, 1.9 Angstrom Crystal Structure Of Glycerol Kinase (Glpk) From Staphylococcus Aureus In Complex With Glycerol. Length = 501 | Back alignment and structure |
| >pdb|2W40|A Chain A, Crystal Structure Of Plasmodium Falciparum Glycerol Kinase With Bound Glycerol Length = 503 | Back alignment and structure |
| >pdb|2W41|A Chain A, Crystal Structure Of Plasmodium Falciparum Glycerol Kinase With Adp Length = 507 | Back alignment and structure |
| >pdb|3GBT|A Chain A, Crystal Structure Of Gluconate Kinase From Lactobacillus Acidophilus Length = 504 | Back alignment and structure |
| >pdb|2ITM|A Chain A, Crystal Structure Of The E. Coli Xylulose Kinase Complexed With Xylulose Length = 484 | Back alignment and structure |
| >pdb|3HZ6|A Chain A, Crystal Structure Of Xylulokinase From Chromobacterium Violaceum Length = 511 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 297 | |||
| 2w40_A | 503 | Glycerol kinase, putative; closed conformation, ma | 1e-138 | |
| 2d4w_A | 504 | Glycerol kinase; alpha and beta protein, ribonucle | 1e-136 | |
| 2p3r_A | 510 | Glycerol kinase; glycerol metabolism, allosteric r | 1e-128 | |
| 2dpn_A | 495 | Glycerol kinase; thermus thermophilus HB8, structu | 1e-128 | |
| 3h3n_X | 506 | Glycerol kinase; ATP-binding, glycerol metabolism, | 1e-128 | |
| 3g25_A | 501 | Glycerol kinase; IDP00743, ATP-binding, glycerol m | 1e-128 | |
| 4e1j_A | 520 | Glycerol kinase; structural genomics, PSI-biology, | 1e-128 | |
| 2zf5_O | 497 | Glycerol kinase; hyperthermophilic archaeon, ATP-b | 1e-126 | |
| 3ll3_A | 504 | Gluconate kinase; xylulose kinase, nysgx, ATP, ADP | 5e-85 | |
| 2uyt_A | 489 | Rhamnulokinase; rhamnose degradation, IN-LINE phos | 1e-73 | |
| 3ifr_A | 508 | Carbohydrate kinase, FGGY; xylulose kinase, SGX, s | 6e-57 | |
| 3hz6_A | 511 | Xylulokinase; xylulose, structural genomic, chromo | 8e-56 | |
| 2itm_A | 484 | Xylulose kinase, xylulokinase; ATPase, FGGY kinase | 7e-52 | |
| 3jvp_A | 572 | Ribulokinase; PSI-II, NYSGXRC, ribulose kinase, su | 9e-45 | |
| 3l0q_A | 554 | Xylulose kinase; xlylulose kinase, SGX, PSI, struc | 3e-42 | |
| 3i8b_A | 515 | Xylulose kinase; strain ATCC 15703 / DSM 20083, 11 | 2e-38 | |
| 3h6e_A | 482 | Carbohydrate kinase, FGGY; novosphingobium aromati | 3e-34 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 8e-05 |
| >2w40_A Glycerol kinase, putative; closed conformation, malaria, transferase, sugar kinase/HSP70/actin superfamily, open conformation; 1.49A {Plasmodium falciparum} PDB: 2w41_A* Length = 503 | Back alignment and structure |
|---|
Score = 399 bits (1027), Expect = e-138
Identities = 111/289 (38%), Positives = 157/289 (54%), Gaps = 18/289 (6%)
Query: 12 VGAIDEGTSSCRFIVFSALTGKLVAKHQISLGQTFPTEGWVEQDPMEILAVVNGTIEACQ 71
+ +ID+ T S + + +V + ++ Q GW E DP+EI+ + +
Sbjct: 6 ILSIDQSTQSTKVFFYDE-ELNIVHSNNLNHEQKCLKPGWYEHDPIEIMTNLYNLMNE-- 62
Query: 72 FSACVEKLKEQGIEPTDIVAVGVTNQRESTIAWDKITGEPLYNSIVWLDARTTSTLEKIL 131
K+ + I +G+TNQRE+ I WD+ITG+PLYN+IVWLD R + +
Sbjct: 63 ----GIKVLKDKYTSVIIKCIGITNQRETVIIWDRITGKPLYNAIVWLDTRVEELVTEFS 118
Query: 132 EVVPNKNKNYLAPLCGLPLSPYFSALKINWLMNNVPKVKEAIDQNRCCIGTVDTWIIWNL 191
N N + G + YFSA KI WL+ N P++K+ ID IG ++TW+I+NL
Sbjct: 119 A---KYNNNDIQKKTGTYFNTYFSAFKILWLIQNNPEIKQKIDDGTAVIGNINTWLIFNL 175
Query: 192 TGGKDGGKYITDVSNASRTMLMNIETLEWDPMLCGFFTIP-MDILPTICSSSEIYGHFVS 250
T G TDV+NASRT+LM+I TL+WD +C F I M +LP I S+ +G S
Sbjct: 176 TKGN----CYTDVTNASRTLLMDINTLQWDEKMCKIFNITNMSVLPEIKSNCSNFGLVKS 231
Query: 251 ---GPLKGVPISGCLGDQHAALLGQNCLKPGLAKSTYGTGCFLLYNTGN 296
+PI+GC+GDQ +A +GQ G AK TYGTG FLL NTG
Sbjct: 232 EHVPDYLNIPITGCIGDQQSACIGQAIFDEGEAKCTYGTGVFLLINTGE 280
|
| >2d4w_A Glycerol kinase; alpha and beta protein, ribonuclease H-like motif, actin- like ATPase domain, transferase; 2.30A {Cellulomonas SP} Length = 504 | Back alignment and structure |
|---|
| >2dpn_A Glycerol kinase; thermus thermophilus HB8, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.80A {Thermus thermophilus} Length = 495 | Back alignment and structure |
|---|
| >3h3n_X Glycerol kinase; ATP-binding, glycerol metabolism, nucleoti binding, phosphoprotein, transferase; 1.73A {Enterococcus casseliflavus} PDB: 3h3o_O 3flc_O 3h46_X 3h45_X 3d7e_O 1r59_O 1xup_O Length = 506 | Back alignment and structure |
|---|
| >3g25_A Glycerol kinase; IDP00743, ATP-binding, glycerol metabolism, nucleotide-binding, transferase, struct genomics; HET: MSE; 1.90A {Staphylococcus aureus subsp} PDB: 3ge1_A* Length = 501 | Back alignment and structure |
|---|
| >4e1j_A Glycerol kinase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, transferase; 2.33A {Sinorhizobium meliloti} Length = 520 | Back alignment and structure |
|---|
| >2zf5_O Glycerol kinase; hyperthermophilic archaeon, ATP-binding, GL metabolism, nucleotide-binding, transferase; 2.40A {Thermococcus kodakarensis} Length = 497 | Back alignment and structure |
|---|
| >3ll3_A Gluconate kinase; xylulose kinase, nysgx, ATP, ADP, xylulose, transferase, structural genomics, PSI-2, protein structure initiative; HET: ATP DXP XUL ADP; 2.00A {Lactobacillus acidophilus} PDB: 3gbt_A* Length = 504 | Back alignment and structure |
|---|
| >2uyt_A Rhamnulokinase; rhamnose degradation, IN-LINE phosphoryl transfer, hexokinas actin superfamily, L-rhamnulose kinase, rhamnose metabolism kinase; HET: LRH ADP; 1.55A {Escherichia coli} PDB: 2cgk_A 2cgj_A* 2cgl_A* Length = 489 | Back alignment and structure |
|---|
| >3ifr_A Carbohydrate kinase, FGGY; xylulose kinase, SGX, structural GENO 11200H, transferase, PSI-2; 2.30A {Rhodospirillum rubrum} Length = 508 | Back alignment and structure |
|---|
| >3hz6_A Xylulokinase; xylulose, structural genomic, chromob violaceum, manolate, transferase, structural genomi 2; HET: ADP XUL; 1.65A {Chromobacterium violaceum} PDB: 3kzb_A* Length = 511 | Back alignment and structure |
|---|
| >2itm_A Xylulose kinase, xylulokinase; ATPase, FGGY kinase, transferase; HET: XUL; 2.10A {Escherichia coli} PDB: 2nlx_A Length = 484 | Back alignment and structure |
|---|
| >3l0q_A Xylulose kinase; xlylulose kinase, SGX, PSI, structural genomics, protein structure initiative; HET: MSE XUL EPE; 1.61A {Yersinia pseudotuberculosis} PDB: 3gg4_A* Length = 554 | Back alignment and structure |
|---|
| >3i8b_A Xylulose kinase; strain ATCC 15703 / DSM 20083, 11200J,, transferase, structural genomics, PSI-2; 2.00A {Bifidobacterium adolescentis ATCC15703} Length = 515 | Back alignment and structure |
|---|
| >3h6e_A Carbohydrate kinase, FGGY; novosphingobium aromaticivorans,strain 12444, SGX, transferase; 2.50A {Novosphingobium aromaticivorans} Length = 482 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 297 | |||
| 3ll3_A | 504 | Gluconate kinase; xylulose kinase, nysgx, ATP, ADP | 100.0 | |
| 3ifr_A | 508 | Carbohydrate kinase, FGGY; xylulose kinase, SGX, s | 100.0 | |
| 3hz6_A | 511 | Xylulokinase; xylulose, structural genomic, chromo | 100.0 | |
| 4e1j_A | 520 | Glycerol kinase; structural genomics, PSI-biology, | 100.0 | |
| 2p3r_A | 510 | Glycerol kinase; glycerol metabolism, allosteric r | 100.0 | |
| 3h3n_X | 506 | Glycerol kinase; ATP-binding, glycerol metabolism, | 100.0 | |
| 3g25_A | 501 | Glycerol kinase; IDP00743, ATP-binding, glycerol m | 100.0 | |
| 3ezw_A | 526 | Glycerol kinase; glycerol metabolism, allosteric r | 100.0 | |
| 2zf5_O | 497 | Glycerol kinase; hyperthermophilic archaeon, ATP-b | 100.0 | |
| 2dpn_A | 495 | Glycerol kinase; thermus thermophilus HB8, structu | 100.0 | |
| 2w40_A | 503 | Glycerol kinase, putative; closed conformation, ma | 100.0 | |
| 4bc3_A | 538 | Xylulose kinase; transferase, glucuronate xyluloki | 100.0 | |
| 2d4w_A | 504 | Glycerol kinase; alpha and beta protein, ribonucle | 100.0 | |
| 2itm_A | 484 | Xylulose kinase, xylulokinase; ATPase, FGGY kinase | 100.0 | |
| 3jvp_A | 572 | Ribulokinase; PSI-II, NYSGXRC, ribulose kinase, su | 100.0 | |
| 3h6e_A | 482 | Carbohydrate kinase, FGGY; novosphingobium aromati | 100.0 | |
| 3i8b_A | 515 | Xylulose kinase; strain ATCC 15703 / DSM 20083, 11 | 100.0 | |
| 2uyt_A | 489 | Rhamnulokinase; rhamnose degradation, IN-LINE phos | 100.0 | |
| 3l0q_A | 554 | Xylulose kinase; xlylulose kinase, SGX, PSI, struc | 100.0 | |
| 2qm1_A | 326 | Glucokinase; alpha-beta structure, putative helix- | 99.0 | |
| 2yhw_A | 343 | Bifunctional UDP-N-acetylglucosamine 2-epimerase/N | 98.76 | |
| 1z05_A | 429 | Transcriptional regulator, ROK family; structural | 98.75 | |
| 2hoe_A | 380 | N-acetylglucosamine kinase; TM1224, structural gen | 98.75 | |
| 3vgl_A | 321 | Glucokinase; ROK family, transferase; HET: BGC ANP | 98.71 | |
| 1z6r_A | 406 | MLC protein; transcriptional repressor, ROK family | 98.68 | |
| 1zc6_A | 305 | Probable N-acetylglucosamine kinase; NESG, Q7NU07_ | 98.64 | |
| 4db3_A | 327 | Glcnac kinase, N-acetyl-D-glucosamine kinase; stru | 98.62 | |
| 3r8e_A | 321 | Hypothetical sugar kinase; ribonuclease H-like mot | 98.59 | |
| 3htv_A | 310 | D-allose kinase, allokinase; NP_418508.1, structur | 98.51 | |
| 2ch5_A | 347 | NAGK protein; transferase, N-acetylglucosamine, gl | 98.48 | |
| 4htl_A | 297 | Beta-glucoside kinase; structural genomics, sugar | 98.45 | |
| 3epq_A | 302 | Putative fructokinase; SCRK, ADP binding, PSI2, MC | 98.39 | |
| 1woq_A | 267 | Inorganic polyphosphate/ATP-glucomannokinase; tran | 98.36 | |
| 3vov_A | 302 | Glucokinase, hexokinase; ROK, sugar kinase, transf | 98.33 | |
| 1hux_A | 270 | Activator of (R)-2-hydroxyglutaryl-COA dehydratase | 98.23 | |
| 2aa4_A | 289 | Mannac kinase, putative N-acetylmannosamine kinase | 98.19 | |
| 2ap1_A | 327 | Putative regulator protein; zinc binding protein, | 98.12 | |
| 2gup_A | 292 | ROK family protein; sugar kinase, streptococcus pn | 98.07 | |
| 3mcp_A | 366 | Glucokinase; structural genomics, joint center for | 98.06 | |
| 2e2o_A | 299 | Hexokinase; acetate and sugar kinases, HSP70, acti | 98.04 | |
| 3lm2_A | 226 | Putative kinase; structural genomics, joint center | 97.85 | |
| 1sz2_A | 332 | Glucokinase, glucose kinase; ATP-dependent, glucos | 97.71 | |
| 2q2r_A | 373 | Glucokinase 1, putative; ATPase hexose kinase fami | 97.56 | |
| 1saz_A | 381 | Probable butyrate kinase 2; askha (acetate and sug | 97.55 | |
| 3djc_A | 266 | Type III pantothenate kinase; structural genomics, | 97.51 | |
| 1zbs_A | 291 | Hypothetical protein PG1100; alpha-beta protein., | 97.49 | |
| 1bdg_A | 451 | Hexokinase; phosphotransferase; HET: GLC; 2.60A {S | 97.43 | |
| 2yhx_A | 457 | Hexokinase B; transferase(phosphoryl,alcohol accep | 97.34 | |
| 4ehu_A | 276 | Activator of 2-hydroxyisocaproyl-COA dehydratase; | 97.33 | |
| 1cza_N | 917 | Hexokinase type I; structurally homologous domains | 97.28 | |
| 3zyy_X | 631 | Iron-sulfur cluster binding protein; iron-sulfur-b | 97.07 | |
| 1zxo_A | 291 | Conserved hypothetical protein Q8A1P1; NESG, BTR25 | 96.93 | |
| 3o8m_A | 485 | Hexokinase; rnaseh-like fold, glycolysis, glucose | 96.84 | |
| 1cza_N | 917 | Hexokinase type I; structurally homologous domains | 96.83 | |
| 3bex_A | 249 | Type III pantothenate kinase; actin-like fold, ATP | 96.76 | |
| 2h3g_X | 268 | Biosynthetic protein; pantothenate kinase, anthrax | 96.69 | |
| 3h1q_A | 272 | Ethanolamine utilization protein EUTJ; ethanolamin | 96.64 | |
| 4a2a_A | 419 | Cell division protein FTSA, putative; cell cycle, | 96.18 | |
| 2ivn_A | 330 | O-sialoglycoprotein endopeptidase; UP1 keops compl | 94.63 | |
| 2ych_A | 377 | Competence protein PILM; cell cycle, type IV pilus | 94.56 | |
| 3hm8_A | 445 | Hexokinase-3; glucose, glucose-6-phosphate, non-pr | 94.25 | |
| 3f9m_A | 470 | Glucokinase; hexokinase IV, ATP-binding, diabetes | 93.78 | |
| 3mdq_A | 315 | Exopolyphosphatase; structural genomics, joint cen | 93.46 | |
| 1t6c_A | 315 | Exopolyphosphatase; alpha/beta protein, actin-like | 92.88 | |
| 3r9p_A | 391 | ACKA; ssgcid, seattle structural genomics center f | 90.79 | |
| 3nuw_A | 295 | 2-OXO-3-deoxygalactonate kinase; structural genomi | 90.68 | |
| 4ijn_A | 398 | Acetate kinase, acetokinase; proprionate kinase, A | 90.51 | |
| 3t69_A | 330 | Putative 2-dehydro-3-deoxygalactonokinase; structu | 90.5 | |
| 3eno_A | 334 | Putative O-sialoglycoprotein endopeptidase; hydrol | 90.46 | |
| 1u6z_A | 513 | Exopolyphosphatase; alpha/beta protein, askha (ace | 90.12 | |
| 2f9w_A | 271 | Pantothenate kinase; COAA, transferase; HET: PAU; | 89.37 | |
| 3cet_A | 334 | Conserved archaeal protein; Q6M145, MRR63, NESG, X | 87.21 | |
| 3cer_A | 343 | Possible exopolyphosphatase-like protein; NESG, BL | 86.83 | |
| 2ews_A | 287 | Pantothenate kinase; PANK, structural genomics, st | 86.55 | |
| 4gni_A | 409 | Putative heat shock protein; HSP70-type ATPase, AT | 86.35 | |
| 3sk3_A | 415 | Acetate kinase, acetokinase; actin-like ATPase dom | 85.74 | |
| 1vhx_A | 150 | Putative holliday junction resolvase; structural g | 85.66 | |
| 2e1z_A | 415 | Propionate kinase; TDCD, native, acetate kinase, n | 85.65 | |
| 3cqy_A | 370 | Anhydro-N-acetylmuramic acid kinase; APC7501, SO_1 | 85.63 | |
| 3r6m_A | 213 | YEAZ, resuscitation promoting factor; actin/HSP70 | 84.68 | |
| 1nbw_A | 607 | Glycerol dehydratase reactivase alpha subunit; mol | 84.52 | |
| 3hi0_A | 508 | Putative exopolyphosphatase; 17739545, structural | 83.26 | |
| 3en9_A | 540 | Glycoprotease, O-sialoglycoprotein endopeptidase/p | 80.6 | |
| 2gel_A | 231 | Putative GRAM negative resuscitation promoting FA; | 80.45 |
| >3ll3_A Gluconate kinase; xylulose kinase, nysgx, ATP, ADP, xylulose, transferase, structural genomics, PSI-2, protein structure initiative; HET: ATP DXP XUL ADP; 2.00A {Lactobacillus acidophilus} PDB: 3gbt_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=3.5e-59 Score=454.30 Aligned_cols=264 Identities=23% Similarity=0.283 Sum_probs=248.6
Q ss_pred cCCEEEEEecCCCcceEEEEeCCCCeEEEEEEeeeccccCCCCeeEeCHHHHHHHHHHHHHhhhhHHHHHHHHHcCCCCC
Q psy9351 8 YGPLVGAIDEGTSSCRFIVFSALTGKLVAKHQISLGQTFPTEGWVEQDPMEILAVVNGTIEACQFSACVEKLKEQGIEPT 87 (297)
Q Consensus 8 ~~~~~lgIDiGtt~ik~~l~d~~~g~v~~~~~~~~~~~~~~~g~~e~d~~~~~~~i~~~i~~~~~~~~~~~l~~~~~~~~ 87 (297)
+++|+||||+|||++|++++|. +|++++..+.+++..+|.+|+.||||++||+.+.++++ + + +++.+ .
T Consensus 2 ~m~~~lgIDiGtts~K~~l~d~-~G~il~~~~~~~~~~~p~~g~~e~dp~~~~~~~~~~i~----~-~---~~~~~---~ 69 (504)
T 3ll3_A 2 SLKYIIGMDVGTTATKGVLYDI-NGKAVASVSKGYPLIQTKVGQAEEDPKLIFDAVQEIIF----D-L---TQKID---G 69 (504)
T ss_dssp CCEEEEEEEECSSEEEEEEEET-TSCEEEEEEEECCCBCSSTTCCEECHHHHHHHHHHHHH----H-H---HHTCS---S
T ss_pred CCCEEEEEEecCCceEEEEEcC-CCCEEEEEEeecceecCCCCcEEECHHHHHHHHHHHHH----H-H---HHhCC---C
Confidence 3569999999999999999997 89999999999998899999999999999999999999 7 5 34333 7
Q ss_pred CeeEEEEcCccceEEEEeCCCCccccccccccccCCHHHHHHHHHhCCCChhhhHHhhhCCCCCCcchHHHHHHHHHhCh
Q psy9351 88 DIVAVGVTNQRESTIAWDKITGEPLYNSIVWLDARTTSTLEKILEVVPNKNKNYLAPLCGLPLSPYFSALKINWLMNNVP 167 (297)
Q Consensus 88 ~I~~Igis~~~~~~v~vd~~~g~~~~~~i~w~D~R~~~~~~~l~~~~~~~~~~~~~~~tG~~~~~~~~~~kl~wl~~~~p 167 (297)
+|.+|||++|++++|+||+ +|+|++|+|.|+|.|+.++++++++..+ .+.++++||.++.+.++++||+|+++|+|
T Consensus 70 ~I~~Igis~q~~~~v~~D~-~G~pl~~~i~W~D~R~~~~~~~l~~~~~---~~~~~~~tG~~~~~~~~~~kl~wl~~~~p 145 (504)
T 3ll3_A 70 KIAAISWSSQMHSLIGLGS-DDELLTNSITWADNCAKSIVQDAKNRGF---AQQIYRKTGMPMHPMAPIYKLLWLKNKKT 145 (504)
T ss_dssp EEEEEEEEECSSCBEEECT-TSCBSSCEECTTCCTTHHHHHHHHHHTH---HHHHHHHHCCCSCTTSHHHHHHHHHHHCH
T ss_pred CeEEEEEECCCCcEEEECC-CCCCcccceeCCccCHHHHHHHHHhccC---HHHHHHHHCCCCCcccHHHHHHHHHHcCh
Confidence 8999999999999999999 7999999999999999999999988764 36899999999999999999999999999
Q ss_pred hhHhhhhcCceeeeChhHHHHHHHcCCCCCCceEeeccccccccCccCCCCCCcHHHhcccCCCCCCCCCcccCCcceee
Q psy9351 168 KVKEAIDQNRCCIGTVDTWIIWNLTGGKDGGKYITDVSNASRTMLMNIETLEWDPMLCGFFTIPMDILPTICSSSEIYGH 247 (297)
Q Consensus 168 ~~~~~~~~~~~~~~~~~dyi~~~LtG~~~~~~~~~d~s~a~~tgl~d~~~~~w~~~~l~~~gi~~~~LP~l~~~g~~~G~ 247 (297)
++|+++ .+|++++|||.|+|||+ .++|+|+|++|++||+++++|++++|+.+||++++||+|+++++++|+
T Consensus 146 e~~~~~----~~~~~~~dyl~~~LTG~-----~~~d~s~As~t~l~d~~~~~W~~~ll~~~gi~~~~LP~i~~~~~~~G~ 216 (504)
T 3ll3_A 146 EVFSQA----QKWIGIKEYIIFRLTGK-----LVTDTTMAAGTGILNLKTLTWDQELLDILKIKKEQLPKIAQPTKVIFP 216 (504)
T ss_dssp HHHHHC----CEEECHHHHHHHHHHSC-----CEEEHHHHTTTTCBCTTTSSBCHHHHHHHTCCGGGSCEEECTTCEECC
T ss_pred HHHHHH----hheeCHHHHHHHHHhCC-----cccchhHhhcccCeeCCCCCcCHHHHHHcCCCHHHCCCeeCCcceeec
Confidence 999998 69999999999999999 999999999999999999999999999999999999999999999999
Q ss_pred c------ccCCCCCCcEEEecchHHHHHHhcCCCCCCcEEEEecccccccccccC
Q psy9351 248 F------VSGPLKGVPISGCLGDQHAALLGQNCLKPGLAKSTYGTGCFLLYNTGN 296 (297)
Q Consensus 248 i------~~Gl~~g~pV~~g~~D~~aa~~g~g~~~~g~~~~~~GTs~~v~~~t~~ 296 (297)
+ ++||++|+||++|++|++|+++|+|++++|++++++|||+++.++++.
T Consensus 217 l~~~~a~~~Gl~~g~pV~~g~~D~~aa~~g~g~~~~g~~~~s~GTs~~~~~~~~~ 271 (504)
T 3ll3_A 217 IKTEYVKKLGIDSDTKIILGASDGYLSTIGVNAIDSDHCALNVGTSGAIRTIVDQ 271 (504)
T ss_dssp CCHHHHHHHTCCTTCEEEEEEEHHHHHHHTTTCCSTTEEEEEESSSEEEEEEESS
T ss_pred cCHHHHHhcCCCcCCCEEEEccHHHHHHHhCCCCCCCcEEEEechhhhheeeCCC
Confidence 9 479999999999999999999999999999999999999999888753
|
| >3ifr_A Carbohydrate kinase, FGGY; xylulose kinase, SGX, structural GENO 11200H, transferase, PSI-2; 2.30A {Rhodospirillum rubrum} | Back alignment and structure |
|---|
| >3hz6_A Xylulokinase; xylulose, structural genomic, chromob violaceum, manolate, transferase, structural genomi 2; HET: ADP XUL; 1.65A {Chromobacterium violaceum} PDB: 3kzb_A* | Back alignment and structure |
|---|
| >4e1j_A Glycerol kinase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, transferase; 2.33A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3h3n_X Glycerol kinase; ATP-binding, glycerol metabolism, nucleoti binding, phosphoprotein, transferase; 1.73A {Enterococcus casseliflavus} PDB: 3h3o_O 3flc_O 3h46_X 3h45_X 3d7e_O 1r59_O 1xup_O | Back alignment and structure |
|---|
| >3g25_A Glycerol kinase; IDP00743, ATP-binding, glycerol metabolism, nucleotide-binding, transferase, struct genomics; HET: MSE; 1.90A {Staphylococcus aureus subsp} PDB: 3ge1_A* | Back alignment and structure |
|---|
| >3ezw_A Glycerol kinase; glycerol metabolism, allosteric regulation, microfluidics, in SITU DATA collection, ATP-binding, kinase binding; 2.00A {Escherichia coli} PDB: 1gla_G 1bo5_O* 1bot_O 1glb_G* 1glc_G* 1gld_G* 1gle_G* 1glf_O* 1bu6_O 1bwf_Y* 1glj_Y* 1gll_Y* | Back alignment and structure |
|---|
| >2zf5_O Glycerol kinase; hyperthermophilic archaeon, ATP-binding, GL metabolism, nucleotide-binding, transferase; 2.40A {Thermococcus kodakarensis} | Back alignment and structure |
|---|
| >2dpn_A Glycerol kinase; thermus thermophilus HB8, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.80A {Thermus thermophilus} | Back alignment and structure |
|---|
| >2w40_A Glycerol kinase, putative; closed conformation, malaria, transferase, sugar kinase/HSP70/actin superfamily, open conformation; 1.49A {Plasmodium falciparum} PDB: 2w41_A* | Back alignment and structure |
|---|
| >4bc3_A Xylulose kinase; transferase, glucuronate xylulokinase pathway; HET: MSE EDO; 1.68A {Homo sapiens} PDB: 4bc2_A* 4bc4_A* 4bc5_A* | Back alignment and structure |
|---|
| >2d4w_A Glycerol kinase; alpha and beta protein, ribonuclease H-like motif, actin- like ATPase domain, transferase; 2.30A {Cellulomonas SP} | Back alignment and structure |
|---|
| >2itm_A Xylulose kinase, xylulokinase; ATPase, FGGY kinase, transferase; HET: XUL; 2.10A {Escherichia coli} PDB: 2nlx_A | Back alignment and structure |
|---|
| >3h6e_A Carbohydrate kinase, FGGY; novosphingobium aromaticivorans,strain 12444, SGX, transferase; 2.50A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >3i8b_A Xylulose kinase; strain ATCC 15703 / DSM 20083, 11200J,, transferase, structural genomics, PSI-2; 2.00A {Bifidobacterium adolescentis ATCC15703} | Back alignment and structure |
|---|
| >2uyt_A Rhamnulokinase; rhamnose degradation, IN-LINE phosphoryl transfer, hexokinas actin superfamily, L-rhamnulose kinase, rhamnose metabolism kinase; HET: LRH ADP; 1.55A {Escherichia coli} PDB: 2cgk_A 2cgj_A* 2cgl_A* | Back alignment and structure |
|---|
| >3l0q_A Xylulose kinase; xlylulose kinase, SGX, PSI, structural genomics, protein structure initiative; HET: MSE XUL EPE; 1.61A {Yersinia pseudotuberculosis} PDB: 3gg4_A* | Back alignment and structure |
|---|
| >2qm1_A Glucokinase; alpha-beta structure, putative helix-turn-helix, structural PSI-2, protein structure initiative; HET: MSE; 2.02A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >2yhw_A Bifunctional UDP-N-acetylglucosamine 2-epimerase/N-acetylmannosamine kinase; transferase, sialic acid, mannac, ROK family; HET: BM3 2PE; 1.64A {Homo sapiens} PDB: 2yhy_A* 2yi1_A* 3eo3_A | Back alignment and structure |
|---|
| >1z05_A Transcriptional regulator, ROK family; structural genomics, protein structure initiative, midwest center for structural genomics; 2.00A {Vibrio cholerae o1 biovar eltor} SCOP: a.4.5.63 c.55.1.10 c.55.1.10 | Back alignment and structure |
|---|
| >2hoe_A N-acetylglucosamine kinase; TM1224, structural genomics, PSI-2, protein structure initiative, joint center structural genomics, JCSG; 2.46A {Thermotoga maritima} SCOP: a.4.5.63 c.55.1.10 c.55.1.10 | Back alignment and structure |
|---|
| >3vgl_A Glucokinase; ROK family, transferase; HET: BGC ANP; 1.55A {Streptomyces griseus} PDB: 3vgk_A* 3vgm_A* | Back alignment and structure |
|---|
| >1z6r_A MLC protein; transcriptional repressor, ROK family protein, DNA binding P helix-turn-helix, phosphotransferase system; 2.70A {Escherichia coli} SCOP: a.4.5.63 c.55.1.10 c.55.1.10 PDB: 3bp8_A | Back alignment and structure |
|---|
| >1zc6_A Probable N-acetylglucosamine kinase; NESG, Q7NU07_chrvo, CVR23, struc genomics, PSI, protein structure initiative; 2.20A {Chromobacterium violaceum} SCOP: c.55.1.5 c.55.1.5 | Back alignment and structure |
|---|
| >4db3_A Glcnac kinase, N-acetyl-D-glucosamine kinase; structural genomics, center for structural genomics of infec diseases, csgid, transferase; 1.95A {Vibrio vulnificus} | Back alignment and structure |
|---|
| >3r8e_A Hypothetical sugar kinase; ribonuclease H-like motif, structural genomics, joint center structural genomics, JCSG; HET: MSE; 1.65A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >3htv_A D-allose kinase, allokinase; NP_418508.1, structural genomics, joint CEN structural genomics, JCSG, protein structure initiative; HET: MSE; 1.95A {Escherichia coli k-12} | Back alignment and structure |
|---|
| >2ch5_A NAGK protein; transferase, N-acetylglucosamine, glcnac, sugar kinase, RIBO H fold, sugar kinase/HSP70/actin superfamily, domain rotati conformation; HET: NAG NDG; 1.9A {Homo sapiens} SCOP: c.55.1.5 c.55.1.5 PDB: 2ch6_A* | Back alignment and structure |
|---|
| >4htl_A Beta-glucoside kinase; structural genomics, sugar kinase, ROK family, PSI-biology, center for structural genomics, MCSG, transferase; HET: MSE; 1.64A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1woq_A Inorganic polyphosphate/ATP-glucomannokinase; transferase; HET: BGC; 1.80A {Arthrobacter SP} SCOP: c.55.1.10 c.55.1.10 | Back alignment and structure |
|---|
| >3vov_A Glucokinase, hexokinase; ROK, sugar kinase, transferase; 2.02A {Thermus thermophilus} | Back alignment and structure |
|---|
| >1hux_A Activator of (R)-2-hydroxyglutaryl-COA dehydratase; actin fold, metal binding protein; HET: ADP; 3.00A {Acidaminococcus fermentans} SCOP: c.55.1.5 | Back alignment and structure |
|---|
| >2aa4_A Mannac kinase, putative N-acetylmannosamine kinase; sugar methabolism, structural genomics, PSI, protein structure initiative; 2.20A {Escherichia coli} SCOP: c.55.1.10 c.55.1.10 | Back alignment and structure |
|---|
| >2ap1_A Putative regulator protein; zinc binding protein, structural genomics, PSI, protein STRU initiative; 1.90A {Salmonella typhimurium} SCOP: c.55.1.10 c.55.1.10 | Back alignment and structure |
|---|
| >2gup_A ROK family protein; sugar kinase, streptococcus pneumoniae TIGR4, AP sucrose, structural genomics, PSI; HET: SUC; 2.01A {Streptococcus pneumoniae} SCOP: c.55.1.10 c.55.1.10 | Back alignment and structure |
|---|
| >3mcp_A Glucokinase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, transferase; 3.00A {Parabacteroides distasonis} | Back alignment and structure |
|---|
| >2e2o_A Hexokinase; acetate and sugar kinases, HSP70, actin superfamily, ribonuc fold, sugar kinase, glucose, phosphoryl transfer, transferase; HET: BGC; 1.65A {Sulfolobus tokodaii} PDB: 2e2n_A* 2e2p_A* 2e2q_A* | Back alignment and structure |
|---|
| >3lm2_A Putative kinase; structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-2, transf; HET: MSE; 1.70A {Agrobacterium tumefaciens} | Back alignment and structure |
|---|
| >1sz2_A Glucokinase, glucose kinase; ATP-dependent, glucose binding, transferase; HET: MSE BGC; 2.20A {Escherichia coli} SCOP: c.55.1.7 PDB: 1q18_A* | Back alignment and structure |
|---|
| >2q2r_A Glucokinase 1, putative; ATPase hexose kinase family, transferase; HET: BGC ADP; 2.10A {Trypanosoma cruzi} | Back alignment and structure |
|---|
| >1saz_A Probable butyrate kinase 2; askha (acetate and sugar kinases, HSC70, actin) superfamily, acetate kinase, isobutyrate kinase; HET: ACP; 2.50A {Thermotoga maritima} SCOP: c.55.1.2 c.55.1.2 PDB: 1x9j_A* | Back alignment and structure |
|---|
| >3djc_A Type III pantothenate kinase; structural genomics, putative transfera 2, protein structure initiative; 2.40A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >1zbs_A Hypothetical protein PG1100; alpha-beta protein., structural genomics, PSI, protein struc initiative; 2.30A {Porphyromonas gingivalis} SCOP: c.55.1.5 c.55.1.5 | Back alignment and structure |
|---|
| >1bdg_A Hexokinase; phosphotransferase; HET: GLC; 2.60A {Schistosoma mansoni} SCOP: c.55.1.3 c.55.1.3 | Back alignment and structure |
|---|
| >2yhx_A Hexokinase B; transferase(phosphoryl,alcohol acceptr); HET: OTG; 2.10A {Saccharomyces cerevisiae} SCOP: i.12.1.1 PDB: 1hkg_A | Back alignment and structure |
|---|
| >4ehu_A Activator of 2-hydroxyisocaproyl-COA dehydratase; actin fold, ATPase, electron transfer, ATP/ADP binding; HET: ANP; 1.60A {Clostridium difficile} PDB: 4eht_A* 4eia_A | Back alignment and structure |
|---|
| >1cza_N Hexokinase type I; structurally homologous domains, transferase; HET: GLC G6P ADP; 1.90A {Homo sapiens} SCOP: c.55.1.3 c.55.1.3 c.55.1.3 c.55.1.3 PDB: 1dgk_N* 1hkb_A* 1qha_A* 1hkc_A* 1bg3_A* 2nzt_A* | Back alignment and structure |
|---|
| >3zyy_X Iron-sulfur cluster binding protein; iron-sulfur-binding protein, ashka family, ATPase; 2.20A {Carboxydothermus hydrogenoformans} | Back alignment and structure |
|---|
| >1zxo_A Conserved hypothetical protein Q8A1P1; NESG, BTR25, structural genomics, PSI, protein structure initiative; 3.20A {Bacteroides thetaiotaomicron} SCOP: c.55.1.5 c.55.1.5 | Back alignment and structure |
|---|
| >3o8m_A Hexokinase; rnaseh-like fold, glycolysis, glucose repression binding, MIG1 binding, transferase; HET: GLC BGC; 1.42A {Kluyveromyces lactis} PDB: 3o1b_A 3o08_A* 3o1w_A* 3o5b_A* 3o4w_A 3o80_A* 3o6w_A* 1ig8_A 3b8a_X* | Back alignment and structure |
|---|
| >1cza_N Hexokinase type I; structurally homologous domains, transferase; HET: GLC G6P ADP; 1.90A {Homo sapiens} SCOP: c.55.1.3 c.55.1.3 c.55.1.3 c.55.1.3 PDB: 1dgk_N* 1hkb_A* 1qha_A* 1hkc_A* 1bg3_A* 2nzt_A* | Back alignment and structure |
|---|
| >3bex_A Type III pantothenate kinase; actin-like fold, ATP-binding, coenzyme A biosynthesis, cytoplasm, metal-binding, nucleotide-binding, potassium; HET: PAU; 1.51A {Thermotoga maritima} SCOP: c.55.1.13 c.55.1.13 PDB: 3bf1_A* 3bf3_A* 2gtd_A | Back alignment and structure |
|---|
| >2h3g_X Biosynthetic protein; pantothenate kinase, anthrax, type III pantothenate kinase, COAX, COAA, askha; 2.00A {Bacillus anthracis str} | Back alignment and structure |
|---|
| >3h1q_A Ethanolamine utilization protein EUTJ; ethanolamine utilization EUTJ, structural genomics, PSI-2; HET: ATP; 2.80A {Carboxydothermus hydrogenoformans z-29organism_taxid} | Back alignment and structure |
|---|
| >4a2a_A Cell division protein FTSA, putative; cell cycle, actin, divisome; HET: ATP; 1.80A {Thermotoga maritima} PDB: 1e4g_T* 1e4f_T* 4a2b_A* | Back alignment and structure |
|---|
| >2ivn_A O-sialoglycoprotein endopeptidase; UP1 keops complex, Fe/Zn dependent nucleotide phosphatase, metalloprotease, hypothetical protein, zinc; HET: ANP; 1.65A {Pyrococcus abyssi} PDB: 2ivo_A 2ivp_A* | Back alignment and structure |
|---|
| >2ych_A Competence protein PILM; cell cycle, type IV pilus actin secretion; HET: ATP; 2.20A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3hm8_A Hexokinase-3; glucose, glucose-6-phosphate, non-protein kinase, structural genomics consortium, SGC, A enzyme, ATP-binding, glycolysis; HET: GLC BG6; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3f9m_A Glucokinase; hexokinase IV, ATP-binding, diabetes mellitus, mutation, glycolysis, nucleotide-binding, transfera; HET: GLC MRK; 1.50A {Homo sapiens} PDB: 3fgu_A* 3id8_A* 3idh_A* 3vev_A* 3vf6_A* 3qic_A* 3s41_A* 4dhy_A* 4dch_A* 3vey_A* 1v4s_A* 3a0i_X* 3fr0_A* 3goi_A* 3imx_A* 3h1v_X* 1v4t_A* | Back alignment and structure |
|---|
| >3mdq_A Exopolyphosphatase; structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2, hydrol; HET: MSE; 1.50A {Cytophaga hutchinsonii} | Back alignment and structure |
|---|
| >1t6c_A Exopolyphosphatase; alpha/beta protein, actin-like fold, hydrolase; 1.53A {Aquifex aeolicus} SCOP: c.55.1.8 c.55.1.8 PDB: 1t6d_A 2j4r_A* | Back alignment and structure |
|---|
| >3r9p_A ACKA; ssgcid, seattle structural genomics center for infectious DI acetate kinase, transferase; HET: PGE; 1.90A {Mycobacterium avium subsp} PDB: 3p4i_A 4dq8_A | Back alignment and structure |
|---|
| >4ijn_A Acetate kinase, acetokinase; proprionate kinase, ATP-dependent, metabolic intermediate biosynthesis, acetyl-COA biosynthesis, hydrolysis; HET: AMP; 1.70A {Mycobacterium smegmatis} | Back alignment and structure |
|---|
| >3t69_A Putative 2-dehydro-3-deoxygalactonokinase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.55A {Sinorhizobium meliloti} | Back alignment and structure |
|---|
| >3eno_A Putative O-sialoglycoprotein endopeptidase; hydrolase, metal-binding, metalloprotease, protease, zinc, keops complex, ATPase, metal ION binding; 3.02A {Thermoplasma acidophilum} | Back alignment and structure |
|---|
| >1u6z_A Exopolyphosphatase; alpha/beta protein, askha (acetate and sugar kinases, HSC70, superfamily; 1.90A {Escherichia coli} SCOP: a.211.1.5 c.55.1.8 c.55.1.8 PDB: 2flo_A* | Back alignment and structure |
|---|
| >2f9w_A Pantothenate kinase; COAA, transferase; HET: PAU; 1.90A {Pseudomonas aeruginosa} SCOP: c.55.1.13 c.55.1.13 PDB: 2f9t_A* | Back alignment and structure |
|---|
| >3cet_A Conserved archaeal protein; Q6M145, MRR63, NESG, XRAY, structure, structural genomics, PSI-2, protein structure initiative; 1.80A {Methanococcus maripaludis S2} PDB: 3c0b_A | Back alignment and structure |
|---|
| >3cer_A Possible exopolyphosphatase-like protein; NESG, BLR13, Q8G5J2, X-RAY, structure, structural genomics, PSI-2; 2.40A {Bifidobacterium longum NCC2705} | Back alignment and structure |
|---|
| >2ews_A Pantothenate kinase; PANK, structural genomics, structural genomics consortium, S transferase; HET: ANP; 2.05A {Staphylococcus aureus subsp} SCOP: c.55.1.14 | Back alignment and structure |
|---|
| >4gni_A Putative heat shock protein; HSP70-type ATPase, ATP binding protein, magnesium binding, C translational chaperone; HET: ATP; 1.80A {Chaetomium thermophilum var} | Back alignment and structure |
|---|
| >3sk3_A Acetate kinase, acetokinase; actin-like ATPase domain, askha superfamily of phosphotransf acetokinase, ATP binding, phosphotransferase; HET: CIT; 1.90A {Salmonella enterica subsp} PDB: 3slc_A | Back alignment and structure |
|---|
| >1vhx_A Putative holliday junction resolvase; structural genomics, hydrolase; 1.96A {Bacillus subtilis} SCOP: c.55.3.8 | Back alignment and structure |
|---|
| >2e1z_A Propionate kinase; TDCD, native, acetate kinase, nucleotide, AP4A, ADP, ATP, AMPPNP, transferase; HET: B4P; 1.98A {Salmonella typhimurium} SCOP: c.55.1.2 c.55.1.2 PDB: 1x3n_A* 2e1y_A 1x3m_A* 2e20_A* | Back alignment and structure |
|---|
| >3cqy_A Anhydro-N-acetylmuramic acid kinase; APC7501, SO_1313, structural genomics, PSI-2, shewanella one MR-1, protein structure initiative; 2.30A {Shewanella oneidensis} | Back alignment and structure |
|---|
| >3r6m_A YEAZ, resuscitation promoting factor; actin/HSP70 nucleotide-binding fold, bacterial resuscitation BUT non-culturable state, Y YJEE; 3.10A {Vibrio parahaemolyticus} | Back alignment and structure |
|---|
| >1nbw_A Glycerol dehydratase reactivase alpha subunit; molecular chaperone, actin-like ATPase domain, beta/BETA/alpha swiveling domain, hydrolase; 2.40A {Klebsiella pneumoniae} SCOP: c.8.6.1 c.55.1.6 c.55.1.6 | Back alignment and structure |
|---|
| >3hi0_A Putative exopolyphosphatase; 17739545, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 2.30A {Agrobacterium tumefaciens str} | Back alignment and structure |
|---|
| >3en9_A Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A* | Back alignment and structure |
|---|
| >2gel_A Putative GRAM negative resuscitation promoting FA; YEAZ, RPF, actin-like-fold, glycoprotease, chaperone; 2.05A {Salmonella typhimurium} PDB: 2gem_A 1okj_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 297 | ||||
| d2p3ra1 | 252 | c.55.1.4 (A:2-253) Glycerol kinase {Escherichia co | 5e-72 | |
| d1r59o1 | 252 | c.55.1.4 (O:5-256) Glycerol kinase {Enterococcus c | 2e-71 | |
| d2p3ra2 | 247 | c.55.1.4 (A:254-500) Glycerol kinase {Escherichia | 6e-08 | |
| d1r59o2 | 235 | c.55.1.4 (O:257-491) Glycerol kinase {Enterococcus | 2e-06 | |
| d1zc6a1 | 114 | c.55.1.5 (A:8-121) Probable N-acetylglucosamine ki | 7e-06 |
| >d1r59o1 c.55.1.4 (O:5-256) Glycerol kinase {Enterococcus casseliflavus [TaxId: 37734]} Length = 252 | Back information, alignment and structure |
|---|
| >d1r59o2 c.55.1.4 (O:257-491) Glycerol kinase {Enterococcus casseliflavus [TaxId: 37734]} Length = 235 | Back information, alignment and structure |
|---|
| >d1zc6a1 c.55.1.5 (A:8-121) Probable N-acetylglucosamine kinase CV2896 {Chromobacterium violaceum [TaxId: 536]} Length = 114 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 297 | |||
| d2p3ra1 | 252 | Glycerol kinase {Escherichia coli [TaxId: 562]} | 100.0 | |
| d1r59o1 | 252 | Glycerol kinase {Enterococcus casseliflavus [TaxId | 100.0 | |
| d2hoea3 | 128 | N-acetylglucosamine kinase {Thermotoga maritima [T | 99.12 | |
| d1zc6a1 | 114 | Probable N-acetylglucosamine kinase CV2896 {Chromo | 99.08 | |
| d2ap1a2 | 117 | Putative regulator protein YcfX {Salmonella typhim | 99.07 | |
| d1z05a3 | 128 | Transcriptional regulator VC2007 {Vibrio cholerae | 99.01 | |
| d2aa4a1 | 119 | N-acetylmannosamine kinase NanK {Escherichia coli | 98.95 | |
| d2gupa1 | 114 | Hypothetical protein SP2142 {Streptococcus pneumon | 98.91 | |
| d1z6ra2 | 129 | Mlc protein {Escherichia coli [TaxId: 562]} | 98.8 | |
| d1woqa1 | 129 | Inorganic polyphosphate/ATP-glucomannokinase PPGMK | 98.78 | |
| d1xc3a1 | 118 | Putative fructokinase YhdR {Bacillus subtilis [Tax | 98.59 | |
| d2ch5a2 | 117 | N-acetylglucosamine kinase, NAGK {Human (Homo sapi | 98.51 | |
| d1q18a1 | 110 | Glucokinase Glk {Escherichia coli [TaxId: 562]} | 98.15 | |
| d1sz2a1 | 319 | Glucokinase Glk {Escherichia coli [TaxId: 562]} | 98.07 | |
| d1huxa_ | 259 | Hydroxyglutaryl-CoA dehydratase component A {Acida | 97.88 | |
| d2ewsa1 | 267 | Type II pantothenate kinase, CoaW {Staphylococcus | 96.66 | |
| d1bdga1 | 208 | Hexokinase {Blood fluke (Schistosoma mansoni) [Tax | 96.31 | |
| d1e4ft1 | 193 | Cell division protein FtsA {Thermotoga maritima [T | 96.02 | |
| d1czan3 | 205 | Mammalian type I hexokinase {Human (Homo sapiens) | 95.95 | |
| d1ig8a1 | 207 | Hexokinase {Baker's yeast (Saccharomyces cerevisia | 95.92 | |
| d1saza1 | 172 | butyrate kinase 2 {Thermotoga maritima [TaxId: 233 | 95.6 | |
| d1v4sa1 | 205 | Glucokinase {Human (Homo sapiens) [TaxId: 9606]} | 95.46 | |
| d3bexa1 | 118 | Type III pantothenate kinase, CoaX {Thermotoga mar | 95.27 | |
| d1czan1 | 207 | Mammalian type I hexokinase {Human (Homo sapiens) | 95.13 | |
| d1t6ca1 | 126 | Exopolyphosphatase Ppx {Aquifex aeolicus [TaxId: 6 | 94.78 | |
| d1u6za2 | 124 | Exopolyphosphatase Ppx {Escherichia coli [TaxId: 5 | 94.68 | |
| d1zbsa2 | 107 | Hypothetical protein PG1100 {Porphyromonas gingiva | 94.36 | |
| d1nbwa2 | 239 | ATPase domain of the glycerol dehydratase reactiva | 93.84 | |
| d2e1za1 | 189 | Propionate kinase {Salmonella typhimurium [TaxId: | 93.78 | |
| d3bzka5 | 149 | Transcriptional accessory factor Tex {Pseudomonas | 91.55 | |
| d1g99a1 | 197 | Acetate kinase {Archaeon Methanosarcina thermophil | 88.29 | |
| d2f9wa2 | 114 | Type III pantothenate kinase, CoaX {Pseudomonas ae | 87.87 | |
| d2d0oa2 | 241 | Diol dehydratase-reactivating factor large subunit | 87.17 | |
| d1bupa1 | 185 | Heat shock protein 70kDa, ATPase fragment {Cow (Bo | 87.14 | |
| d1okja1 | 106 | Hypothetical protein YeaZ {Escherichia coli [TaxId | 85.74 | |
| d1dkgd1 | 183 | Heat shock protein 70kDa, ATPase fragment {Escheri | 84.5 | |
| d1jcea1 | 137 | Prokaryotic actin homolog MreB {Thermotoga maritim | 83.75 | |
| d1nu0a_ | 138 | Hypothetical protein YqgF (RuvX) {Escherichia coli | 81.97 | |
| d1iv0a_ | 98 | Hypothetical protein, YqgF homologue {Thermus ther | 80.27 |
| >d1r59o1 c.55.1.4 (O:5-256) Glycerol kinase {Enterococcus casseliflavus [TaxId: 37734]} | Back information, alignment and structure |
|---|
| >d2hoea3 c.55.1.10 (A:72-199) N-acetylglucosamine kinase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1zc6a1 c.55.1.5 (A:8-121) Probable N-acetylglucosamine kinase CV2896 {Chromobacterium violaceum [TaxId: 536]} | Back information, alignment and structure |
|---|
| >d2ap1a2 c.55.1.10 (A:1-117) Putative regulator protein YcfX {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d1z05a3 c.55.1.10 (A:81-208) Transcriptional regulator VC2007 {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
| >d2aa4a1 c.55.1.10 (A:1-119) N-acetylmannosamine kinase NanK {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d2gupa1 c.55.1.10 (A:1-114) Hypothetical protein SP2142 {Streptococcus pneumoniae [TaxId: 1313]} | Back information, alignment and structure |
|---|
| >d1z6ra2 c.55.1.10 (A:82-210) Mlc protein {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1woqa1 c.55.1.10 (A:11-139) Inorganic polyphosphate/ATP-glucomannokinase PPGMK {Arthrobacter sp. KM [TaxId: 184230]} | Back information, alignment and structure |
|---|
| >d1xc3a1 c.55.1.10 (A:1-118) Putative fructokinase YhdR {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d2ch5a2 c.55.1.5 (A:1-117) N-acetylglucosamine kinase, NAGK {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q18a1 c.55.1.7 (A:2-111) Glucokinase Glk {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1sz2a1 c.55.1.7 (A:3-321) Glucokinase Glk {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1huxa_ c.55.1.5 (A:) Hydroxyglutaryl-CoA dehydratase component A {Acidaminococcus fermentans [TaxId: 905]} | Back information, alignment and structure |
|---|
| >d2ewsa1 c.55.1.14 (A:1-267) Type II pantothenate kinase, CoaW {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1bdga1 c.55.1.3 (A:13-222) Hexokinase {Blood fluke (Schistosoma mansoni) [TaxId: 6183]} | Back information, alignment and structure |
|---|
| >d1e4ft1 c.55.1.1 (T:7-199) Cell division protein FtsA {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1czan3 c.55.1.3 (N:466-670) Mammalian type I hexokinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ig8a1 c.55.1.3 (A:18-224) Hexokinase {Baker's yeast (Saccharomyces cerevisiae), pII [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1saza1 c.55.1.2 (A:1-172) butyrate kinase 2 {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1v4sa1 c.55.1.3 (A:14-218) Glucokinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3bexa1 c.55.1.13 (A:1-118) Type III pantothenate kinase, CoaX {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1czan1 c.55.1.3 (N:16-222) Mammalian type I hexokinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t6ca1 c.55.1.8 (A:7-132) Exopolyphosphatase Ppx {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1u6za2 c.55.1.8 (A:12-135) Exopolyphosphatase Ppx {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1zbsa2 c.55.1.5 (A:1-107) Hypothetical protein PG1100 {Porphyromonas gingivalis [TaxId: 837]} | Back information, alignment and structure |
|---|
| >d1nbwa2 c.55.1.6 (A:2-91,A:257-405) ATPase domain of the glycerol dehydratase reactivase alpha subunit {Klebsiella pneumoniae [TaxId: 573]} | Back information, alignment and structure |
|---|
| >d2e1za1 c.55.1.2 (A:4-192) Propionate kinase {Salmonella typhimurium [TaxId: 90371]} | Back information, alignment and structure |
|---|
| >d3bzka5 c.55.3.13 (A:325-473) Transcriptional accessory factor Tex {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d1g99a1 c.55.1.2 (A:1-197) Acetate kinase {Archaeon Methanosarcina thermophila [TaxId: 2210]} | Back information, alignment and structure |
|---|
| >d2f9wa2 c.55.1.13 (A:1-114) Type III pantothenate kinase, CoaX {Pseudomonas aeruginosa [TaxId: 287]} | Back information, alignment and structure |
|---|
| >d2d0oa2 c.55.1.6 (A:1-92,A:255-403) Diol dehydratase-reactivating factor large subunit DdrA {Klebsiella oxytoca [TaxId: 571]} | Back information, alignment and structure |
|---|
| >d1bupa1 c.55.1.1 (A:4-188) Heat shock protein 70kDa, ATPase fragment {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1okja1 c.55.1.9 (A:1-106) Hypothetical protein YeaZ {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1dkgd1 c.55.1.1 (D:3-185) Heat shock protein 70kDa, ATPase fragment {Escherichia coli, gene dnaK [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1jcea1 c.55.1.1 (A:4-140) Prokaryotic actin homolog MreB {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1nu0a_ c.55.3.8 (A:) Hypothetical protein YqgF (RuvX) {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1iv0a_ c.55.3.8 (A:) Hypothetical protein, YqgF homologue {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|