Psyllid ID: psy9395

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------
MLFKSKFDVIVVGGGHAGTEAALVSARMGQKTLLLSHNIDTIGQMSCNPSIGGIGKSHLVKEIDAMGGIMAIATDKSGIQFRILNSSKGAAVRATRAQVDRILYKQAIRFYLENQLNLYLFQEEVDDLIIKTNKILGVVTKIGIKFFSKTVILTTGTFLNGKIHIGLKSYSAGRFGDFSTTSLAKRLKELQLSHGRLKTGTPPRIDKRTIDFSKMEEQIGDFDPVPVFSVLGNINLHPKQLSCFITHTNEKTHNIIRSEFKNSPIFSGKIESIGPRYCPSIEDKVYRFPKKKSHHIFLEPEGIVINEYYPNGISTSLPFEAQIELVQSIDGMKNANIIRPGYAIEYDYFNPCNLKSSLETKQIHGLFFAGQINGTTGYEEAASQGLLAGLNAALFSQDRDPWIPGRDQAYLGVLVDDLITKGIQEPYRMFTSRAEYRLNLREDNADLRLTEIGWKLGCVSYKQWKIFEKKREIITKELQRLKDTWINPSILNTGESERVLGKRIKHEYSLSNLLTWPNVNYNTLTSLKGINGKNLYNTEIYQEDIKKQLKIQLQYEGYILRQINEVEKNKINENLKLPHNLDYMKIQSLSIEARQKLNKYKPETIGQASRISGVTPAALTLLLIYLKSGFLKNFIKK
cccccccEEEEEcccHHHHHHHHHHHHccccEEEEcccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHcccccEEEEcccEEEEEEccEEEEEEEccccEEEccEEEEccccccccEEEEEcccccccccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccccccccEEccccccccccccccccccccccccccccccccccccEEEccccccccHHHHHHHHHHccccccccEEEccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccccccccccccccEEEEEcccccccccccccccHHHHHHHHHHcccccccccHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHcccccccccHHHHHccccccHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHcccccHHHHcccccccHHHHHHHHHHHHcccccHHHcc
ccccccccEEEEcccHHHHHHHHHHHHccccEEEEEEcHHHHcccccccccccccccHHHHHHHHHHHHHHHHHHHcccEEEEEEccccHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHEEEEccEEEEEEEEcEEEEEEcEEEEEEccccccEEEEEcccccccccccHHHHHHHHHHHHcccccccccccccccccccEEEccHEEccccccccccEEEEcccHHHccccccEEEEEccHHHHHHHHccccccccccEEEEccccccccccHHHEEEEccccccEEEEccccccccEEccccccccccHHHHHHHHHHcccccccEEEccccEEEEEcccHccccccHHHHccccEEEEccccccccHHHHHHHHHHHHHHHHHHHccccccccccccEEEEEEEHHHHHcccccccEEEccHHHHHHHHHHccccccccHHHcEcccccHHHHHHHHHHHHHHHHHHHHHHHcEcccccHHHHHHHHHHcccccHHccHHHHHccccccHHHHHHccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHccccHHHHHcccccccHHHHHHHHHHHHHccHHHHccc
MLFKSKFDVIVVGGGHAGTEAALVSARMGQKTLLLSHnidtigqmscnpsiggigksHLVKEIDAMGGIMAIATDKSGIQFRILNSSKGAAVRATRAQVDRILYKQAIRFYLENQLNLYLFQEEVDDLIIKTNKILGVVTKIGIKFFSKTVIlttgtflngkihiglksysagrfgdfsTTSLAKRLKELQLshgrlktgtppridkrtidfskmeeqigdfdpvpvfsvlgninlhpkqLSCFIThtnekthniirsefknspifsgkiesigprycpsiedkvyrfpkkkshhiflepegivineyypngistslpFEAQIELVQSIdgmknaniirpgyaieydyfnpcnlkssletKQIHGLFfagqingttgYEEAASQGLLAGLNAalfsqdrdpwipgrdqaYLGVLVDDLItkgiqepyrMFTSRAEYRLNLREDNADLRLTEIGWKLGCVSYKQWKIFEKKREIITKELQRLKdtwinpsilntgeSERVLGKRIKHEYslsnlltwpnvnyntltslkgingknlynteIYQEDIKKQLKIQLQYEGYILRQINEVEKNKinenlklphnldymkIQSLSIEARQKLnkykpetigqasrisgvtPAALTLLLIYLKSGFLKNFIKK
MLFKSKFDVIVVGGGHAGTEAALVSARMGQKTLLLSHNIDTIGQMSCNPSIGGIGKSHLVKEIDAMGGIMAIATDKSGIQFRILNSSKGAAVRATRAQVDRILYKQAIRFYLENQLNLYLFQEEVDDLIIKTNKILGVVTKIGIKFFSKTVILTTGTFLNGKIHIGLKSYSAGRFGDFSTTSLAKRLKElqlshgrlktgtppridkRTIDFSKMEEQIGDFDPVPVFSVLGNINLHPKQLSCFITHTNEKThniirsefknspifsgkiesigprycpSIEDKVYRFPKKKSHHIFLEPEGIVINEYYPNGISTSLPFEAQIELVQSIDGMKNANIIRPGYAIEYDYFNPCNLKSSLETKQIHGLFFAGQINGTTGYEEAASQGLLAGLNAALFSQDRDPWIPGRDQAYLGVLVDDLITKGIQEPYRMFTSRAEYRLNLREDNADLRLTEIGWKLGCVSYKQWKIFEKKREIITKELqrlkdtwinpsilntgeserVLGKRIKHEYSlsnlltwpnvNYNTLTSLKGINGKNLYNTEIYQEDIKKQLKIQLQYEGYILRQINEVEKNKINENLKLPHNLDYMKIQSLSIEARQKLNKYKPetigqasrisgvTPAALTLLLIYlksgflknfikk
MLFKSKFDVIVVGGGHAGTEAALVSARMGQKTLLLSHNIDTIGQMSCNPSIGGIGKSHLVKEIDAMGGIMAIATDKSGIQFRILNSSKGAAVRATRAQVDRILYKQAIRFYLENQLNLYLFQEEVDDLIIKTNKILGVVTKIGIKFFSKTVILTTGTFLNGKIHIGLKSYSAGRFGDFSTTSLAKRLKELQLSHGRLKTGTPPRIDKRTIDFSKMEEQIGDFDPVPVFSVLGNINLHPKQLSCFITHTNEKTHNIIRSEFKNSPIFSGKIESIGPRYCPSIEDKVYRFPKKKSHHIFLEPEGIVINEYYPNGISTSLPFEAQIELVQSIDGMKNANIIRPGYAIEYDYFNPCNLKSSLETKQIHGLFFAGQINGTTGYEEAASQGLLAGLNAALFSQDRDPWIPGRDQAYLGVLVDDLITKGIQEPYRMFTSRAEYRLNLREDNADLRLTEIGWKLGCVSYKQWKIFEKKREIITKELQRLKDTWINPSILNTGESERVLGKRIKHEYSLSNLLTWPNVNYNTLTSLKGINGKNLYNTEIYQEDIKKQLKIQLQYEGYILRQineveknkinenlklPHNLDYMKIQSLSIEARQKLNKYKPETIGQASRISGVTPAALTLLLIYLKSGFLKNFIKK
*****KFDVIVVGGGHAGTEAALVSARMGQKTLLLSHNIDTIGQMSCNPSIGGIGKSHLVKEIDAMGGIMAIATDKSGIQFRILNSSKGAAVRATRAQVDRILYKQAIRFYLENQLNLYLFQEEVDDLIIKTNKILGVVTKIGIKFFSKTVILTTGTFLNGKIHIGLKSYSAGRFGDFSTTSLAKRL**********************IDFSKMEEQIGDFDPVPVFSVLGNINLHPKQLSCFITHTNEKTHNIIRSEFKNSPIFSGKIESIGPRYCPSIEDKVYRFPKKKSHHIFLEPEGIVINEYYPNGISTSLPFEAQIELVQSIDGMKNANIIRPGYAIEYDYFNPCNLKSSLETKQIHGLFFAGQINGTTGYEEAASQGLLAGLNAALFSQDRDPWIPGRDQAYLGVLVDDLITKGIQEPYRMFTSRAEYRLNLREDNADLRLTEIGWKLGCVSYKQWKIFEKKREIITKELQRLKDTWINPSILNTGESERVLGKRIKHEYSLSNLLTWPNVNYNTLTSLKGINGKNLYNTEIYQEDIKKQLKIQLQYEGYILRQINEVEKNKINENLKLPHNLDYMKIQSLSIEARQKLNKYKPETIGQASRISGVTPAALTLLLIYLKSGFLKNFI**
*LFKSKFDVIVVGGGHAGTEAALVSARMGQKTLLLSHNIDTIGQMSCNPSIGGIGKSHLVKEIDAMGGIMAIATDKSGIQFRILNSSKGAAVRATRAQVDRILYKQAIRFYLENQLNLYLFQEEVDDLIIKTNKILGVVTKIGIKFFSKTVILTTGTFLNGKIHIGLKSYSAGRFGDFSTTSLAKRLKELQLSHGRLKTGTPPRIDKRTIDFSKMEEQIGDFDPVPVFSVLGNINLHPKQLSCFITHTNEKTHNIIRSEFKNSPIFSGKIESIGPRYCPSIEDKVYRFPKKKSHHIFLEPEGIVINEYYPNGISTSLPFEAQIELVQSIDGMKNANIIRPGYAIEYDYFNPCNLKSSLETKQIHGLFFAGQINGTTGYEEAASQGLLAGLNAALFSQDRDPWIPGRDQAYLGVLVDDLITKGIQEPYRMFTSRAEYRLNLREDNADLRLTEIGWKLGCVSYKQWKIFEKKREIITKELQRLKDTWINPSILNTG***********H*YSLSNLLTWPNVNYNTLTSLKGINGKNLYNTEIYQEDIKKQLKIQLQYEGYILRQINEVEKNKINENLKLPHNLDYMKIQSLSIEARQKLNKYKPETIGQASRISGVTPAALTLLLIYL***********
MLFKSKFDVIVVGGGHAGTEAALVSARMGQKTLLLSHNIDTIGQMSCNPSIGGIGKSHLVKEIDAMGGIMAIATDKSGIQFRILNSSKGAAVRATRAQVDRILYKQAIRFYLENQLNLYLFQEEVDDLIIKTNKILGVVTKIGIKFFSKTVILTTGTFLNGKIHIGLKSYSAGRFGDFSTTSLAKRLKELQLSHGRLKTGTPPRIDKRTIDFSKMEEQIGDFDPVPVFSVLGNINLHPKQLSCFITHTNEKTHNIIRSEFKNSPIFSGKIESIGPRYCPSIEDKVYRFPKKKSHHIFLEPEGIVINEYYPNGISTSLPFEAQIELVQSIDGMKNANIIRPGYAIEYDYFNPCNLKSSLETKQIHGLFFAGQINGTTGYEEAASQGLLAGLNAALFSQDRDPWIPGRDQAYLGVLVDDLITKGIQEPYRMFTSRAEYRLNLREDNADLRLTEIGWKLGCVSYKQWKIFEKKREIITKELQRLKDTWINPSILNTGESERVLGKRIKHEYSLSNLLTWPNVNYNTLTSLKGINGKNLYNTEIYQEDIKKQLKIQLQYEGYILRQINEVEKNKINENLKLPHNLDYMKIQSLSIEARQKLNKYKPETIGQASRISGVTPAALTLLLIYLKSGFLKNFIKK
*LFKSKFDVIVVGGGHAGTEAALVSARMGQKTLLLSHNIDTIGQMSCNPSIGGIGKSHLVKEIDAMGGIMAIATDKSGIQFRILNSSKGAAVRATRAQVDRILYKQAIRFYLENQLNLYLFQEEVDDLIIKTNKILGVVTKIGIKFFSKTVILTTGTFLNGKIHIGLKSYSAGRFGDFSTTSLAKRLKELQLSHGRLKTGTPPRIDKRTIDFSKMEEQIGDFDPVPVFSVLGNINLHPKQLSCFITHTNEKTHNIIRSEFKNSPIFSGKIESIGPRYCPSIEDKVYRFPKKKSHHIFLEPEGIVINEYYPNGISTSLPFEAQIELVQSIDGMKNANIIRPGYAIEYDYFNPCNLKSSLETKQIHGLFFAGQINGTTGYEEAASQGLLAGLNAALFSQDRDPWIPGRDQAYLGVLVDDLITKGIQEPYRMFTSRAEYRLNLREDNADLRLTEIGWKLGCVSYKQWKIFEKKREIITKELQRLKDTWINPSILNTGESERVLGKRIKHEYSLSNLLTWPNVNYNTLTSLKGINGKNLYNTEIYQEDIKKQLKIQLQYEGYILRQINEVEKNKINENLKLPHNLDYMKIQSLSIEARQKLNKYKPETIGQASRISGVTPAALTLLLIYLKSGFLK*****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLFKSKFDVIVVGGGHAGTEAALVSARMGQKTLLLSHNIDTIGQMSCNPSIGGIGKSHLVKEIDAMGGIMAIATDKSGIQFRILNSSKGAAVRATRAQVDRILYKQAIRFYLENQLNLYLFQEEVDDLIIKTNKILGVVTKIGIKFFSKTVILTTGTFLNGKIHIGLKSYSAGRFGDFSTTSLAKRLKELQLSHGRLKTGTPPRIDKRTIDFSKMEEQIGDFDPVPVFSVLGNINLHPKQLSCFITHTNEKTHNIIRSEFKNSPIFSGKIESIGPRYCPSIEDKVYRFPKKKSHHIFLEPEGIVINEYYPNGISTSLPFEAQIELVQSIDGMKNANIIRPGYAIEYDYFNPCNLKSSLETKQIHGLFFAGQINGTTGYEEAASQGLLAGLNAALFSQDRDPWIPGRDQAYLGVLVDDLITKGIQEPYRMFTSRAEYRLNLREDNADLRLTEIGWKLGCVSYKQWKIFEKKREIITKELQRLKDTWINPSILNTGESERVLGKRIKHEYSLSNLLTWPNVNYNTLTSLKGINGKNLYNTEIYQEDIKKQLKIQLQYEGYILRQINEVEKNKINENLKLPHNLDYMKIQSLSIEARQKLNKYKPETIGQASRISGVTPAALTLLLIYLKSGFLKNFIKK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query637 2.2.26 [Sep-21-2011]
A6T482645 tRNA uridine 5-carboxymet yes N/A 0.995 0.982 0.682 0.0
A4GAI2645 tRNA uridine 5-carboxymet yes N/A 0.995 0.982 0.670 0.0
B2JJL1652 tRNA uridine 5-carboxymet yes N/A 0.989 0.966 0.642 0.0
B1YQK2656 tRNA uridine 5-carboxymet yes N/A 0.984 0.955 0.649 0.0
A0K2X0656 tRNA uridine 5-carboxymet yes N/A 0.984 0.955 0.649 0.0
Q1BR97656 tRNA uridine 5-carboxymet yes N/A 0.984 0.955 0.649 0.0
Q0BJM8656 tRNA uridine 5-carboxymet yes N/A 0.984 0.955 0.649 0.0
B1K1K2656 tRNA uridine 5-carboxymet yes N/A 0.984 0.955 0.649 0.0
B4E581656 tRNA uridine 5-carboxymet yes N/A 0.984 0.955 0.649 0.0
Q39KY9656 tRNA uridine 5-carboxymet yes N/A 0.984 0.955 0.647 0.0
>sp|A6T482|MNMG_JANMA tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG OS=Janthinobacterium sp. (strain Marseille) GN=mnmG PE=3 SV=1 Back     alignment and function desciption
 Score =  949 bits (2453), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/634 (68%), Positives = 537/634 (84%)

Query: 1   MLFKSKFDVIVVGGGHAGTEAALVSARMGQKTLLLSHNIDTIGQMSCNPSIGGIGKSHLV 60
           M+F +KFDVIVVGGGHAGTEAAL SARMGQ TLLLSHNI+T+GQMSCNPSIGGIGK HLV
Sbjct: 1   MIFPTKFDVIVVGGGHAGTEAALASARMGQSTLLLSHNIETLGQMSCNPSIGGIGKGHLV 60

Query: 61  KEIDAMGGIMAIATDKSGIQFRILNSSKGAAVRATRAQVDRILYKQAIRFYLENQLNLYL 120
           KE+DAMGG MAIATD++GIQFRILNSSKG AVRATRAQ DRILYKQAIR  LENQ NL+L
Sbjct: 61  KEVDAMGGAMAIATDEAGIQFRILNSSKGPAVRATRAQADRILYKQAIRSRLENQPNLWL 120

Query: 121 FQEEVDDLIIKTNKILGVVTKIGIKFFSKTVILTTGTFLNGKIHIGLKSYSAGRFGDFST 180
           FQ+ VDDL+++ ++++G VT++GIKF+++ V+LT GTFL+GKIH+GL +YSAGR GD   
Sbjct: 121 FQQAVDDLLVEGDRVIGAVTQVGIKFYARAVVLTAGTFLDGKIHVGLNNYSAGRAGDPPA 180

Query: 181 TSLAKRLKELQLSHGRLKTGTPPRIDKRTIDFSKMEEQIGDFDPVPVFSVLGNINLHPKQ 240
            SL+ RLKEL+L  GRLKTGTPPRID R+IDFS M+EQ GD DP+PVFSV+G++ +HPKQ
Sbjct: 181 ISLSARLKELKLPQGRLKTGTPPRIDGRSIDFSVMQEQPGDLDPIPVFSVMGSVAMHPKQ 240

Query: 241 LSCFITHTNEKTHNIIRSEFKNSPIFSGKIESIGPRYCPSIEDKVYRFPKKKSHHIFLEP 300
           + C+ITHTNEKTH++IRS    SP+++G IE +GPRYCPSIEDK++RF  K SH IFLEP
Sbjct: 241 MPCWITHTNEKTHDLIRSGLDRSPMYTGVIEGVGPRYCPSIEDKIHRFAGKDSHQIFLEP 300

Query: 301 EGIVINEYYPNGISTSLPFEAQIELVQSIDGMKNANIIRPGYAIEYDYFNPCNLKSSLET 360
           EG+  NE+YPNGISTSLPF+ Q+ LVQS+ G+++A+I+RPGYAIEYDYF+P  LKS+LET
Sbjct: 301 EGLTTNEFYPNGISTSLPFDIQLALVQSMRGLEHAHILRPGYAIEYDYFDPRGLKSTLET 360

Query: 361 KQIHGLFFAGQINGTTGYEEAASQGLLAGLNAALFSQDRDPWIPGRDQAYLGVLVDDLIT 420
           K I GLFFAGQINGTTGYEEAA+QG+LAG+NAAL +Q+RD W P RD+AYLGV+VDDLIT
Sbjct: 361 KVIQGLFFAGQINGTTGYEEAAAQGMLAGINAALQTQERDAWTPRRDEAYLGVMVDDLIT 420

Query: 421 KGIQEPYRMFTSRAEYRLNLREDNADLRLTEIGWKLGCVSYKQWKIFEKKREIITKELQR 480
           KG+ EPYRMFTSRAEYRL+LREDNAD+RLTEIG +LGCV   QW +FE KRE + +EL+R
Sbjct: 421 KGVLEPYRMFTSRAEYRLSLREDNADMRLTEIGRQLGCVGDAQWAVFETKREAVARELER 480

Query: 481 LKDTWINPSILNTGESERVLGKRIKHEYSLSNLLTWPNVNYNTLTSLKGINGKNLYNTEI 540
           L+ TW++P IL   E+ERVLGK I+ EY+L++LL  PNV+Y TL SLKG++G++L    +
Sbjct: 481 LRSTWVSPRILAEAEAERVLGKGIEREYALADLLRRPNVSYETLMSLKGVDGQDLAGPGV 540

Query: 541 YQEDIKKQLKIQLQYEGYILRQINEVEKNKINENLKLPHNLDYMKIQSLSIEARQKLNKY 600
            ++ +++Q++IQL+Y GYI RQ  EVE++   ENLKLP   DYM+++ LS E RQKL K+
Sbjct: 541 AEDAVREQVEIQLKYAGYIDRQAKEVERHDYYENLKLPQEFDYMEVKGLSFEVRQKLCKH 600

Query: 601 KPETIGQASRISGVTPAALTLLLIYLKSGFLKNF 634
           KPET+GQASRISGVTPAA++LLL++LK G  K F
Sbjct: 601 KPETLGQASRISGVTPAAISLLLVHLKKGGFKEF 634
NAD-binding protein involved in the addition of a carboxymethylaminomethyl (cmnm) group at the wobble position (U34) of certain tRNAs, forming tRNA-cmnm(5)s(2)U34.
Janthinobacterium sp. (strain Marseille) (taxid: 375286)
>sp|A4GAI2|MNMG_HERAR tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG OS=Herminiimonas arsenicoxydans GN=mnmG PE=3 SV=2 Back     alignment and function description
>sp|B2JJL1|MNMG_BURP8 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=mnmG PE=3 SV=1 Back     alignment and function description
>sp|B1YQK2|MNMG_BURA4 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG OS=Burkholderia ambifaria (strain MC40-6) GN=mnmG PE=3 SV=1 Back     alignment and function description
>sp|A0K2X0|MNMG_BURCH tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG OS=Burkholderia cenocepacia (strain HI2424) GN=mnmG PE=3 SV=1 Back     alignment and function description
>sp|Q1BR97|MNMG_BURCA tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG OS=Burkholderia cenocepacia (strain AU 1054) GN=mnmG PE=3 SV=1 Back     alignment and function description
>sp|Q0BJM8|MNMG_BURCM tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=mnmG PE=3 SV=1 Back     alignment and function description
>sp|B1K1K2|MNMG_BURCC tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG OS=Burkholderia cenocepacia (strain MC0-3) GN=mnmG PE=3 SV=1 Back     alignment and function description
>sp|B4E581|MNMG_BURCJ tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG OS=Burkholderia cepacia (strain J2315 / LMG 16656) GN=mnmG PE=3 SV=1 Back     alignment and function description
>sp|Q39KY9|MNMG_BURS3 tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG OS=Burkholderia sp. (strain 383) GN=mnmG PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query637
152980753645 tRNA uridine 5-carboxymethylaminomethyl 0.995 0.982 0.682 0.0
340789584641 tRNA uridine 5-carboxymethylaminomethyl 0.995 0.989 0.689 0.0
399020764651 glucose-inhibited division protein A [He 0.993 0.972 0.685 0.0
395760438645 tRNA uridine 5-carboxymethylaminomethyl 0.989 0.976 0.678 0.0
329900649644 tRNA uridine 5-carboxymethylaminomethyl 0.996 0.986 0.672 0.0
205831546645 RecName: Full=tRNA uridine 5-carboxymeth 0.995 0.982 0.670 0.0
445493989643 tRNA uridine 5-carboxymethylaminomethyl 1.0 0.990 0.667 0.0
300314067642 glucose inhibited division GidA protein 0.992 0.984 0.669 0.0
409408580642 glucose inhibited division GidA protein 0.993 0.985 0.669 0.0
398836797641 glucose-inhibited division protein A [He 0.990 0.984 0.673 0.0
>gi|152980753|ref|YP_001355329.1| tRNA uridine 5-carboxymethylaminomethyl modification protein GidA [Janthinobacterium sp. Marseille] gi|166222939|sp|A6T482.1|MNMG_JANMA RecName: Full=tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG; AltName: Full=Glucose-inhibited division protein A gi|151280830|gb|ABR89240.1| glucose inhibited division protein A [Janthinobacterium sp. Marseille] Back     alignment and taxonomy information
 Score =  949 bits (2453), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 433/634 (68%), Positives = 537/634 (84%)

Query: 1   MLFKSKFDVIVVGGGHAGTEAALVSARMGQKTLLLSHNIDTIGQMSCNPSIGGIGKSHLV 60
           M+F +KFDVIVVGGGHAGTEAAL SARMGQ TLLLSHNI+T+GQMSCNPSIGGIGK HLV
Sbjct: 1   MIFPTKFDVIVVGGGHAGTEAALASARMGQSTLLLSHNIETLGQMSCNPSIGGIGKGHLV 60

Query: 61  KEIDAMGGIMAIATDKSGIQFRILNSSKGAAVRATRAQVDRILYKQAIRFYLENQLNLYL 120
           KE+DAMGG MAIATD++GIQFRILNSSKG AVRATRAQ DRILYKQAIR  LENQ NL+L
Sbjct: 61  KEVDAMGGAMAIATDEAGIQFRILNSSKGPAVRATRAQADRILYKQAIRSRLENQPNLWL 120

Query: 121 FQEEVDDLIIKTNKILGVVTKIGIKFFSKTVILTTGTFLNGKIHIGLKSYSAGRFGDFST 180
           FQ+ VDDL+++ ++++G VT++GIKF+++ V+LT GTFL+GKIH+GL +YSAGR GD   
Sbjct: 121 FQQAVDDLLVEGDRVIGAVTQVGIKFYARAVVLTAGTFLDGKIHVGLNNYSAGRAGDPPA 180

Query: 181 TSLAKRLKELQLSHGRLKTGTPPRIDKRTIDFSKMEEQIGDFDPVPVFSVLGNINLHPKQ 240
            SL+ RLKEL+L  GRLKTGTPPRID R+IDFS M+EQ GD DP+PVFSV+G++ +HPKQ
Sbjct: 181 ISLSARLKELKLPQGRLKTGTPPRIDGRSIDFSVMQEQPGDLDPIPVFSVMGSVAMHPKQ 240

Query: 241 LSCFITHTNEKTHNIIRSEFKNSPIFSGKIESIGPRYCPSIEDKVYRFPKKKSHHIFLEP 300
           + C+ITHTNEKTH++IRS    SP+++G IE +GPRYCPSIEDK++RF  K SH IFLEP
Sbjct: 241 MPCWITHTNEKTHDLIRSGLDRSPMYTGVIEGVGPRYCPSIEDKIHRFAGKDSHQIFLEP 300

Query: 301 EGIVINEYYPNGISTSLPFEAQIELVQSIDGMKNANIIRPGYAIEYDYFNPCNLKSSLET 360
           EG+  NE+YPNGISTSLPF+ Q+ LVQS+ G+++A+I+RPGYAIEYDYF+P  LKS+LET
Sbjct: 301 EGLTTNEFYPNGISTSLPFDIQLALVQSMRGLEHAHILRPGYAIEYDYFDPRGLKSTLET 360

Query: 361 KQIHGLFFAGQINGTTGYEEAASQGLLAGLNAALFSQDRDPWIPGRDQAYLGVLVDDLIT 420
           K I GLFFAGQINGTTGYEEAA+QG+LAG+NAAL +Q+RD W P RD+AYLGV+VDDLIT
Sbjct: 361 KVIQGLFFAGQINGTTGYEEAAAQGMLAGINAALQTQERDAWTPRRDEAYLGVMVDDLIT 420

Query: 421 KGIQEPYRMFTSRAEYRLNLREDNADLRLTEIGWKLGCVSYKQWKIFEKKREIITKELQR 480
           KG+ EPYRMFTSRAEYRL+LREDNAD+RLTEIG +LGCV   QW +FE KRE + +EL+R
Sbjct: 421 KGVLEPYRMFTSRAEYRLSLREDNADMRLTEIGRQLGCVGDAQWAVFETKREAVARELER 480

Query: 481 LKDTWINPSILNTGESERVLGKRIKHEYSLSNLLTWPNVNYNTLTSLKGINGKNLYNTEI 540
           L+ TW++P IL   E+ERVLGK I+ EY+L++LL  PNV+Y TL SLKG++G++L    +
Sbjct: 481 LRSTWVSPRILAEAEAERVLGKGIEREYALADLLRRPNVSYETLMSLKGVDGQDLAGPGV 540

Query: 541 YQEDIKKQLKIQLQYEGYILRQINEVEKNKINENLKLPHNLDYMKIQSLSIEARQKLNKY 600
            ++ +++Q++IQL+Y GYI RQ  EVE++   ENLKLP   DYM+++ LS E RQKL K+
Sbjct: 541 AEDAVREQVEIQLKYAGYIDRQAKEVERHDYYENLKLPQEFDYMEVKGLSFEVRQKLCKH 600

Query: 601 KPETIGQASRISGVTPAALTLLLIYLKSGFLKNF 634
           KPET+GQASRISGVTPAA++LLL++LK G  K F
Sbjct: 601 KPETLGQASRISGVTPAAISLLLVHLKKGGFKEF 634

Source: Janthinobacterium sp. Marseille

Species: Janthinobacterium sp. Marseille

Genus: Janthinobacterium

Family: Oxalobacteraceae

Order: Burkholderiales

Class: Betaproteobacteria

Phylum: Proteobacteria

Superkingdom: Bacteria
>gi|340789584|ref|YP_004755049.1| tRNA uridine 5-carboxymethylaminomethyl modification protein gidA [Collimonas fungivorans Ter331] gi|340554851|gb|AEK64226.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA [Collimonas fungivorans Ter331] Back     alignment and taxonomy information
>gi|399020764|ref|ZP_10722889.1| glucose-inhibited division protein A [Herbaspirillum sp. CF444] gi|398093995|gb|EJL84367.1| glucose-inhibited division protein A [Herbaspirillum sp. CF444] Back     alignment and taxonomy information
>gi|395760438|ref|ZP_10441107.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Janthinobacterium lividum PAMC 25724] Back     alignment and taxonomy information
>gi|329900649|ref|ZP_08272541.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Oxalobacteraceae bacterium IMCC9480] gi|327549425|gb|EGF33989.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Oxalobacteraceae bacterium IMCC9480] Back     alignment and taxonomy information
>gi|205831546|sp|A4GAI2.2|MNMG_HERAR RecName: Full=tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG; AltName: Full=Glucose-inhibited division protein A gi|193222447|emb|CAL63519.2| tRNA uridine 5-carboxymethylaminomethyl modification enzyme gidA (Glucose-inhibited division protein A) [Herminiimonas arsenicoxydans] Back     alignment and taxonomy information
>gi|445493989|ref|ZP_21461033.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG [Janthinobacterium sp. HH01] gi|444790150|gb|ELX11697.1| tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG [Janthinobacterium sp. HH01] Back     alignment and taxonomy information
>gi|300314067|ref|YP_003778159.1| glucose inhibited division GidA protein [Herbaspirillum seropedicae SmR1] gi|300076852|gb|ADJ66251.1| glucose inhibited division GidA protein [Herbaspirillum seropedicae SmR1] Back     alignment and taxonomy information
>gi|409408580|ref|ZP_11257015.1| glucose inhibited division GidA protein [Herbaspirillum sp. GW103] gi|386431902|gb|EIJ44730.1| glucose inhibited division GidA protein [Herbaspirillum sp. GW103] Back     alignment and taxonomy information
>gi|398836797|ref|ZP_10594125.1| glucose-inhibited division protein A [Herbaspirillum sp. YR522] gi|398210863|gb|EJM97497.1| glucose-inhibited division protein A [Herbaspirillum sp. YR522] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query637
UNIPROTKB|P0A6U3629 mnmG "protein involved in a tR 0.981 0.993 0.600 3.1e-202
UNIPROTKB|Q8E8A9629 mnmG "tRNA uridine 5-carboxyme 0.981 0.993 0.609 4.5e-201
TIGR_CMR|SO_4758629 SO_4758 "glucose-inhibited div 0.981 0.993 0.609 4.5e-201
UNIPROTKB|Q87TS3630 mnmG "tRNA uridine 5-carboxyme 0.970 0.980 0.612 4.1e-200
UNIPROTKB|Q9KNG4631 mnmG "tRNA uridine 5-carboxyme 0.981 0.990 0.586 4.3e-196
TIGR_CMR|VC_2775631 VC_2775 "glucose inhibited div 0.981 0.990 0.586 4.3e-196
UNIPROTKB|P94613627 mnmG "tRNA uridine 5-carboxyme 0.965 0.980 0.583 7.5e-192
TIGR_CMR|CBU_1924627 CBU_1924 "glucose inhibited di 0.965 0.980 0.583 7.5e-192
UNIPROTKB|Q47U38629 mnmG "tRNA uridine 5-carboxyme 0.981 0.993 0.568 7.9e-188
TIGR_CMR|CPS_5047629 CPS_5047 "glucose inhibited di 0.981 0.993 0.568 7.9e-188
UNIPROTKB|P0A6U3 mnmG "protein involved in a tRNA modification pathway" [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
 Score = 1957 (694.0 bits), Expect = 3.1e-202, P = 3.1e-202
 Identities = 380/633 (60%), Positives = 479/633 (75%)

Query:     1 MLFKSKFDVIVVGGGHAGTEAALVSARMGQKTLLLSHNIDTIGQMSCNPSIGGIGKSHLV 60
             M +   FDVI++GGGHAGTEAA+ +ARMGQ+TLLL+HNIDT+GQMSCNP+IGGIGK HLV
Sbjct:     1 MFYPDPFDVIIIGGGHAGTEAAMAAARMGQQTLLLTHNIDTLGQMSCNPAIGGIGKGHLV 60

Query:    61 KEIDAMGGIMAIATDKSGIQFRILNSSKGAAVRATRAQVDRILYKQAIRFYLENQLNLYL 120
             KE+DA+GG+MA A D++GIQFRILN+SKG AVRATRAQ DR+LY+QA+R  LENQ NL +
Sbjct:    61 KEVDALGGLMAKAIDQAGIQFRILNASKGPAVRATRAQADRVLYRQAVRTALENQPNLMI 120

Query:   121 FQEEVDDLIIKTNKILGVVTKIGIKFFSKTVILTTGTFLNGKIHIGLKSYSAGRFGDFST 180
             FQ+ V+DLI++ ++++G VT++G+KF +K V+LT GTFL+GKIHIGL +YS GR GD  +
Sbjct:   121 FQQAVEDLIVENDRVVGAVTQMGLKFRAKAVVLTVGTFLDGKIHIGLDNYSGGRAGDPPS 180

Query:   181 TSLAKRLKELQLSHGRLKTGTPPRIDKRTIDFSKMEEQIGDFDPVPVFSVLGNINLHPKQ 240
               L++RL+EL L  GRLKTGTPPRID RTIDFS + +Q GD +P+PVFS +GN + HP+Q
Sbjct:   181 IPLSRRLRELPLRVGRLKTGTPPRIDARTIDFSVLAQQHGD-NPMPVFSFMGNASQHPQQ 239

Query:   241 LSCFITHTNEKTHNIIRSEFKNSPIFSGKIESIGPRYCPSIEDKVYRFPKKKSHHIFLEP 300
             + C+ITHTNEKTH++IRS    SP+++G IE +GPRYCPSIEDKV RF  +  H IFLEP
Sbjct:   240 VPCYITHTNEKTHDVIRSNLDRSPMYAGVIEGVGPRYCPSIEDKVMRFADRNQHQIFLEP 299

Query:   301 EGIVINEYYPNGISTSLPFEAQIELVQSIDGMKNANIIRPGYAIEYDYFNPCNLKSSLET 360
             EG+  NE YPNGISTSLPF+ Q+++V+S+ GM+NA I+RPGYAIEYD+F+P +LK +LE+
Sbjct:   300 EGLTSNEIYPNGISTSLPFDVQMQIVRSMQGMENAKIVRPGYAIEYDFFDPRDLKPTLES 359

Query:   361 KQIHGLFFAGQINGTTGYEEAASQGLLAGLNAALFSQDRDPWIPGRDQAYLGVLVDDLIT 420
             K I GLFFAGQINGTTGYEEAA+QGLLAGLNAA  S D++ W P R QAYLGVLVDDL T
Sbjct:   360 KFIQGLFFAGQINGTTGYEEAAAQGLLAGLNAARLSADKEGWAPARSQAYLGVLVDDLCT 419

Query:   421 KGIQEPYRMFTSRAEYRLNLREDNADLRLTEIGWKLGCVSYKQWKIFEKKREIITKELQR 480
              G +EPYRMFTSRAEYRL LREDNADLRLTEIG +LG V  ++W  F +K E I +E QR
Sbjct:   420 LGTKEPYRMFTSRAEYRLMLREDNADLRLTEIGRELGLVDDERWARFNEKLENIERERQR 479

Query:   481 LKDTWINPSILNTGESERVLGKRIKHEYSLSNLLTWPNVNYNTLTSLKGINGKNLYNTEI 540
             LK TW+ PS     E    L   +  E S  +LL  P + Y  LT+L        +   +
Sbjct:   480 LKSTWVTPSAEAAAEVNAHLTAPLSREASGEDLLRRPEMTYEKLTTLTP------FAPAL 533

Query:   541 YQEDIKKQLKIQLQYEGYILRQXXXXXXXXXXXXXXXPHNLDYMKIQSLSIEARQKLNKY 600
               E   +Q++IQ++YEGYI RQ               P  LDY ++  LS E   KLN +
Sbjct:   534 TDEQAAEQVEIQVKYEGYIARQQDEIEKQLRNENTLLPATLDYRQVSGLSNEVIAKLNDH 593

Query:   601 KPETIGQASRISGVTPAALTLLLIYLKS-GFLK 632
             KP +IGQASRISGVTPAA+++LL++LK  G L+
Sbjct:   594 KPASIGQASRISGVTPAAISILLVWLKKQGMLR 626
GO:0002098 "tRNA wobble uridine modification" evidence=IEA
GO:0005737 "cytoplasm" evidence=IEA
GO:0005515 "protein binding" evidence=IPI
GO:0050660 "flavin adenine dinucleotide binding" evidence=IEA;IDA
GO:0030488 "tRNA methylation" evidence=IMP
UNIPROTKB|Q8E8A9 mnmG "tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
TIGR_CMR|SO_4758 SO_4758 "glucose-inhibited division protein A" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
UNIPROTKB|Q87TS3 mnmG "tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG" [Pseudomonas syringae pv. tomato str. DC3000 (taxid:223283)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KNG4 mnmG "tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_2775 VC_2775 "glucose inhibited division protein A" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms
UNIPROTKB|P94613 mnmG "tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG" [Coxiella burnetii RSA 493 (taxid:227377)] Back     alignment and assigned GO terms
TIGR_CMR|CBU_1924 CBU_1924 "glucose inhibited division protein A" [Coxiella burnetii RSA 493 (taxid:227377)] Back     alignment and assigned GO terms
UNIPROTKB|Q47U38 mnmG "tRNA uridine 5-carboxymethylaminomethyl modification enzyme MnmG" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_5047 CPS_5047 "glucose inhibited division protein A" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q2STD7MNMG_BURTANo assigned EC number0.63800.98430.9543yesN/A
Q7WRF1MNMG_BORBRNo assigned EC number0.63530.98430.9812yesN/A
A9AJF1MNMG_BURM1No assigned EC number0.64440.98430.9557yesN/A
A3NF54MNMG_BURP6No assigned EC number0.63800.98430.9543yesN/A
Q8XU65MNMG_RALSONo assigned EC number0.62380.99680.9814yesN/A
B1YQK2MNMG_BURA4No assigned EC number0.64920.98430.9557yesN/A
Q0BJM8MNMG_BURCMNo assigned EC number0.64920.98430.9557yesN/A
A3P104MNMG_BURP0No assigned EC number0.63800.98430.9543yesN/A
Q12HF2MNMG_POLSJNo assigned EC number0.62400.99050.9375yesN/A
B4E581MNMG_BURCJNo assigned EC number0.64920.98430.9557yesN/A
Q3JXU7MNMG_BURP1No assigned EC number0.63650.98430.9543yesN/A
A9IJ48MNMG_BORPDNo assigned EC number0.63850.98430.9812yesN/A
Q1LHJ8MNMG_RALMENo assigned EC number0.63760.98110.9556yesN/A
Q9K1G0MNMG_NEIMBNo assigned EC number0.63960.97950.9936yesN/A
Q1GXL9MNMG_METFKNo assigned EC number0.64430.97330.9779yesN/A
Q2Y5B4MNMG_NITMUNo assigned EC number0.63730.98900.9968yesN/A
A1TI78MNMG_ACIACNo assigned EC number0.62510.99520.9679yesN/A
B9M9W3MNMG_ACIETNo assigned EC number0.63170.98900.9589yesN/A
A1KRM5MNMG_NEIMFNo assigned EC number0.63490.97950.9936yesN/A
Q21QL5MNMG_RHOFDNo assigned EC number0.62670.99520.9337yesN/A
C0Q2P1MNMG_SALPCNo assigned EC number0.61130.98110.9936yesN/A
A1VIB1MNMG_POLNANo assigned EC number0.61600.98900.9445yesN/A
A4GAI2MNMG_HERARNo assigned EC number0.67030.99520.9829yesN/A
Q46VW9MNMG_CUPPJNo assigned EC number0.63600.98110.9674yesN/A
A1V8U3MNMG_BURMSNo assigned EC number0.63800.98430.9543yesN/A
C5CW10MNMG_VARPSNo assigned EC number0.64000.99050.9677yesN/A
A0K2X0MNMG_BURCHNo assigned EC number0.64920.98430.9557yesN/A
B2JJL1MNMG_BURP8No assigned EC number0.64290.98900.9662yesN/A
Q0K5L6MNMG_CUPNHNo assigned EC number0.63600.98110.9585yesN/A
Q7W0T0MNMG_BORPENo assigned EC number0.63370.98430.9812yesN/A
Q39KY9MNMG_BURS3No assigned EC number0.64760.98430.9557yesN/A
Q7W2I1MNMG_BORPANo assigned EC number0.63210.98430.9812yesN/A
Q1BR97MNMG_BURCANo assigned EC number0.64920.98430.9557yesN/A
B1K1K2MNMG_BURCCNo assigned EC number0.64920.98430.9557yesN/A
A1W207MNMG_ACISJNo assigned EC number0.62780.98900.9531yesN/A
B1XYL1MNMG_LEPCPNo assigned EC number0.61100.99520.9255yesN/A
A3MQI7MNMG_BURM7No assigned EC number0.63800.98430.9543yesN/A
A6T482MNMG_JANMANo assigned EC number0.68290.99520.9829yesN/A
A9M3R4MNMG_NEIM0No assigned EC number0.63650.97950.9936yesN/A
A9BQJ1MNMG_DELASNo assigned EC number0.63020.98900.9559yesN/A
A1WGT2MNMG_VEREINo assigned EC number0.60880.99370.9620yesN/A
Q13SP0MNMG_BURXLNo assigned EC number0.62910.99840.9754yesN/A
Q2L2T3MNMG_BORA1No assigned EC number0.63530.98430.9843yesN/A
B2T7L1MNMG_BURPPNo assigned EC number0.63060.99840.9754yesN/A
A4JA22MNMG_BURVGNo assigned EC number0.64760.98430.9557yesN/A
Q7P0A6MNMG_CHRVONo assigned EC number0.62440.98110.9889yesN/A
B2UGW0MNMG_RALPJNo assigned EC number0.62810.99370.9753yesN/A
A2S6L0MNMG_BURM9No assigned EC number0.63800.98430.9543yesN/A
Q62FS8MNMG_BURMANo assigned EC number0.63800.98430.9543yesN/A
Q63PG8MNMG_BURPSNo assigned EC number0.63960.98430.9543yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query637
PRK05192618 PRK05192, PRK05192, tRNA uridine 5-carboxymethylam 0.0
COG0445621 COG0445, GidA, Flavin-dependent tRNA uridine 5-car 0.0
TIGR00136617 TIGR00136, gidA, glucose-inhibited division protei 0.0
pfam01134391 pfam01134, GIDA, Glucose inhibited division protei 0.0
pfam1393272 pfam13932, GIDA_assoc_3, GidA associated domain 3 5e-30
COG1206439 COG1206, Gid, NAD(FAD)-utilizing enzyme possibly i 5e-15
PRK05335436 PRK05335, PRK05335, tRNA (uracil-5-)-methyltransfe 2e-13
TIGR00137433 TIGR00137, gid_trmFO, tRNA:m(5)U-54 methyltransfer 2e-10
COG0644396 COG0644, FixC, Dehydrogenases (flavoproteins) [Ene 1e-06
pfam12831415 pfam12831, FAD_oxidored, FAD dependent oxidoreduct 2e-06
pfam07992283 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulp 3e-06
PRK05329422 PRK05329, PRK05329, anaerobic glycerol-3-phosphate 2e-04
COG1053562 COG1053, SdhA, Succinate dehydrogenase/fumarate re 3e-04
TIGR00137433 TIGR00137, gid_trmFO, tRNA:m(5)U-54 methyltransfer 4e-04
COG2081408 COG2081, COG2081, Predicted flavoproteins [General 5e-04
COG3634520 COG3634, AhpF, Alkyl hydroperoxide reductase, larg 7e-04
PRK15317517 PRK15317, PRK15317, alkyl hydroperoxide reductase 9e-04
PRK05335436 PRK05335, PRK05335, tRNA (uracil-5-)-methyltransfe 0.001
COG1233487 COG1233, COG1233, Phytoene dehydrogenase and relat 0.001
TIGR02032295 TIGR02032, GG-red-SF, geranylgeranyl reductase fam 0.001
COG1206439 COG1206, Gid, NAD(FAD)-utilizing enzyme possibly i 0.002
TIGR03140515 TIGR03140, AhpF, alkyl hydroperoxide reductase sub 0.002
PRK10157428 PRK10157, PRK10157, putative oxidoreductase FixC; 0.002
PRK13800 897 PRK13800, PRK13800, putative oxidoreductase/HEAT r 0.004
pfam03486405 pfam03486, HI0933_like, HI0933-like protein 0.004
>gnl|CDD|235362 PRK05192, PRK05192, tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information 
 Score = 1112 bits (2879), Expect = 0.0
 Identities = 377/622 (60%), Positives = 473/622 (76%), Gaps = 15/622 (2%)

Query: 6   KFDVIVVGGGHAGTEAALVSARMGQKTLLLSHNIDTIGQMSCNPSIGGIGKSHLVKEIDA 65
           ++DVIVVGGGHAG EAAL +ARMG KTLLL+HN+DTIGQMSCNP+IGGI K HLV+EIDA
Sbjct: 4   EYDVIVVGGGHAGCEAALAAARMGAKTLLLTHNLDTIGQMSCNPAIGGIAKGHLVREIDA 63

Query: 66  MGGIMAIATDKSGIQFRILNSSKGAAVRATRAQVDRILYKQAIRFYLENQLNLYLFQEEV 125
           +GG M  A DK+GIQFR+LN+SKG AVRA RAQ DR LY+ A+R  LENQ NL LFQ EV
Sbjct: 64  LGGEMGKAIDKTGIQFRMLNTSKGPAVRALRAQADRKLYRAAMREILENQPNLDLFQGEV 123

Query: 126 DDLIIKTNKILGVVTKIGIKFFSKTVILTTGTFLNGKIHIGLKSYSAGRFGDFSTTSLAK 185
           +DLI++  +++GVVT+ G++F +K V+LTTGTFL GKIHIG K+YS GR G+  +  L++
Sbjct: 124 EDLIVENGRVVGVVTQDGLEFRAKAVVLTTGTFLRGKIHIGEKNYSGGRAGEPPSIGLSE 183

Query: 186 RLKELQLSHGRLKTGTPPRIDKRTIDFSKMEEQIGDFDPVPVFSVLGNINLHPKQLSCFI 245
            L+EL    GRLKTGTPPRID R+IDFSK+EEQ GD DP P FS +    +HP Q+ C+I
Sbjct: 184 SLRELGFELGRLKTGTPPRIDGRSIDFSKLEEQPGD-DPPPPFSFM-TEKIHPPQVPCYI 241

Query: 246 THTNEKTHNIIRSEFKNSPIFSGKIESIGPRYCPSIEDKVYRFPKKKSHHIFLEPEGIVI 305
           T+TNE+TH IIR     SP++SG IE +GPRYCPSIEDK+ RF  K  H IFLEPEG+  
Sbjct: 242 TYTNEETHEIIRENLHRSPMYSGVIEGVGPRYCPSIEDKIVRFADKDRHQIFLEPEGLDT 301

Query: 306 NEYYPNGISTSLPFEAQIELVQSIDGMKNANIIRPGYAIEYDYFNPCNLKSSLETKQIHG 365
           NE YPNGISTSLP + Q+E+++SI G++NA I+RPGYAIEYDY +P  LK +LETK+I G
Sbjct: 302 NEVYPNGISTSLPEDVQLEMLRSIPGLENAEILRPGYAIEYDYVDPRQLKPTLETKKIKG 361

Query: 366 LFFAGQINGTTGYEEAASQGLLAGLNAALFSQDRDPWIPGRDQAYLGVLVDDLITKGIQE 425
           LFFAGQINGTTGYEEAA+QGL+AG+NAAL  Q  +P+I  R +AY+GVL+DDL+TKG +E
Sbjct: 362 LFFAGQINGTTGYEEAAAQGLIAGINAALKVQ-GEPFILKRSEAYIGVLIDDLVTKGTKE 420

Query: 426 PYRMFTSRAEYRLNLREDNADLRLTEIGWKLGCVSYKQWKIFEKKREIITKELQRLKDTW 485
           PYRMFTSRAEYRL LREDNADLRLTE G++LG V  ++W  FE+K+E I +E++RLK T 
Sbjct: 421 PYRMFTSRAEYRLLLREDNADLRLTEKGYELGLVDDERWARFEEKKEAIEEEIERLKSTR 480

Query: 486 INPSILNTGESERVLGKRIKHEYSLSNLLTWPNVNYNTLTSLKGINGKNLYNTEIYQEDI 545
           + P  LN      + G  +K E SL +LL  P + Y  L  L                ++
Sbjct: 481 VTPDELN-----ELGGDPLKREVSLLDLLRRPEITYEDLAKLDPEL-------ADLDPEV 528

Query: 546 KKQLKIQLQYEGYILRQINEVEKNKINENLKLPHNLDYMKIQSLSIEARQKLNKYKPETI 605
            +Q++I+++YEGYI RQ  E+EK K  EN K+P ++DY  I  LS EAR+KLNK +PETI
Sbjct: 529 AEQVEIEIKYEGYIERQQEEIEKLKRLENKKIPEDIDYDAISGLSNEAREKLNKIRPETI 588

Query: 606 GQASRISGVTPAALTLLLIYLK 627
           GQASRISGVTPA +++LL+YLK
Sbjct: 589 GQASRISGVTPADISILLVYLK 610

Length = 618
>gnl|CDD|223522 COG0445, GidA, Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>gnl|CDD|129242 TIGR00136, gidA, glucose-inhibited division protein A Back     alignment and domain information
>gnl|CDD|216319 pfam01134, GIDA, Glucose inhibited division protein A Back     alignment and domain information
>gnl|CDD|206103 pfam13932, GIDA_assoc_3, GidA associated domain 3 Back     alignment and domain information
>gnl|CDD|224127 COG1206, Gid, NAD(FAD)-utilizing enzyme possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|235416 PRK05335, PRK05335, tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>gnl|CDD|129243 TIGR00137, gid_trmFO, tRNA:m(5)U-54 methyltransferase Back     alignment and domain information
>gnl|CDD|223717 COG0644, FixC, Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|221798 pfam12831, FAD_oxidored, FAD dependent oxidoreductase Back     alignment and domain information
>gnl|CDD|219686 pfam07992, Pyr_redox_2, Pyridine nucleotide-disulphide oxidoreductase Back     alignment and domain information
>gnl|CDD|235412 PRK05329, PRK05329, anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>gnl|CDD|223981 COG1053, SdhA, Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|129243 TIGR00137, gid_trmFO, tRNA:m(5)U-54 methyltransferase Back     alignment and domain information
>gnl|CDD|224992 COG2081, COG2081, Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>gnl|CDD|226160 COG3634, AhpF, Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|237942 PRK15317, PRK15317, alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>gnl|CDD|235416 PRK05335, PRK05335, tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>gnl|CDD|224154 COG1233, COG1233, Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|233693 TIGR02032, GG-red-SF, geranylgeranyl reductase family Back     alignment and domain information
>gnl|CDD|224127 COG1206, Gid, NAD(FAD)-utilizing enzyme possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|234119 TIGR03140, AhpF, alkyl hydroperoxide reductase subunit F Back     alignment and domain information
>gnl|CDD|182273 PRK10157, PRK10157, putative oxidoreductase FixC; Provisional Back     alignment and domain information
>gnl|CDD|237512 PRK13800, PRK13800, putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|217590 pfam03486, HI0933_like, HI0933-like protein Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 637
COG0445621 GidA Flavin-dependent tRNA uridine 5-carboxymethyl 100.0
KOG2311|consensus679 100.0
PRK05192618 tRNA uridine 5-carboxymethylaminomethyl modificati 100.0
TIGR00136617 gidA glucose-inhibited division protein A. GidA, t 100.0
PF01134392 GIDA: Glucose inhibited division protein A; InterP 100.0
TIGR00137433 gid_trmFO tRNA:m(5)U-54 methyltransferase. This mo 100.0
PRK05335436 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 100.0
COG1206439 Gid NAD(FAD)-utilizing enzyme possibly involved in 100.0
COG2081408 Predicted flavoproteins [General function predicti 100.0
PF03486409 HI0933_like: HI0933-like protein; InterPro: IPR004 100.0
TIGR00275400 flavoprotein, HI0933 family. The model when search 99.96
PF1393272 GIDA_assoc_3: GidA associated domain 3; PDB: 3CES_ 99.96
TIGR03862376 flavo_PP4765 uncharacterized flavoprotein, PP_4765 99.93
PRK06481506 fumarate reductase flavoprotein subunit; Validated 99.65
PRK06452566 sdhA succinate dehydrogenase flavoprotein subunit; 99.65
PRK09078598 sdhA succinate dehydrogenase flavoprotein subunit; 99.65
PTZ00139617 Succinate dehydrogenase [ubiquinone] flavoprotein 99.64
TIGR00551488 nadB L-aspartate oxidase. L-aspartate oxidase is t 99.64
PRK08626657 fumarate reductase flavoprotein subunit; Provision 99.63
PRK06175433 L-aspartate oxidase; Provisional 99.63
PRK06854608 adenylylsulfate reductase subunit alpha; Validated 99.63
PRK06069577 sdhA succinate dehydrogenase flavoprotein subunit; 99.63
PRK08401466 L-aspartate oxidase; Provisional 99.63
PRK08274466 tricarballylate dehydrogenase; Validated 99.62
PRK09231582 fumarate reductase flavoprotein subunit; Validated 99.62
PRK07573640 sdhA succinate dehydrogenase flavoprotein subunit; 99.62
COG0029518 NadB Aspartate oxidase [Coenzyme metabolism] 99.62
PRK07803626 sdhA succinate dehydrogenase flavoprotein subunit; 99.62
PRK05945575 sdhA succinate dehydrogenase flavoprotein subunit; 99.62
PRK06263543 sdhA succinate dehydrogenase flavoprotein subunit; 99.62
PLN00128635 Succinate dehydrogenase [ubiquinone] flavoprotein 99.62
PRK07512513 L-aspartate oxidase; Provisional 99.61
TIGR01176580 fum_red_Fp fumarate reductase, flavoprotein subuni 99.61
PRK07121492 hypothetical protein; Validated 99.6
PRK07395553 L-aspartate oxidase; Provisional 99.6
TIGR01812566 sdhA_frdA_Gneg succinate dehydrogenase or fumarate 99.6
PRK13800 897 putative oxidoreductase/HEAT repeat-containing pro 99.6
PRK07057591 sdhA succinate dehydrogenase flavoprotein subunit; 99.6
PRK08958588 sdhA succinate dehydrogenase flavoprotein subunit; 99.59
PRK08205583 sdhA succinate dehydrogenase flavoprotein subunit; 99.59
COG1053562 SdhA Succinate dehydrogenase/fumarate reductase, f 99.59
PRK08071510 L-aspartate oxidase; Provisional 99.58
PRK07804541 L-aspartate oxidase; Provisional 99.58
PRK08275554 putative oxidoreductase; Provisional 99.57
PRK09077536 L-aspartate oxidase; Provisional 99.57
PRK08641589 sdhA succinate dehydrogenase flavoprotein subunit; 99.57
COG2509486 Uncharacterized FAD-dependent dehydrogenases [Gene 99.56
PLN02815594 L-aspartate oxidase 99.56
TIGR01811603 sdhA_Bsu succinate dehydrogenase or fumarate reduc 99.54
TIGR02061614 aprA adenosine phosphosulphate reductase, alpha su 99.52
KOG2820|consensus399 99.5
COG0492305 TrxB Thioredoxin reductase [Posttranslational modi 99.5
PTZ003061167 NADH-dependent fumarate reductase; Provisional 99.49
PRK12844557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 99.48
PRK14694468 putative mercuric reductase; Provisional 99.47
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 99.46
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 99.44
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy produc 99.44
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductas 99.41
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 99.4
PRK06116450 glutathione reductase; Validated 99.4
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 99.4
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 99.37
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 99.37
PRK13748561 putative mercuric reductase; Provisional 99.37
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 99.36
PRK06370463 mercuric reductase; Validated 99.35
PRK06327475 dihydrolipoamide dehydrogenase; Validated 99.35
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 99.34
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 99.33
PLN02507499 glutathione reductase 99.32
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 99.3
PRK10262321 thioredoxin reductase; Provisional 99.3
PRK10157428 putative oxidoreductase FixC; Provisional 99.3
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 99.29
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 99.29
PRK14727479 putative mercuric reductase; Provisional 99.28
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 99.28
PLN02546558 glutathione reductase 99.28
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 99.27
PF00890417 FAD_binding_2: FAD binding domain of the Pfam fami 99.27
PF01946230 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K. 99.27
TIGR02053463 MerA mercuric reductase. This model represents the 99.26
PF12831428 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 99.26
PTZ00058561 glutathione reductase; Provisional 99.26
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 99.25
PF01266358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 99.25
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 99.25
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, convert 99.24
PRK10015429 oxidoreductase; Provisional 99.22
PRK07494388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 99.21
PRK06292460 dihydrolipoamide dehydrogenase; Validated 99.21
PRK12834549 putative FAD-binding dehydrogenase; Reviewed 99.21
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 99.2
PRK07845466 flavoprotein disulfide reductase; Reviewed 99.2
PLN02661357 Putative thiazole synthesis 99.2
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 99.18
PRK12837513 3-ketosteroid-delta-1-dehydrogenase; Provisional 99.18
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 99.18
PRK06185407 hypothetical protein; Provisional 99.17
PLN02463447 lycopene beta cyclase 99.14
PRK07846451 mycothione reductase; Reviewed 99.13
TIGR01813439 flavo_cyto_c flavocytochrome c. This model describ 99.13
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 99.12
PRK11101546 glpA sn-glycerol-3-phosphate dehydrogenase subunit 99.12
PLN02697529 lycopene epsilon cyclase 99.11
PRK12845564 3-ketosteroid-delta-1-dehydrogenase; Reviewed 99.11
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 99.1
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 99.09
TIGR01790388 carotene-cycl lycopene cyclase family protein. Thi 99.09
PRK07608388 ubiquinone biosynthesis hydroxylase family protein 99.08
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 99.08
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 99.08
PRK06847375 hypothetical protein; Provisional 99.08
TIGR01377380 soxA_mon sarcosine oxidase, monomeric form. Sarcos 99.08
PRK12266508 glpD glycerol-3-phosphate dehydrogenase; Reviewed 99.08
PRK11259376 solA N-methyltryptophan oxidase; Provisional 99.07
PRK11728393 hydroxyglutarate oxidase; Provisional 99.06
PRK12831464 putative oxidoreductase; Provisional 99.06
PRK127751006 putative trifunctional 2-polyprenylphenol hydroxyl 99.04
PRK12835584 3-ketosteroid-delta-1-dehydrogenase; Reviewed 99.03
PRK07045388 putative monooxygenase; Reviewed 99.03
PRK12842574 putative succinate dehydrogenase; Reviewed 99.03
PRK09126392 hypothetical protein; Provisional 99.03
KOG1335|consensus506 99.03
PRK08163396 salicylate hydroxylase; Provisional 99.03
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 99.02
PRK00711416 D-amino acid dehydrogenase small subunit; Validate 99.02
PRK07364415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 99.02
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 99.02
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 99.02
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 99.02
TIGR02023388 BchP-ChlP geranylgeranyl reductase. This model rep 99.02
PRK08013400 oxidoreductase; Provisional 99.01
TIGR01373407 soxB sarcosine oxidase, beta subunit family, heter 99.01
PF01494356 FAD_binding_3: FAD binding domain; InterPro: IPR00 99.01
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 99.01
PRK13369502 glycerol-3-phosphate dehydrogenase; Provisional 99.0
TIGR01984382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 99.0
PRK06134581 putative FAD-binding dehydrogenase; Reviewed 98.99
PRK12839572 hypothetical protein; Provisional 98.99
PRK12779944 putative bifunctional glutamate synthase subunit b 98.99
PLN00093450 geranylgeranyl diphosphate reductase; Provisional 98.98
PRK07190487 hypothetical protein; Provisional 98.98
TIGR01988385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 98.98
TIGR03364365 HpnW_proposed FAD dependent oxidoreductase TIGR033 98.98
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 98.98
PLN02985514 squalene monooxygenase 98.97
PRK12778752 putative bifunctional 2-polyprenylphenol hydroxyla 98.97
PRK12843578 putative FAD-binding dehydrogenase; Reviewed 98.97
PTZ00383497 malate:quinone oxidoreductase; Provisional 98.97
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 98.97
PRK12409410 D-amino acid dehydrogenase small subunit; Provisio 98.97
KOG2404|consensus477 98.96
PRK05976472 dihydrolipoamide dehydrogenase; Validated 98.96
PRK06834488 hypothetical protein; Provisional 98.96
PF05834374 Lycopene_cycl: Lycopene cyclase protein; InterPro: 98.96
TIGR02028398 ChlP geranylgeranyl reductase. This model represen 98.96
TIGR03329460 Phn_aa_oxid putative aminophosphonate oxidoreducta 98.96
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 98.95
TIGR02485432 CobZ_N-term precorrin 3B synthase CobZ. CobZ is es 98.95
PRK05675570 sdhA succinate dehydrogenase flavoprotein subunit; 98.95
PRK11445351 putative oxidoreductase; Provisional 98.95
PRK07843557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 98.94
COG0579429 Predicted dehydrogenase [General function predicti 98.94
KOG1298|consensus509 98.93
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 98.93
PRK098531019 putative selenate reductase subunit YgfK; Provisio 98.92
PRK06184502 hypothetical protein; Provisional 98.92
PLN02464627 glycerol-3-phosphate dehydrogenase 98.92
PRK06183538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 98.91
PRK05868372 hypothetical protein; Validated 98.9
TIGR01816565 sdhA_forward succinate dehydrogenase, flavoprotein 98.9
PRK06126545 hypothetical protein; Provisional 98.89
TIGR01989437 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T 98.87
PRK07236386 hypothetical protein; Provisional 98.87
COG3573552 Predicted oxidoreductase [General function predict 98.86
PRK07588391 hypothetical protein; Provisional 98.85
PTZ00318424 NADH dehydrogenase-like protein; Provisional 98.85
KOG0404|consensus322 98.84
PRK08244493 hypothetical protein; Provisional 98.83
PRK01747662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 98.82
PRK06753373 hypothetical protein; Provisional 98.82
PTZ00367567 squalene epoxidase; Provisional 98.82
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 98.81
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [ 98.81
PF04820454 Trp_halogenase: Tryptophan halogenase; InterPro: I 98.8
PRK08132547 FAD-dependent oxidoreductase; Provisional 98.8
PLN02172461 flavin-containing monooxygenase FMO GS-OX 98.78
PRK05257494 malate:quinone oxidoreductase; Validated 98.77
PRK13339497 malate:quinone oxidoreductase; Reviewed 98.75
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 98.74
TIGR02360390 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. 98.74
PRK06996398 hypothetical protein; Provisional 98.72
PRK06475400 salicylate hydroxylase; Provisional 98.72
COG0578532 GlpA Glycerol-3-phosphate dehydrogenase [Energy pr 98.71
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 98.71
PRK07538413 hypothetical protein; Provisional 98.71
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 98.7
TIGR01320483 mal_quin_oxido malate:quinone-oxidoreductase. This 98.7
PRK08294634 phenol 2-monooxygenase; Provisional 98.69
PTZ00052499 thioredoxin reductase; Provisional 98.68
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 98.67
PTZ00153659 lipoamide dehydrogenase; Provisional 98.64
PRK12814652 putative NADPH-dependent glutamate synthase small 98.62
PRK14989 847 nitrite reductase subunit NirD; Provisional 98.61
PLN02927668 antheraxanthin epoxidase/zeaxanthin epoxidase 98.59
COG1148622 HdrA Heterodisulfide reductase, subunit A and rela 98.58
TIGR03219414 salicylate_mono salicylate 1-monooxygenase. Member 98.57
PF07992201 Pyr_redox_2: Pyridine nucleotide-disulphide oxidor 98.56
KOG2853|consensus509 98.54
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 98.52
TIGR02730493 carot_isom carotene isomerase. Members of this fam 98.5
KOG2614|consensus420 98.5
PF00732296 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR0001 98.49
TIGR01789370 lycopene_cycl lycopene cyclase. This model represe 98.49
TIGR01317485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 98.48
PRK13984604 putative oxidoreductase; Provisional 98.47
COG2072443 TrkA Predicted flavoprotein involved in K+ transpo 98.44
KOG1399|consensus448 98.44
PRK09897534 hypothetical protein; Provisional 98.44
PF13454156 NAD_binding_9: FAD-NAD(P)-binding 98.41
KOG4254|consensus561 98.39
PRK12771564 putative glutamate synthase (NADPH) small subunit; 98.39
KOG4716|consensus503 98.37
TIGR03378419 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase 98.36
KOG2415|consensus621 98.34
KOG2844|consensus 856 98.33
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit 98.33
PF0007080 Pyr_redox: Pyridine nucleotide-disulphide oxidored 98.32
COG3380331 Predicted NAD/FAD-dependent oxidoreductase [Genera 98.32
PRK05329422 anaerobic glycerol-3-phosphate dehydrogenase subun 98.27
PRK07233434 hypothetical protein; Provisional 98.27
COG3075421 GlpB Anaerobic glycerol-3-phosphate dehydrogenase 98.26
PRK13977576 myosin-cross-reactive antigen; Provisional 98.24
PF00743531 FMO-like: Flavin-binding monooxygenase-like; Inter 98.22
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 98.17
TIGR033151012 Se_ygfK putative selenate reductase, YgfK subunit. 98.13
PRK09564444 coenzyme A disulfide reductase; Reviewed 98.12
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 98.1
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 98.08
KOG0405|consensus478 98.08
KOG2852|consensus380 98.05
PRK13512438 coenzyme A disulfide reductase; Provisional 98.04
TIGR01810532 betA choline dehydrogenase. This enzyme is a membe 98.03
PRK08255 765 salicylyl-CoA 5-hydroxylase; Reviewed 98.02
PF06039488 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro 98.01
COG1233487 Phytoene dehydrogenase and related proteins [Secon 98.01
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 97.92
KOG3851|consensus446 97.91
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 97.9
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 97.9
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 97.89
PRK06116450 glutathione reductase; Validated 97.85
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 97.85
PRK05976472 dihydrolipoamide dehydrogenase; Validated 97.85
PLN02785587 Protein HOTHEAD 97.84
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 97.82
PLN02852491 ferredoxin-NADP+ reductase 97.81
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 97.81
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 97.81
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 97.79
PRK065671028 putative bifunctional glutamate synthase subunit b 97.78
PRK12770352 putative glutamate synthase subunit beta; Provisio 97.78
KOG2960|consensus328 97.77
TIGR02374 785 nitri_red_nirB nitrite reductase [NAD(P)H], large 97.77
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 97.75
PTZ00363443 rab-GDP dissociation inhibitor; Provisional 97.74
PRK07208479 hypothetical protein; Provisional 97.72
KOG0042|consensus680 97.7
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 97.69
PRK07845466 flavoprotein disulfide reductase; Reviewed 97.69
TIGR00031377 UDP-GALP_mutase UDP-galactopyranose mutase. The ge 97.69
PLN02507499 glutathione reductase 97.66
TIGR02053463 MerA mercuric reductase. This model represents the 97.66
TIGR02374785 nitri_red_nirB nitrite reductase [NAD(P)H], large 97.65
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 97.64
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 97.63
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 97.62
COG0446415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogen 97.6
PRK07846451 mycothione reductase; Reviewed 97.59
PRK14989 847 nitrite reductase subunit NirD; Provisional 97.59
KOG3855|consensus481 97.58
TIGR03197381 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouri 97.58
PRK06370463 mercuric reductase; Validated 97.58
PLN02576496 protoporphyrinogen oxidase 97.55
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of 97.55
PRK11883451 protoporphyrinogen oxidase; Reviewed 97.54
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 97.53
TIGR02733492 desat_CrtD C-3',4' desaturase CrtD. Members of thi 97.52
PRK06327475 dihydrolipoamide dehydrogenase; Validated 97.52
COG4529474 Uncharacterized protein conserved in bacteria [Fun 97.52
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 97.52
KOG0029|consensus501 97.51
PRK09564444 coenzyme A disulfide reductase; Reviewed 97.51
TIGR02734502 crtI_fam phytoene desaturase. Phytoene is converte 97.49
TIGR00562462 proto_IX_ox protoporphyrinogen oxidase. This prote 97.47
PRK14727479 putative mercuric reductase; Provisional 97.46
PRK13512438 coenzyme A disulfide reductase; Provisional 97.46
PRK14694468 putative mercuric reductase; Provisional 97.43
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 97.42
PTZ00052499 thioredoxin reductase; Provisional 97.42
PTZ00058561 glutathione reductase; Provisional 97.41
PLN02676487 polyamine oxidase 97.41
PLN02268435 probable polyamine oxidase 97.38
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 97.37
COG0493457 GltD NADPH-dependent glutamate synthase beta chain 97.35
PLN02546558 glutathione reductase 97.34
PRK10262321 thioredoxin reductase; Provisional 97.33
PTZ00318424 NADH dehydrogenase-like protein; Provisional 97.33
TIGR02352337 thiamin_ThiO glycine oxidase ThiO. This family con 97.32
PRK13748561 putative mercuric reductase; Provisional 97.32
PRK02106560 choline dehydrogenase; Validated 97.32
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 97.32
PLN02568539 polyamine oxidase 97.31
PRK12416463 protoporphyrinogen oxidase; Provisional 97.3
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 97.3
COG1231450 Monoamine oxidase [Amino acid transport and metabo 97.29
KOG1238|consensus623 97.26
TIGR03377516 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase 97.19
KOG2403|consensus642 97.18
COG1252405 Ndh NADH dehydrogenase, FAD-containing subunit [En 97.16
COG0562374 Glf UDP-galactopyranose mutase [Cell envelope biog 97.16
COG3349485 Uncharacterized conserved protein [Function unknow 97.15
PRK06292460 dihydrolipoamide dehydrogenase; Validated 97.14
TIGR02731453 phytoene_desat phytoene desaturase. Plants and cya 97.11
PTZ00153659 lipoamide dehydrogenase; Provisional 97.08
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 97.07
KOG1336|consensus478 97.07
TIGR02462544 pyranose_ox pyranose oxidase. Pyranose oxidase (al 97.04
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 97.02
PLN02328808 lysine-specific histone demethylase 1 homolog 96.96
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 96.94
COG2303542 BetA Choline dehydrogenase and related flavoprotei 96.94
COG1232444 HemY Protoporphyrinogen oxidase [Coenzyme metaboli 96.94
PLN02529738 lysine-specific histone demethylase 1 96.92
KOG2665|consensus453 96.9
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 96.85
TIGR02732474 zeta_caro_desat carotene 7,8-desaturase. Carotene 96.84
PF13434341 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requi 96.8
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 96.72
COG1251793 NirB NAD(P)H-nitrite reductase [Energy production 96.72
PLN02487569 zeta-carotene desaturase 96.67
PLN02612567 phytoene desaturase 96.59
PTZ00188506 adrenodoxin reductase; Provisional 96.57
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 96.55
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 96.5
PRK12831464 putative oxidoreductase; Provisional 96.5
COG1251 793 NirB NAD(P)H-nitrite reductase [Energy production 96.31
KOG1276|consensus491 96.28
PLN03000881 amine oxidase 96.23
PF00996438 GDI: GDP dissociation inhibitor; InterPro: IPR0182 96.17
COG2907447 Predicted NAD/FAD-binding protein [General functio 96.15
PRK12770352 putative glutamate synthase subunit beta; Provisio 96.14
PLN02976 1713 amine oxidase 96.13
KOG3923|consensus342 95.97
KOG1335|consensus506 95.88
COG3486436 IucD Lysine/ornithine N-monooxygenase [Secondary m 95.81
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductas 95.8
KOG2755|consensus334 95.73
PRK12778752 putative bifunctional 2-polyprenylphenol hydroxyla 95.72
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit 95.56
PRK13984604 putative oxidoreductase; Provisional 95.32
PRK12779944 putative bifunctional glutamate synthase subunit b 95.31
TIGR01372985 soxA sarcosine oxidase, alpha subunit family, hete 95.29
KOG0685|consensus498 95.24
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 95.07
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 95.01
PRK098531019 putative selenate reductase subunit YgfK; Provisio 94.65
PF01210157 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate 94.56
PRK12814652 putative NADPH-dependent glutamate synthase small 94.49
KOG1336|consensus478 94.44
PF06100500 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross 94.36
COG0492305 TrxB Thioredoxin reductase [Posttranslational modi 94.17
KOG0399|consensus2142 94.12
TIGR01317485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 94.09
KOG1800|consensus468 93.87
PRK127751006 putative trifunctional 2-polyprenylphenol hydroxyl 93.82
PF02737180 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD bind 93.72
TIGR033151012 Se_ygfK putative selenate reductase, YgfK subunit. 93.21
PF00743531 FMO-like: Flavin-binding monooxygenase-like; Inter 93.16
KOG1346|consensus659 93.12
COG0446415 HcaD Uncharacterized NAD(FAD)-dependent dehydrogen 93.02
PF02558151 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: 92.99
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 92.77
KOG2495|consensus491 92.35
TIGR02485432 CobZ_N-term precorrin 3B synthase CobZ. CobZ is es 92.3
PRK12842574 putative succinate dehydrogenase; Reviewed 92.3
COG5044434 MRS6 RAB proteins geranylgeranyltransferase compon 92.16
PRK07819286 3-hydroxybutyryl-CoA dehydrogenase; Validated 92.06
PF03721185 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogen 91.96
PRK06249313 2-dehydropantoate 2-reductase; Provisional 91.95
PRK08293287 3-hydroxybutyryl-CoA dehydrogenase; Validated 91.61
PRK01438480 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 91.44
PRK065671028 putative bifunctional glutamate synthase subunit b 91.39
PRK14106450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 91.32
COG0686371 Ald Alanine dehydrogenase [Amino acid transport an 91.27
PRK05808282 3-hydroxybutyryl-CoA dehydrogenase; Validated 91.24
PRK08229341 2-dehydropantoate 2-reductase; Provisional 91.15
PRK05708305 2-dehydropantoate 2-reductase; Provisional 90.95
PTZ00082321 L-lactate dehydrogenase; Provisional 90.94
PRK02705459 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 90.88
PRK07530292 3-hydroxybutyryl-CoA dehydrogenase; Validated 90.65
KOG2495|consensus491 90.65
KOG1346|consensus659 90.57
PRK06129308 3-hydroxyacyl-CoA dehydrogenase; Validated 90.37
KOG1439|consensus440 90.33
KOG4405|consensus547 90.29
PRK12834549 putative FAD-binding dehydrogenase; Reviewed 90.23
PRK06035291 3-hydroxyacyl-CoA dehydrogenase; Validated 90.0
PF01262168 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal 89.89
PF13241103 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_ 89.85
PRK12771564 putative glutamate synthase (NADPH) small subunit; 89.84
TIGR02354200 thiF_fam2 thiamine biosynthesis protein ThiF, fami 89.66
PRK09260288 3-hydroxybutyryl-CoA dehydrogenase; Validated 89.58
COG0569225 TrkA K+ transport systems, NAD-binding component [ 89.39
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of 89.35
TIGR01470205 cysG_Nterm siroheme synthase, N-terminal domain. T 89.24
PRK12843578 putative FAD-binding dehydrogenase; Reviewed 89.18
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 89.11
PRK12835584 3-ketosteroid-delta-1-dehydrogenase; Reviewed 88.92
PRK07066321 3-hydroxybutyryl-CoA dehydrogenase; Validated 88.82
PF01593450 Amino_oxidase: Flavin containing amine oxidoreduct 88.8
PRK15116268 sulfur acceptor protein CsdL; Provisional 88.57
PRK12921305 2-dehydropantoate 2-reductase; Provisional 88.53
PRK11064415 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Pro 88.43
PRK06522304 2-dehydropantoate 2-reductase; Reviewed 88.3
PRK06130311 3-hydroxybutyryl-CoA dehydrogenase; Validated 88.21
PRK14618328 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 88.08
TIGR02734502 crtI_fam phytoene desaturase. Phytoene is converte 88.06
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 88.05
PRK06719157 precorrin-2 dehydrogenase; Validated 87.78
KOG2304|consensus298 87.54
PRK06718202 precorrin-2 dehydrogenase; Reviewed 87.31
PRK12845564 3-ketosteroid-delta-1-dehydrogenase; Reviewed 87.0
cd05292308 LDH_2 A subgroup of L-lactate dehydrogenases. L-la 86.86
PRK00066315 ldh L-lactate dehydrogenase; Reviewed 86.78
PRK07843557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 86.78
PRK09424509 pntA NAD(P) transhydrogenase subunit alpha; Provis 86.75
PF00899135 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-a 86.7
PRK06134581 putative FAD-binding dehydrogenase; Reviewed 86.56
COG3486436 IucD Lysine/ornithine N-monooxygenase [Secondary m 86.53
cd01487174 E1_ThiF_like E1_ThiF_like. Member of superfamily o 85.99
PLN02545295 3-hydroxybutyryl-CoA dehydrogenase 85.8
cd01483143 E1_enzyme_family Superfamily of activating enzymes 85.78
PRK00094325 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydr 85.52
PRK14620326 NAD(P)H-dependent glycerol-3-phosphate dehydrogena 85.51
TIGR01763305 MalateDH_bact malate dehydrogenase, NAD-dependent. 85.48
PRK12475338 thiamine/molybdopterin biosynthesis MoeB-like prot 85.36
PRK08268507 3-hydroxy-acyl-CoA dehydrogenase; Validated 85.29
PRK12839572 hypothetical protein; Provisional 84.91
PRK12549284 shikimate 5-dehydrogenase; Reviewed 84.82
TIGR02356202 adenyl_thiF thiazole biosynthesis adenylyltransfer 84.81
PF13478136 XdhC_C: XdhC Rossmann domain; PDB: 3ON5_A 2WE8_B 2 84.34
PRK07688339 thiamine/molybdopterin biosynthesis ThiF/MoeB-like 84.29
PRK12837513 3-ketosteroid-delta-1-dehydrogenase; Provisional 84.24
TIGR02279503 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase Pa 83.7
TIGR03736244 PRTRC_ThiF PRTRC system ThiF family protein. A nov 83.65
PRK02472447 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 83.45
COG1748389 LYS9 Saccharopine dehydrogenase and related protei 83.43
PRK06223307 malate dehydrogenase; Reviewed 83.1
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 83.03
TIGR03026411 NDP-sugDHase nucleotide sugar dehydrogenase. All o 82.97
PRK08644212 thiamine biosynthesis protein ThiF; Provisional 82.91
PRK11730715 fadB multifunctional fatty acid oxidation complex 82.89
PRK04148134 hypothetical protein; Provisional 82.83
cd05311226 NAD_bind_2_malic_enz NAD(P) binding domain of mali 82.73
cd05291306 HicDH_like L-2-hydroxyisocapronate dehydrogenases 82.65
cd01339300 LDH-like_MDH L-lactate dehydrogenase-like malate d 82.58
TIGR02355240 moeB molybdopterin synthase sulfurylase MoeB. This 82.53
TIGR02437714 FadB fatty oxidation complex, alpha subunit FadB. 82.28
PRK07531495 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioe 82.1
cd00401413 AdoHcyase S-adenosyl-L-homocysteine hydrolase (Ado 81.81
TIGR00561511 pntA NAD(P) transhydrogenase, alpha subunit. In so 81.76
PRK08328231 hypothetical protein; Provisional 81.75
PRK04308445 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 81.07
PRK07454241 short chain dehydrogenase; Provisional 81.01
COG1250307 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabo 80.97
cd01075200 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of l 80.96
TIGR01813439 flavo_cyto_c flavocytochrome c. This model describ 80.95
PLN02353473 probable UDP-glucose 6-dehydrogenase 80.8
PF03446163 NAD_binding_2: NAD binding domain of 6-phosphogluc 80.68
KOG2404|consensus477 80.67
TIGR02441737 fa_ox_alpha_mit fatty acid oxidation complex, alph 80.46
PRK05690245 molybdopterin biosynthesis protein MoeB; Provision 80.36
TIGR02733492 desat_CrtD C-3',4' desaturase CrtD. Members of thi 80.24
PRK00421461 murC UDP-N-acetylmuramate--L-alanine ligase; Provi 80.22
PRK12548289 shikimate 5-dehydrogenase; Provisional 80.02
>COG0445 GidA Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information 
Probab=100.00  E-value=3.7e-183  Score=1429.80  Aligned_cols=615  Identities=61%  Similarity=0.982  Sum_probs=593.3

Q ss_pred             CcccEEEECcchHHHHHHHHHhhCCCcEEEEccCCCCCCcccccCCCCccchhhHHHHHHHhccHHHHHHhhcCCeEeee
Q psy9395           5 SKFDVIVVGGGHAGTEAALVSARMGQKTLLLSHNIDTIGQMSCNPSIGGIGKSHLVKEIDAMGGIMAIATDKSGIQFRIL   84 (637)
Q Consensus         5 ~~yDViVIGgG~AGl~AA~~lA~~G~~V~LiE~~~~~~G~~~cn~s~gg~~~~~l~~el~~~gg~~~~~~~~~gi~~~~l   84 (637)
                      +.||||||||||||++||+++||+|++|+|+..+.+.+|.|+|||++||++++++++|+|++||.|+..+|..+++|++|
T Consensus         3 ~~~DVIVIGgGHAG~EAA~AaARmG~ktlLlT~~~dtig~msCNPaIGG~~KG~lvrEIDALGG~Mg~~~D~~~IQ~r~L   82 (621)
T COG0445           3 KEYDVIVIGGGHAGVEAALAAARMGAKTLLLTLNLDTIGEMSCNPAIGGPGKGHLVREIDALGGLMGKAADKAGIQFRML   82 (621)
T ss_pred             CCCceEEECCCccchHHHHhhhccCCeEEEEEcCCCceeecccccccCCcccceeEEeehhccchHHHhhhhcCCchhhc
Confidence            34999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccccCchhhhhhhccCHHHHHHHHHHHHHhcCCeEEEcceeEEEEEeCC-eEEEEEEecceEEEeceEEEecccccCCce
Q psy9395          85 NSSKGAAVRATRAQVDRILYKQAIRFYLENQLNLYLFQEEVDDLIIKTN-KILGVVTKIGIKFFSKTVILTTGTFLNGKI  163 (637)
Q Consensus        85 ~~~~gp~~~~~~~~~d~~~~~~~l~~~l~~~~gv~i~~~~V~~i~~~~~-~v~gV~~~~g~~i~a~~VIlAtG~~~~~~~  163 (637)
                      |.++||+||++|+|.|+..|...|++.+++++|+.+++..|.++..+++ +|+||.+.+|..|.|++||++||+|++|++
T Consensus        83 N~sKGPAVra~RaQaDk~~Y~~~mk~~le~~~NL~l~q~~v~dli~e~~~~v~GV~t~~G~~~~a~aVVlTTGTFL~G~I  162 (621)
T COG0445          83 NSSKGPAVRAPRAQADKWLYRRAMKNELENQPNLHLLQGEVEDLIVEEGQRVVGVVTADGPEFHAKAVVLTTGTFLRGKI  162 (621)
T ss_pred             cCCCcchhcchhhhhhHHHHHHHHHHHHhcCCCceehHhhhHHHhhcCCCeEEEEEeCCCCeeecCEEEEeecccccceE
Confidence            9999999999999999999999999999999999999999999998777 599999999999999999999999999999


Q ss_pred             eecccccCCCCccccchHHHHHHHHhcCccceecccCCCCcccccccccchhhcccCCCCCCceeeecCCCcCCCccccc
Q psy9395         164 HIGLKSYSAGRFGDFSTTSLAKRLKELQLSHGRLKTGTPPRIDKRTIDFSKMEEQIGDFDPVPVFSVLGNINLHPKQLSC  243 (637)
Q Consensus       164 ~ig~~~~~~g~~g~~~~~~l~~~l~~~G~~~~~~~~g~~p~~~~~si~~~~~~~~~~d~~~~~~fs~~~~~~~~~~~~sc  243 (637)
                      |+|...++.||.|+.++..|+..|.++|++++|+|||||||++++||||++++.|++| .+++.|+|.+  .....|++|
T Consensus       163 ~iG~~~~~aGr~ge~~s~~Ls~~L~~lGf~l~RlKTGTPpRi~~~sIDfs~le~q~gD-~~~~~fs~~~--~~~~~Qi~C  239 (621)
T COG0445         163 HIGDTNYSAGRLGEPPSIGLSDRLRELGFKLGRLKTGTPPRIDARSIDFSKLEEQPGD-EPPPVFSFTT--EPHPPQIPC  239 (621)
T ss_pred             EeccccccCCCCCCccchHHHHHHHhcCcEEeeeccCCCCccCCCccChhhhccCcCC-CCCCccccCC--CCCccccce
Confidence            9999999999999999999999999999999999999999999999999999999999 7888899987  256679999


Q ss_pred             ccccccccccccccccccccccccccccccCCCCcccHHHHhhccCCCcccccccccCCCCCcceecCcccCCCCHHHHH
Q psy9395         244 FITHTNEKTHNIIRSEFKNSPIFSGKIESIGPRYCPSIEDKVYRFPKKKSHHIFLEPEGIVINEYYPNGISTSLPFEAQI  323 (637)
Q Consensus       244 ~~t~t~~~~~~ii~~~~~~~~~~~g~~~~~G~r~~psie~~~~~f~~~~~~~~~le~~gl~~~~~~~~g~~~~l~~~~q~  323 (637)
                      |+|+|++++|+||+.|++.++||+|.+.|.|||||||||||+.||+++.+||+||||||++++++|+||+|||||+++|.
T Consensus       240 ~iT~Tn~~TH~iIr~Nl~rSpmysG~Ieg~GPRYCPSIEDKIvrF~dK~~HqIFlEPEGl~~~evY~nGlSTSlP~dVQ~  319 (621)
T COG0445         240 YITYTNEKTHEIIRDNLHRSPMYSGEIEGVGPRYCPSIEDKIVRFADKERHQIFLEPEGLDTDEVYPNGLSTSLPEDVQE  319 (621)
T ss_pred             eeecCChHHHHHHHHhhhhCchhcccccccCCCCCCCHHHhhccCCCCccceEEecCCCCCCceEecCcccccCCHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHhccCCcceEEeccccccccceeCccccCccccccCCCCEEEEEeecCCCCHHHHHHHHHHHHHHHHHHhCCCCCCC
Q psy9395         324 ELVQSIDGMKNANIIRPGYAIEYDYFNPCNLKSSLETKQIHGLFFAGQINGTTGYEEAASQGLLAGLNAALFSQDRDPWI  403 (637)
Q Consensus       324 ~~~~~i~gle~a~v~~~G~~~e~~~v~~~~l~~tlesk~v~gLf~aGei~G~~Gy~eA~a~G~~AG~naa~~~~~~~~~~  403 (637)
                      +|+++|||||||+|+|||||||||||+|++|++|||||+|+||||||||||||||+||+|||++||+|||++++|++|++
T Consensus       320 ~~irsipGlEna~i~rpgYAIEYD~v~p~qL~~tLEtK~I~GLf~AGQINGTtGYEEAAaQGliAGiNAal~~~~~~p~i  399 (621)
T COG0445         320 QIIRSIPGLENAEILRPGYAIEYDYVDPRQLKPTLETKKIKGLFFAGQINGTTGYEEAAAQGLIAGINAALKVQGKEPFI  399 (621)
T ss_pred             HHHHhCcccccceeeccceeeeecccChhhcccchhhceecceEEcccccCCchhHHHHhhhHHHHHHHHHHhcCCCCcc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCccchhhhhHHHHhhhcCCCCccccccchHHHhhhcccccccccccccccccCCCCHHHHHHHHHHHHHHHHHHHHhhc
Q psy9395         404 PGRDQAYLGVLVDDLITKGIQEPYRMFTSRAEYRLNLREDNADLRLTEIGWKLGCVSYKQWKIFEKKREIITKELQRLKD  483 (637)
Q Consensus       404 ~~r~~~~ig~l~~~l~~~~~~epyrm~tsr~e~rl~~r~dn~~~r~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~l~~  483 (637)
                      +.|++|||||||||||||||+||||||||||||||+||+||||+||||+|+++|||+++||+.|+++++.+++.+++|++
T Consensus       400 l~R~eaYIGVlIDDLvTkGt~EPYRmfTSRAEyRL~LR~DNAd~RLt~~g~~lGLv~~~r~~~f~~k~~~i~~~~~~L~~  479 (621)
T COG0445         400 LRRDEAYIGVLIDDLVTKGTNEPYRMFTSRAEYRLLLREDNADLRLTEIGRELGLVDDERYERFLKKKENIEEEIERLKS  479 (621)
T ss_pred             cccCcceeeeEehhhhcCCCCCchhhcchHHHHHHHhhccchhhhhhHHHHHhCCCCHHHHHHHHHHHHHHHHHHHHHHh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ceeCCccccccccccccccccCcccCHHhhhcCCCCChhhHhcccccCCCCCccccCCcHHHHHHHHHHhhcHHHHHHHH
Q psy9395         484 TWINPSILNTGESERVLGKRIKHEYSLSNLLTWPNVNYNTLTSLKGINGKNLYNTEIYQEDIKKQLKIQLQYEGYILRQI  563 (637)
Q Consensus       484 ~~~~~~~~~~~~~~~~~~~~~~~~~s~~~ll~r~~v~~~~l~~~~~~~~~~~~~~~~~~~~~~~~veie~kY~gYi~rq~  563 (637)
                      ++++|++|.. .+......+++...+++|+|+||+++|++|.+++|....       ++++++++||||+||+|||+||+
T Consensus       480 ~~v~p~~~~~-~~~~~~~~~~~~~~~~~~lL~rpe~~~~~l~~~~~~~~~-------~~~~v~eqveieiKY~gYI~rq~  551 (621)
T COG0445         480 TWVTPSEVAK-ELLALGGQPLKRRSSLYDLLRRPEISYDDLISLFPLPAD-------LDAEVLEQVEIEIKYEGYIKRQQ  551 (621)
T ss_pred             eecChHHHHH-HHHHhhcCCcccchhHHHHhcCCCCCHHHHHHhCCcccc-------cCHHHHhHhheehhHHHHHHHHH
Confidence            9999965554 333334445667789999999999999999999984433       78999999999999999999999


Q ss_pred             HHHHHHHhhcccCCCCCCCCCCCcCccHHHHHHhhccCCCCHHHhhcCCCCCHHHHHHHHHHHhcCc
Q psy9395         564 NEVEKNKINENLKLPHNLDYMKIQSLSIEARQKLNKYKPETIGQASRISGVTPAALTLLLIYLKSGF  630 (637)
Q Consensus       564 ~~i~~~~~~e~~~iP~d~dY~~i~~LS~E~~ekL~~~rP~tlgqAsrI~GvtPa~i~~L~~~l~~~~  630 (637)
                      ++|++++++|+++||+||||+.|+|||+|+||||+++||.||||||||||||||||+.|++||++.+
T Consensus       552 ~~i~~~~~~e~~~IP~~~Dy~~i~~LS~Ea~~KL~~~rP~tigqAsRIsGitpadI~~Ll~~l~~~~  618 (621)
T COG0445         552 EQIEKLKRLENTKIPEDIDYDKIPGLSNEAREKLNKIRPLTIGQASRISGVTPADISILLVYLKKGK  618 (621)
T ss_pred             HHHHHHHHhhcccCCCCcChhhccchhHHHHHHHhhcCCCcHHHhhhcCCCCHHHHHHHHHHHhhhc
Confidence            9999999999999999999999999999999999999999999999999999999999999999754

>KOG2311|consensus Back     alignment and domain information
>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information
>TIGR00136 gidA glucose-inhibited division protein A Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>TIGR00137 gid_trmFO tRNA:m(5)U-54 methyltransferase Back     alignment and domain information
>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>COG1206 Gid NAD(FAD)-utilizing enzyme possibly involved in translation [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>TIGR00275 flavoprotein, HI0933 family Back     alignment and domain information
>PF13932 GIDA_assoc_3: GidA associated domain 3; PDB: 3CES_C 3CP2_A 3G05_A 3CP8_A 2ZXI_B 2ZXH_A Back     alignment and domain information
>TIGR03862 flavo_PP4765 uncharacterized flavoprotein, PP_4765 family Back     alignment and domain information
>PRK06481 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional Back     alignment and domain information
>TIGR00551 nadB L-aspartate oxidase Back     alignment and domain information
>PRK08626 fumarate reductase flavoprotein subunit; Provisional Back     alignment and domain information
>PRK06175 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK06854 adenylylsulfate reductase subunit alpha; Validated Back     alignment and domain information
>PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08401 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK08274 tricarballylate dehydrogenase; Validated Back     alignment and domain information
>PRK09231 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>COG0029 NadB Aspartate oxidase [Coenzyme metabolism] Back     alignment and domain information
>PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit Back     alignment and domain information
>PRK07512 L-aspartate oxidase; Provisional Back     alignment and domain information
>TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit Back     alignment and domain information
>PRK07121 hypothetical protein; Validated Back     alignment and domain information
>PRK07395 L-aspartate oxidase; Provisional Back     alignment and domain information
>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>COG1053 SdhA Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>PRK08071 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK07804 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK08275 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK09077 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PLN02815 L-aspartate oxidase Back     alignment and domain information
>TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup Back     alignment and domain information
>TIGR02061 aprA adenosine phosphosulphate reductase, alpha subunit Back     alignment and domain information
>KOG2820|consensus Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PTZ00306 NADH-dependent fumarate reductase; Provisional Back     alignment and domain information
>PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>PF00890 FAD_binding_2: FAD binding domain of the Pfam family Back     alignment and domain information
>PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK10015 oxidoreductase; Provisional Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK12834 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>PLN02661 Putative thiazole synthesis Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>TIGR01813 flavo_cyto_c flavocytochrome c Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional Back     alignment and domain information
>PLN02697 lycopene epsilon cyclase Back     alignment and domain information
>PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>TIGR01790 carotene-cycl lycopene cyclase family protein Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01377 soxA_mon sarcosine oxidase, monomeric form Back     alignment and domain information
>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>PRK11259 solA N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>PRK12842 putative succinate dehydrogenase; Reviewed Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>KOG1335|consensus Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>PRK06134 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK12839 hypothetical protein; Provisional Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PLN02985 squalene monooxygenase Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK12843 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PTZ00383 malate:quinone oxidoreductase; Provisional Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>KOG2404|consensus Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>PF05834 Lycopene_cycl: Lycopene cyclase protein; InterPro: IPR008671 This family consists of lycopene beta and epsilon cyclase proteins Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>TIGR02485 CobZ_N-term precorrin 3B synthase CobZ Back     alignment and domain information
>PRK05675 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>COG0579 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>KOG1298|consensus Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>PLN02464 glycerol-3-phosphate dehydrogenase Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>TIGR01816 sdhA_forward succinate dehydrogenase, flavoprotein subunit, E Back     alignment and domain information
>PRK06126 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>COG3573 Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>KOG0404|consensus Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00367 squalene epoxidase; Provisional Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>PRK05257 malate:quinone oxidoreductase; Validated Back     alignment and domain information
>PRK13339 malate:quinone oxidoreductase; Reviewed Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase Back     alignment and domain information
>PRK06996 hypothetical protein; Provisional Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase Back     alignment and domain information
>PRK08294 phenol 2-monooxygenase; Provisional Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>KOG2853|consensus Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>KOG2614|consensus Back     alignment and domain information
>PF00732 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR000172 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ] Back     alignment and domain information
>TIGR01789 lycopene_cycl lycopene cyclase Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>KOG1399|consensus Back     alignment and domain information
>PRK09897 hypothetical protein; Provisional Back     alignment and domain information
>PF13454 NAD_binding_9: FAD-NAD(P)-binding Back     alignment and domain information
>KOG4254|consensus Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>KOG4716|consensus Back     alignment and domain information
>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit Back     alignment and domain information
>KOG2415|consensus Back     alignment and domain information
>KOG2844|consensus Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF00070 Pyr_redox: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR001327 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information
>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>COG3075 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13977 myosin-cross-reactive antigen; Provisional Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>KOG0405|consensus Back     alignment and domain information
>KOG2852|consensus Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>TIGR01810 betA choline dehydrogenase Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle Back     alignment and domain information
>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>KOG3851|consensus Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PLN02785 Protein HOTHEAD Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>KOG2960|consensus Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>PTZ00363 rab-GDP dissociation inhibitor; Provisional Back     alignment and domain information
>PRK07208 hypothetical protein; Provisional Back     alignment and domain information
>KOG0042|consensus Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>TIGR00031 UDP-GALP_mutase UDP-galactopyranose mutase Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>KOG3855|consensus Back     alignment and domain information
>TIGR03197 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>PLN02576 protoporphyrinogen oxidase Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>PRK11883 protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>COG4529 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>KOG0029|consensus Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>TIGR00562 proto_IX_ox protoporphyrinogen oxidase Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>PLN02676 polyamine oxidase Back     alignment and domain information
>PLN02268 probable polyamine oxidase Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>COG0493 GltD NADPH-dependent glutamate synthase beta chain and related oxidoreductases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>TIGR02352 thiamin_ThiO glycine oxidase ThiO Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>PRK02106 choline dehydrogenase; Validated Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PLN02568 polyamine oxidase Back     alignment and domain information
>PRK12416 protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>COG1231 Monoamine oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG1238|consensus Back     alignment and domain information
>TIGR03377 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase, anaerobic, A subunit Back     alignment and domain information
>KOG2403|consensus Back     alignment and domain information
>COG1252 Ndh NADH dehydrogenase, FAD-containing subunit [Energy production and conversion] Back     alignment and domain information
>COG0562 Glf UDP-galactopyranose mutase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>COG3349 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR02731 phytoene_desat phytoene desaturase Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>KOG1336|consensus Back     alignment and domain information
>TIGR02462 pyranose_ox pyranose oxidase Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>PLN02328 lysine-specific histone demethylase 1 homolog Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>COG2303 BetA Choline dehydrogenase and related flavoproteins [Amino acid transport and metabolism] Back     alignment and domain information
>COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] Back     alignment and domain information
>PLN02529 lysine-specific histone demethylase 1 Back     alignment and domain information
>KOG2665|consensus Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>TIGR02732 zeta_caro_desat carotene 7,8-desaturase Back     alignment and domain information
>PF13434 K_oxygenase: L-lysine 6-monooxygenase (NADPH-requiring); PDB: 3S61_B 3S5W_B Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>COG1251 NirB NAD(P)H-nitrite reductase [Energy production and conversion] Back     alignment and domain information
>PLN02487 zeta-carotene desaturase Back     alignment and domain information
>PLN02612 phytoene desaturase Back     alignment and domain information
>PTZ00188 adrenodoxin reductase; Provisional Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>COG1251 NirB NAD(P)H-nitrite reductase [Energy production and conversion] Back     alignment and domain information
>KOG1276|consensus Back     alignment and domain information
>PLN03000 amine oxidase Back     alignment and domain information
>PF00996 GDI: GDP dissociation inhibitor; InterPro: IPR018203 Rab proteins constitute a family of small GTPases that serve a regulatory role in vesicular membrane traffic [, ]; C-terminal geranylgeranylation is crucial for their membrane association and function Back     alignment and domain information
>COG2907 Predicted NAD/FAD-binding protein [General function prediction only] Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PLN02976 amine oxidase Back     alignment and domain information
>KOG3923|consensus Back     alignment and domain information
>KOG1335|consensus Back     alignment and domain information
>COG3486 IucD Lysine/ornithine N-monooxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>KOG2755|consensus Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>KOG0685|consensus Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>PF01210 NAD_Gly3P_dh_N: NAD-dependent glycerol-3-phosphate dehydrogenase N-terminus; InterPro: IPR011128 NAD-dependent glycerol-3-phosphate dehydrogenase (GPDH) catalyses the interconversion of dihydroxyacetone phosphate and L-glycerol-3-phosphate Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>KOG1336|consensus Back     alignment and domain information
>PF06100 Strep_67kDa_ant: Streptococcal 67 kDa myosin-cross-reactive antigen like family ; InterPro: IPR010354 Members of this family are thought to have structural features in common with the beta chain of the class II antigens, as well as myosin, and may play an important role in the pathogenesis [] Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0399|consensus Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>KOG1800|consensus Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>PF02737 3HCDH_N: 3-hydroxyacyl-CoA dehydrogenase, NAD binding domain; InterPro: IPR006176 3-hydroxyacyl-CoA dehydrogenase (1 Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>KOG1346|consensus Back     alignment and domain information
>COG0446 HcaD Uncharacterized NAD(FAD)-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PF02558 ApbA: Ketopantoate reductase PanE/ApbA; InterPro: IPR013332 ApbA, the ketopantoate reductase enzyme 1 Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>KOG2495|consensus Back     alignment and domain information
>TIGR02485 CobZ_N-term precorrin 3B synthase CobZ Back     alignment and domain information
>PRK12842 putative succinate dehydrogenase; Reviewed Back     alignment and domain information
>COG5044 MRS6 RAB proteins geranylgeranyltransferase component A (RAB escort protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07819 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PF03721 UDPG_MGDP_dh_N: UDP-glucose/GDP-mannose dehydrogenase family, NAD binding domain; InterPro: IPR001732 The UDP-glucose/GDP-mannose dehydrogenases are a small group of enzymes which possesses the ability to catalyse the NAD-dependent 2-fold oxidation of an alcohol to an acid without the release of an aldehyde intermediate [, ] Back     alignment and domain information
>PRK06249 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK08293 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK01438 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK06567 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Validated Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG0686 Ald Alanine dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK05808 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK08229 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK05708 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PTZ00082 L-lactate dehydrogenase; Provisional Back     alignment and domain information
>PRK02705 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK07530 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>KOG2495|consensus Back     alignment and domain information
>KOG1346|consensus Back     alignment and domain information
>PRK06129 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>KOG1439|consensus Back     alignment and domain information
>KOG4405|consensus Back     alignment and domain information
>PRK12834 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK06035 3-hydroxyacyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PF01262 AlaDh_PNT_C: Alanine dehydrogenase/PNT, C-terminal domain; InterPro: IPR007698 Alanine dehydrogenases (1 Back     alignment and domain information
>PF13241 NAD_binding_7: Putative NAD(P)-binding; PDB: 3DFZ_B 1PJT_A 1PJS_A 1PJQ_A 1KYQ_B Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>TIGR02354 thiF_fam2 thiamine biosynthesis protein ThiF, family 2 Back     alignment and domain information
>PRK09260 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>TIGR01470 cysG_Nterm siroheme synthase, N-terminal domain Back     alignment and domain information
>PRK12843 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK07066 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PF01593 Amino_oxidase: Flavin containing amine oxidoreductase This is a subset of the Pfam family; InterPro: IPR002937 This entry consists of various amine oxidases, including maize polyamine oxidase (PAO) [], L-amino acid oxidases (LAO) and various flavin containing monoamine oxidases (MAO) Back     alignment and domain information
>PRK15116 sulfur acceptor protein CsdL; Provisional Back     alignment and domain information
>PRK12921 2-dehydropantoate 2-reductase; Provisional Back     alignment and domain information
>PRK11064 wecC UDP-N-acetyl-D-mannosamine dehydrogenase; Provisional Back     alignment and domain information
>PRK06522 2-dehydropantoate 2-reductase; Reviewed Back     alignment and domain information
>PRK06130 3-hydroxybutyryl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK14618 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>PRK06719 precorrin-2 dehydrogenase; Validated Back     alignment and domain information
>KOG2304|consensus Back     alignment and domain information
>PRK06718 precorrin-2 dehydrogenase; Reviewed Back     alignment and domain information
>PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>cd05292 LDH_2 A subgroup of L-lactate dehydrogenases Back     alignment and domain information
>PRK00066 ldh L-lactate dehydrogenase; Reviewed Back     alignment and domain information
>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>PF00899 ThiF: ThiF family; InterPro: IPR000594 Ubiquitin-activating enzyme (E1 enzyme) [, ] activates ubiquitin by first adenylating with ATP its C-terminal glycine residue and thereafter linking this residue to the side chain of a cysteine residue in E1, yielding an ubiquitin-E1 thiolester and free AMP Back     alignment and domain information
>PRK06134 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>COG3486 IucD Lysine/ornithine N-monooxygenase [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>cd01487 E1_ThiF_like E1_ThiF_like Back     alignment and domain information
>PLN02545 3-hydroxybutyryl-CoA dehydrogenase Back     alignment and domain information
>cd01483 E1_enzyme_family Superfamily of activating enzymes (E1) of the ubiquitin-like proteins Back     alignment and domain information
>PRK00094 gpsA NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Validated Back     alignment and domain information
>PRK14620 NAD(P)H-dependent glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>TIGR01763 MalateDH_bact malate dehydrogenase, NAD-dependent Back     alignment and domain information
>PRK12475 thiamine/molybdopterin biosynthesis MoeB-like protein; Provisional Back     alignment and domain information
>PRK08268 3-hydroxy-acyl-CoA dehydrogenase; Validated Back     alignment and domain information
>PRK12839 hypothetical protein; Provisional Back     alignment and domain information
>PRK12549 shikimate 5-dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02356 adenyl_thiF thiazole biosynthesis adenylyltransferase ThiF, E Back     alignment and domain information
>PF13478 XdhC_C: XdhC Rossmann domain; PDB: 3ON5_A 2WE8_B 2WE7_A Back     alignment and domain information
>PRK07688 thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein; Validated Back     alignment and domain information
>PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional Back     alignment and domain information
>TIGR02279 PaaC-3OHAcCoADH 3-hydroxyacyl-CoA dehydrogenase PaaC Back     alignment and domain information
>TIGR03736 PRTRC_ThiF PRTRC system ThiF family protein Back     alignment and domain information
>PRK02472 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PRK06223 malate dehydrogenase; Reviewed Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>TIGR03026 NDP-sugDHase nucleotide sugar dehydrogenase Back     alignment and domain information
>PRK08644 thiamine biosynthesis protein ThiF; Provisional Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>cd05311 NAD_bind_2_malic_enz NAD(P) binding domain of malic enzyme (ME), subgroup 2 Back     alignment and domain information
>cd05291 HicDH_like L-2-hydroxyisocapronate dehydrogenases and some bacterial L-lactate dehydrogenases Back     alignment and domain information
>cd01339 LDH-like_MDH L-lactate dehydrogenase-like malate dehydrogenase proteins Back     alignment and domain information
>TIGR02355 moeB molybdopterin synthase sulfurylase MoeB Back     alignment and domain information
>TIGR02437 FadB fatty oxidation complex, alpha subunit FadB Back     alignment and domain information
>PRK07531 bifunctional 3-hydroxyacyl-CoA dehydrogenase/thioesterase; Validated Back     alignment and domain information
>cd00401 AdoHcyase S-adenosyl-L-homocysteine hydrolase (AdoHycase) catalyzes the hydrolysis of S-adenosyl-L-homocysteine (AdoHyc) to form adenosine (Ado) and homocysteine (Hcy) Back     alignment and domain information
>TIGR00561 pntA NAD(P) transhydrogenase, alpha subunit Back     alignment and domain information
>PRK08328 hypothetical protein; Provisional Back     alignment and domain information
>PRK04308 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG1250 FadB 3-hydroxyacyl-CoA dehydrogenase [Lipid metabolism] Back     alignment and domain information
>cd01075 NAD_bind_Leu_Phe_Val_DH NAD(P) binding domain of leucine dehydrogenase, phenylalanine dehydrogenase, and valine dehydrogenase Back     alignment and domain information
>TIGR01813 flavo_cyto_c flavocytochrome c Back     alignment and domain information
>PLN02353 probable UDP-glucose 6-dehydrogenase Back     alignment and domain information
>PF03446 NAD_binding_2: NAD binding domain of 6-phosphogluconate dehydrogenase; InterPro: IPR006115 6-Phosphogluconate dehydrogenase (1 Back     alignment and domain information
>KOG2404|consensus Back     alignment and domain information
>TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial Back     alignment and domain information
>PRK05690 molybdopterin biosynthesis protein MoeB; Provisional Back     alignment and domain information
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD Back     alignment and domain information
>PRK00421 murC UDP-N-acetylmuramate--L-alanine ligase; Provisional Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query637
3ces_A651 Crystal Structure Of E.Coli Mnmg (Gida), A Highly-C 0.0
3cp2_A649 Crystal Structure Of Gida From E. Coli Length = 649 0.0
3g05_A576 Crystal Structure Of N-Terminal Domain (2-550) Of E 0.0
2zxh_A637 Structure Of Aquifex Aeolicus Gida In The Form I Cr 1e-164
3cp8_A641 Crystal Structure Of Gida From Chlorobium Tepidum L 1e-157
3g5s_A443 Crystal Structure Of Thermus Thermophilus Trmfo In 2e-11
3g5q_A443 Crystal Structure Of Thermus Thermophilus Trmfo Len 3e-11
2cul_A232 Crystal Structure Of The Gida-Related Protein From 7e-06
>pdb|3CES|A Chain A, Crystal Structure Of E.Coli Mnmg (Gida), A Highly-Conserved Trna Modifying Enzyme Length = 651 Back     alignment and structure 
Iteration: 1

 Score =  791 bits (2043), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/633 (60%), Positives = 479/633 (75%), Gaps = 8/633 (1%)
Query: 1   MLFKSKFDVIVVGGGHAGTEAALVSARMGQKTLLLSHNIDTIGQMSCNPSIGGIGKSHLV 60
           M +   FDVI++GGGHAGTEAA+ +ARMGQ+TLLL+HNIDT+GQMSCNP+IGGIGK HLV
Sbjct: 23  MFYPDPFDVIIIGGGHAGTEAAMAAARMGQQTLLLTHNIDTLGQMSCNPAIGGIGKGHLV 82
Query: 61  KEIDAMGGIMAIATDKSGIQFRILNSSKGAAVRATRAQVDRILYKQAIRFYLENQLNLYL 120
           KE+DA+GG+MA A D++GIQFRILN+SKG AVRATRAQ DR+LY+QA+R  LENQ NL +
Sbjct: 83  KEVDALGGLMAKAIDQAGIQFRILNASKGPAVRATRAQADRVLYRQAVRTALENQPNLMI 142
Query: 121 FQEEVDDLIIKTNKILGVVTKIGIKFFSKTVILTTGTFLNGKIHIGLKSYSAGRFGDFST 180
           FQ+ V+DLI++ ++++G VT++G+KF +K V+LT GTFL+GKIHIGL +YS GR GD  +
Sbjct: 143 FQQAVEDLIVENDRVVGAVTQMGLKFRAKAVVLTVGTFLDGKIHIGLDNYSGGRAGDPPS 202
Query: 181 TSLAKRLKELQLSHGRLKTGTPPRIDKRTIDFSKMEEQIGDFDPVPVFSVLGNINLHPKQ 240
             L++RL+EL L  GRLKTGTPPRID RTIDFS + +Q GD +P+PVFS +GN + HP+Q
Sbjct: 203 IPLSRRLRELPLRVGRLKTGTPPRIDARTIDFSVLAQQHGD-NPMPVFSFMGNASQHPQQ 261
Query: 241 LSCFITHTNEKTHNIIRSEFKNSPIFSGKIESIGPRYCPSIEDKVYRFPKKKSHHIFLEP 300
           + C+ITHTNEKTH++IRS    SP+++G IE +GPRYCPSIEDKV RF  +  H IFLEP
Sbjct: 262 VPCYITHTNEKTHDVIRSNLDRSPMYAGVIEGVGPRYCPSIEDKVMRFADRNQHQIFLEP 321
Query: 301 EGIVINEYYPNGISTSLPFEAQIELVQSIDGMKNANIIRPGYAIEYDYFNPCNLKSSLET 360
           EG+  NE YPNGISTSLPF+ Q+++V+S+ GM+NA I+RPGYAIEYD+F+P +LK +LE+
Sbjct: 322 EGLTSNEIYPNGISTSLPFDVQMQIVRSMQGMENAKIVRPGYAIEYDFFDPRDLKPTLES 381
Query: 361 KQIHGLFFAGQINGTTGYEEAASQGLLAGLNAALFSQDRDPWIPGRDQAYLGVLVDDLIT 420
           K I GLFFAGQINGTTGYEEAA+QGLLAGLNAA  S D++ W P R QAYLGVLVDDL T
Sbjct: 382 KFIQGLFFAGQINGTTGYEEAAAQGLLAGLNAARLSADKEGWAPARSQAYLGVLVDDLCT 441
Query: 421 KGIQEPYRMFTSRAEYRLNLREDNADLRLTEIGWKLGCVSYKQWKIFEKKREIITKELQR 480
            G +EPYRMFTSRAEYRL LREDNADLRLTEIG +LG V  ++W  F +K E I +E QR
Sbjct: 442 LGTKEPYRMFTSRAEYRLMLREDNADLRLTEIGRELGLVDDERWARFNEKLENIERERQR 501
Query: 481 LKDTWINPSILNTGESERVLGKRIKHEYSLSNLLTWPNVNYNTLTSLKGINGKNLYNTEI 540
           LK TW+ PS     E    L   +  E S  +LL  P + Y  LT+L        +   +
Sbjct: 502 LKSTWVTPSAEAAAEVNAHLTAPLSREASGEDLLRRPEMTYEKLTTL------TPFAPAL 555
Query: 541 YQEDIKKQLKIQLQYEGYILRQXXXXXXXXXXXXXXXPHNLDYMKIQSLSIEARQKLNKY 600
             E   +Q++IQ++YEGYI RQ               P  LDY ++  LS E   KLN +
Sbjct: 556 TDEQAAEQVEIQVKYEGYIARQQDEIEKQLRNENTLLPATLDYRQVSGLSNEVIAKLNDH 615
Query: 601 KPETIGQASRISGVTPAALTLLLIYL-KSGFLK 632
           KP +IGQASRISGVTPAA+++LL++L K G L+
Sbjct: 616 KPASIGQASRISGVTPAAISILLVWLKKQGMLR 648
>pdb|3CP2|A Chain A, Crystal Structure Of Gida From E. Coli Length = 649 Back     alignment and structure
>pdb|3G05|A Chain A, Crystal Structure Of N-Terminal Domain (2-550) Of E.Coli Mnmg Length = 576 Back     alignment and structure
>pdb|2ZXH|A Chain A, Structure Of Aquifex Aeolicus Gida In The Form I Crystal Length = 637 Back     alignment and structure
>pdb|3CP8|A Chain A, Crystal Structure Of Gida From Chlorobium Tepidum Length = 641 Back     alignment and structure
>pdb|3G5S|A Chain A, Crystal Structure Of Thermus Thermophilus Trmfo In Complex With Glutathione Length = 443 Back     alignment and structure
>pdb|3G5Q|A Chain A, Crystal Structure Of Thermus Thermophilus Trmfo Length = 443 Back     alignment and structure
>pdb|2CUL|A Chain A, Crystal Structure Of The Gida-Related Protein From Thermus Thermophilus Hb8 Length = 232 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query637
3ces_A651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 0.0
3cp8_A641 TRNA uridine 5-carboxymethylaminomethyl modificati 0.0
2zxi_A637 TRNA uridine 5-carboxymethylaminomethyl modificat 0.0
3g5s_A443 Methylenetetrahydrofolate--tRNA-(uracil-5-)- methy 1e-134
2cul_A232 Glucose-inhibited division protein A-related PROT 1e-116
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-15
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-09
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-07
3atr_A453 Conserved archaeal protein; saturating double bond 5e-10
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 7e-08
4fk1_A304 Putative thioredoxin reductase; structural genomic 8e-07
3gyx_A662 Adenylylsulfate reductase; oxidoreductase; HET: FA 1e-06
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 2e-05
3e1t_A512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 2e-05
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 3e-05
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 3e-05
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 7e-05
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 9e-05
2gqf_A401 Hypothetical protein HI0933; structural genomics, 1e-04
2ywl_A180 Thioredoxin reductase related protein; uncharacter 1e-04
2i0z_A447 NAD(FAD)-utilizing dehydrogenases; structural geno 2e-04
3i3l_A591 Alkylhalidase CMLS; flavin-dependent halogenase, c 2e-04
2h88_A621 Succinate dehydrogenase flavoprotein subunit; comp 3e-04
2bs2_A660 Quinol-fumarate reductase flavoprotein subunit A; 4e-04
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 9e-04
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Length = 651 Back     alignment and structure
 Score = 1132 bits (2932), Expect = 0.0
 Identities = 385/627 (61%), Positives = 484/627 (77%), Gaps = 7/627 (1%)

Query: 1   MLFKSKFDVIVVGGGHAGTEAALVSARMGQKTLLLSHNIDTIGQMSCNPSIGGIGKSHLV 60
           M +   FDVI++GGGHAGTEAA+ +ARMGQ+TLLL+HNIDT+GQMSCNP+IGGIGK HLV
Sbjct: 23  MFYPDPFDVIIIGGGHAGTEAAMAAARMGQQTLLLTHNIDTLGQMSCNPAIGGIGKGHLV 82

Query: 61  KEIDAMGGIMAIATDKSGIQFRILNSSKGAAVRATRAQVDRILYKQAIRFYLENQLNLYL 120
           KE+DA+GG+MA A D++GIQFRILN+SKG AVRATRAQ DR+LY+QA+R  LENQ NL +
Sbjct: 83  KEVDALGGLMAKAIDQAGIQFRILNASKGPAVRATRAQADRVLYRQAVRTALENQPNLMI 142

Query: 121 FQEEVDDLIIKTNKILGVVTKIGIKFFSKTVILTTGTFLNGKIHIGLKSYSAGRFGDFST 180
           FQ+ V+DLI++ ++++G VT++G+KF +K V+LT GTFL+GKIHIGL +YS GR GD  +
Sbjct: 143 FQQAVEDLIVENDRVVGAVTQMGLKFRAKAVVLTVGTFLDGKIHIGLDNYSGGRAGDPPS 202

Query: 181 TSLAKRLKELQLSHGRLKTGTPPRIDKRTIDFSKMEEQIGDFDPVPVFSVLGNINLHPKQ 240
             L++RL+EL L  GRLKTGTPPRID RTIDFS + +Q GD +P+PVFS +GN + HP+Q
Sbjct: 203 IPLSRRLRELPLRVGRLKTGTPPRIDARTIDFSVLAQQHGD-NPMPVFSFMGNASQHPQQ 261

Query: 241 LSCFITHTNEKTHNIIRSEFKNSPIFSGKIESIGPRYCPSIEDKVYRFPKKKSHHIFLEP 300
           + C+ITHTNEKTH++IRS    SP+++G IE +GPRYCPSIEDKV RF  +  H IFLEP
Sbjct: 262 VPCYITHTNEKTHDVIRSNLDRSPMYAGVIEGVGPRYCPSIEDKVMRFADRNQHQIFLEP 321

Query: 301 EGIVINEYYPNGISTSLPFEAQIELVQSIDGMKNANIIRPGYAIEYDYFNPCNLKSSLET 360
           EG+  NE YPNGISTSLPF+ Q+++V+S+ GM+NA I+RPGYAIEYD+F+P +LK +LE+
Sbjct: 322 EGLTSNEIYPNGISTSLPFDVQMQIVRSMQGMENAKIVRPGYAIEYDFFDPRDLKPTLES 381

Query: 361 KQIHGLFFAGQINGTTGYEEAASQGLLAGLNAALFSQDRDPWIPGRDQAYLGVLVDDLIT 420
           K I GLFFAGQINGTTGYEEAA+QGLLAGLNAA  S D++ W P R QAYLGVLVDDL T
Sbjct: 382 KFIQGLFFAGQINGTTGYEEAAAQGLLAGLNAARLSADKEGWAPARSQAYLGVLVDDLCT 441

Query: 421 KGIQEPYRMFTSRAEYRLNLREDNADLRLTEIGWKLGCVSYKQWKIFEKKREIITKELQR 480
            G +EPYRMFTSRAEYRL LREDNADLRLTEIG +LG V  ++W  F +K E I +E QR
Sbjct: 442 LGTKEPYRMFTSRAEYRLMLREDNADLRLTEIGRELGLVDDERWARFNEKLENIERERQR 501

Query: 481 LKDTWINPSILNTGESERVLGKRIKHEYSLSNLLTWPNVNYNTLTSLKGINGKNLYNTEI 540
           LK TW+ PS     E    L   +  E S  +LL  P + Y  LT+L            +
Sbjct: 502 LKSTWVTPSAEAAAEVNAHLTAPLSREASGEDLLRRPEMTYEKLTTLTPFAP------AL 555

Query: 541 YQEDIKKQLKIQLQYEGYILRQINEVEKNKINENLKLPHNLDYMKIQSLSIEARQKLNKY 600
             E   +Q++IQ++YEGYI RQ +E+EK   NEN  LP  LDY ++  LS E   KLN +
Sbjct: 556 TDEQAAEQVEIQVKYEGYIARQQDEIEKQLRNENTLLPATLDYRQVSGLSNEVIAKLNDH 615

Query: 601 KPETIGQASRISGVTPAALTLLLIYLK 627
           KP +IGQASRISGVTPAA+++LL++LK
Sbjct: 616 KPASIGQASRISGVTPAAISILLVWLK 642
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Length = 641 Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Length = 637 Back     alignment and structure
>3g5s_A Methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TRMFO; tRNA methyltransferase FAD folate, FAD, flavoprotein; HET: MSE FAD GSH; 1.05A {Thermus thermophilus} PDB: 3g5q_A* 3g5r_A* Length = 443 Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Length = 232 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Length = 453 Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Length = 304 Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Length = 662 Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Length = 297 Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Length = 512 Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Length = 421 Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Length = 521 Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Length = 284 Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Length = 417 Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Length = 401 Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Length = 180 Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Length = 447 Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Length = 591 Back     alignment and structure
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Length = 621 Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Length = 660 Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Length = 319 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query637
3ces_A651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 100.0
2zxi_A637 TRNA uridine 5-carboxymethylaminomethyl modificat 100.0
3cp8_A641 TRNA uridine 5-carboxymethylaminomethyl modificati 100.0
3g5s_A443 Methylenetetrahydrofolate--tRNA-(uracil-5-)- methy 100.0
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 99.97
2gqf_A401 Hypothetical protein HI0933; structural genomics, 99.96
2i0z_A447 NAD(FAD)-utilizing dehydrogenases; structural geno 99.94
2cul_A232 Glucose-inhibited division protein A-related PROT 99.81
3nlc_A549 Uncharacterized protein VP0956; FAD-binding protei 99.8
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 99.71
1qo8_A566 Flavocytochrome C3 fumarate reductase; oxidoreduct 99.67
2bs2_A660 Quinol-fumarate reductase flavoprotein subunit A; 99.67
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 99.65
4at0_A510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 99.64
4fk1_A304 Putative thioredoxin reductase; structural genomic 99.64
1chu_A540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 99.63
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 99.63
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 99.62
2wdq_A588 Succinate dehydrogenase flavoprotein subunit; succ 99.62
2h88_A621 Succinate dehydrogenase flavoprotein subunit; comp 99.61
1kf6_A602 Fumarate reductase flavoprotein; respiration, fuma 99.6
3gyx_A662 Adenylylsulfate reductase; oxidoreductase; HET: FA 99.55
1jnr_A643 Adenylylsulfate reductase; oxidoreductase; HET: FA 99.51
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 99.51
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 99.49
2e5v_A472 L-aspartate oxidase; archaea, oxidoreductase; HET: 99.47
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 99.45
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 99.43
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 99.43
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 99.42
3dje_A438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 99.42
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 99.4
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 99.4
3dme_A369 Conserved exported protein; structural genomics, P 99.35
3r9u_A315 Thioredoxin reductase; structural genomics, center 99.34
2ywl_A180 Thioredoxin reductase related protein; uncharacter 99.33
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 99.33
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 99.32
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 99.32
4dgk_A501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 99.28
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 99.28
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 99.26
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 99.25
3oz2_A397 Digeranylgeranylglycerophospholipid reductase; str 99.25
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 99.25
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 99.25
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 99.24
1ojt_A482 Surface protein; redox-active center, glycolysis, 99.23
2gag_B405 Heterotetrameric sarcosine oxidase beta-subunit; f 99.23
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 99.23
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 99.23
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 99.22
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 99.22
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 99.22
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 99.21
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 99.2
3e1t_A512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 99.2
3atr_A453 Conserved archaeal protein; saturating double bond 99.2
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 99.18
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 99.18
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 99.17
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 99.17
3ps9_A676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 99.16
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 99.15
3sx6_A437 Sulfide-quinone reductase, putative; sulfide:quino 99.15
3i3l_A591 Alkylhalidase CMLS; flavin-dependent halogenase, c 99.14
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 99.14
4dna_A463 Probable glutathione reductase; structural genomic 99.14
3pvc_A689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 99.13
3da1_A561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 99.12
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 99.12
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 99.11
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 99.11
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 99.11
1pj5_A 830 N,N-dimethylglycine oxidase; channelling, FAD bind 99.11
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 99.1
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 99.07
2gmh_A584 Electron transfer flavoprotein-ubiquinone oxidored 99.07
3axb_A448 Putative oxidoreductase; dinucleotide-binding fold 99.06
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 99.06
3fmw_A570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 99.04
3ihg_A535 RDME; flavoenzyme, anthracycline, polyketide biosy 99.02
2aqj_A538 Tryptophan halogenase, pRNA; flavin-dependent halo 99.02
2e4g_A550 Tryptophan halogenase; flavin-binding, rebeccamyci 99.02
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 99.01
2qa1_A500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 99.01
2pyx_A526 Tryptophan halogenase; structural genomics, JOI fo 99.0
3c96_A410 Flavin-containing monooxygenase; FAD, oxidoreducta 99.0
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 99.0
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 99.0
3vrd_B401 FCCB subunit, flavocytochrome C flavin subunit; su 99.0
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 98.99
2weu_A511 Tryptophan 5-halogenase; regioselectivity, antifun 98.99
2qcu_A501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 98.99
2rgh_A571 Alpha-glycerophosphate oxidase; flavoprotein oxida 98.98
2r0c_A549 REBC; flavin adenine dinucleotide, monooxygenase, 98.97
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 98.97
3c4n_A405 Uncharacterized protein DR_0571; alpha-beta protei 98.96
2qa2_A499 CABE, polyketide oxygenase CABE; FAD, angucycline, 98.95
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 98.94
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 98.94
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 98.9
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 98.89
2bry_A497 NEDD9 interacting protein with calponin homology a 98.88
2dkh_A639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 98.88
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 98.88
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 98.88
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 98.85
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 98.85
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 98.83
1c0p_A363 D-amino acid oxidase; alpha-beta-alpha motif, flav 98.82
3gwf_A540 Cyclohexanone monooxygenase; flavoprotein biocatal 98.8
3uox_A545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 98.8
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 98.79
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 98.79
4ap3_A549 Steroid monooxygenase; oxidoreductase, baeyer-vill 98.77
1w4x_A542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 98.76
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 98.75
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 98.73
4hb9_A412 Similarities with probable monooxygenase; flavin, 98.71
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 98.7
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 98.68
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 98.67
3g3e_A351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 98.66
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 98.65
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 98.63
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 98.63
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 98.62
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 98.61
3qvp_A583 Glucose oxidase; oxidoreductase; HET: NAG BMA MAN 98.6
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 98.59
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 98.59
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 98.58
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 98.58
4gde_A513 UDP-galactopyranose mutase; flavin adenine dinucle 98.58
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 98.57
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 98.57
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 98.56
3i6d_A470 Protoporphyrinogen oxidase; protein-inhibitor comp 98.56
1pn0_A665 Phenol 2-monooxygenase; two dimers, TLS refinement 98.54
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 98.54
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 98.52
3p1w_A475 Rabgdi protein; GDI RAB, malaria, structural genom 98.51
1fec_A490 Trypanothione reductase; redox-active center, oxid 98.51
1s3e_A520 Amine oxidase [flavin-containing] B; human monoami 98.49
3q9t_A577 Choline dehydrogenase and related flavoproteins; g 98.48
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 98.47
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 98.47
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 98.46
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 98.46
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 98.44
3nks_A477 Protoporphyrinogen oxidase; FAD containing protein 98.44
3h28_A430 Sulfide-quinone reductase; monotopic membrane prot 98.43
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 98.42
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 98.42
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 98.42
3t37_A526 Probable dehydrogenase; BET alpha beta fold, ADP b 98.41
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 98.41
2ivd_A478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 98.4
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 98.39
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 98.39
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 98.38
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 98.37
3pl8_A623 Pyranose 2-oxidase; substrate complex, H167A mutan 98.36
2vvm_A495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 98.36
3lov_A475 Protoporphyrinogen oxidase; structural genomics, J 98.36
3hyw_A430 Sulfide-quinone reductase; monotopic membrane prot 98.36
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 98.34
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 98.33
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 98.33
1y56_A493 Hypothetical protein PH1363; dehydrogenase, protei 98.33
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 98.32
3c4a_A381 Probable tryptophan hydroxylase VIOD; alpha-beta p 98.31
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 98.3
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 98.25
3fim_B566 ARYL-alcohol oxidase; AAO, lignin degradation, oxi 98.25
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 98.24
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 98.2
2jbv_A546 Choline oxidase; alcohol oxidation, flavoenyzme ox 98.16
4gut_A776 Lysine-specific histone demethylase 1B; histone de 98.16
3ihm_A430 Styrene monooxygenase A; rossman fold, anti-parall 98.15
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 98.14
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 98.14
2bcg_G453 Secretory pathway GDP dissociation inhibitor; RABG 98.12
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 98.12
3fpz_A326 Thiazole biosynthetic enzyme; FAD, mitochondrion, 98.12
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 98.1
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 98.06
4b63_A501 L-ornithine N5 monooxygenase; oxidoreductase, side 98.05
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 98.05
2b9w_A424 Putative aminooxidase; isomerase, conjugated linol 98.02
1v0j_A399 UDP-galactopyranose mutase; flavoprotein, isomeras 98.02
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 98.0
1n4w_A504 CHOD, cholesterol oxidase; flavoenzyme, steroid me 98.0
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 98.0
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 97.99
1gpe_A587 Protein (glucose oxidase); oxidoreductase(flavopro 97.98
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 97.97
4g6h_A502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 97.96
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 97.95
1fec_A490 Trypanothione reductase; redox-active center, oxid 97.94
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 97.93
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 97.93
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 97.91
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 97.9
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 97.9
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 97.89
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 97.88
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 97.86
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 97.86
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 97.86
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 97.85
2yg5_A453 Putrescine oxidase; oxidoreductase, flavin; HET: F 97.84
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 97.84
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 97.83
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 97.82
4dsg_A484 UDP-galactopyranose mutase; rossmann fold, flavin 97.8
4dna_A463 Probable glutathione reductase; structural genomic 97.8
1ojt_A482 Surface protein; redox-active center, glycolysis, 97.79
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 97.78
3hdq_A397 UDP-galactopyranose mutase; substrate and inhibito 97.78
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 97.78
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 97.75
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 97.74
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 97.74
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 97.74
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 97.73
1i8t_A367 UDP-galactopyranose mutase; rossman fold, FAD, con 97.71
2jae_A489 L-amino acid oxidase; oxidoreductase, dimerisation 97.71
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 97.71
1d5t_A433 Guanine nucleotide dissociation inhibitor; ultra-h 97.71
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 97.7
1sez_A504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 97.69
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 97.69
1rsg_A516 FMS1 protein; FAD binding motif, oxidoreductase; H 97.69
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 97.68
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 97.67
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 97.66
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 97.65
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 97.65
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 97.64
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 97.63
2e1m_A376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 97.63
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 97.61
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 97.61
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 97.59
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 97.59
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 97.58
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 97.51
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 97.49
3r9u_A315 Thioredoxin reductase; structural genomics, center 97.49
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 97.45
2iid_A498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 97.43
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 97.42
2bi7_A384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 97.41
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 97.4
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 97.38
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 97.37
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 97.37
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 97.33
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 97.32
1ju2_A536 HydroxynitrIle lyase; flavin, GMC oxidoreductase, 97.32
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 97.27
1b37_A472 Protein (polyamine oxidase); flavin-dependent amin 97.26
1kdg_A546 CDH, cellobiose dehydrogenase; GMC oxidoreductase, 97.25
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 97.22
3gwf_A540 Cyclohexanone monooxygenase; flavoprotein biocatal 97.19
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 97.17
4g6h_A502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 97.14
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 97.14
3k30_A690 Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi 97.1
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 97.08
1vg0_A650 RAB proteins geranylgeranyltransferase component A 97.05
2z3y_A662 Lysine-specific histone demethylase 1; chromatin, 97.02
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 97.02
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 97.01
3uox_A545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 96.99
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 96.98
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 96.89
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 96.89
4ap3_A549 Steroid monooxygenase; oxidoreductase, baeyer-vill 96.88
2xag_A852 Lysine-specific histone demethylase 1; amine oxida 96.87
1coy_A507 Cholesterol oxidase; oxidoreductase(oxygen recepto 96.86
1cjc_A460 Protein (adrenodoxin reductase); flavoenzyme, MAD 96.77
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 96.57
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 96.55
1gte_A1025 Dihydropyrimidine dehydrogenase; electron transfer 96.48
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 96.48
1cjc_A460 Protein (adrenodoxin reductase); flavoenzyme, MAD 96.3
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 96.28
1o94_A729 Tmadh, trimethylamine dehydrogenase; electron tran 96.21
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 96.18
4fk1_A304 Putative thioredoxin reductase; structural genomic 96.01
3ayj_A721 Pro-enzyme of L-phenylalanine oxidase; amino acid 95.99
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 95.96
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 95.96
1ps9_A671 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel 95.62
4b63_A501 L-ornithine N5 monooxygenase; oxidoreductase, side 94.86
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 94.76
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 94.69
1w4x_A542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 94.37
3h28_A430 Sulfide-quinone reductase; monotopic membrane prot 94.19
3sx6_A437 Sulfide-quinone reductase, putative; sulfide:quino 93.11
1lss_A140 TRK system potassium uptake protein TRKA homolog; 93.1
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 93.08
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 92.87
3ado_A319 Lambda-crystallin; L-gulonate 3-dehydrogenase, str 92.81
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 92.51
3i83_A320 2-dehydropantoate 2-reductase; structural genomics 92.4
3hn2_A312 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, str 92.23
4e12_A283 Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1 91.98
1id1_A153 Putative potassium channel protein; RCK domain, E. 91.97
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 91.91
3g17_A294 Similar to 2-dehydropantoate 2-reductase; structur 91.64
3hyw_A430 Sulfide-quinone reductase; monotopic membrane prot 91.17
2dpo_A319 L-gulonate 3-dehydrogenase; structural genomics, N 90.95
1f0y_A302 HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive 90.83
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 90.61
3ego_A307 Probable 2-dehydropantoate 2-reductase; structural 90.42
3ghy_A335 Ketopantoate reductase protein; oxidoreductase, NA 90.4
3gg2_A450 Sugar dehydrogenase, UDP-glucose/GDP-mannose dehyd 90.23
3c85_A183 Putative glutathione-regulated potassium-efflux S 90.14
3tl2_A315 Malate dehydrogenase; center for structural genomi 89.91
2ewd_A317 Lactate dehydrogenase,; protein-substrate_cofactor 89.77
1y6j_A318 L-lactate dehydrogenase; southeast collaboratory f 89.66
1bg6_A359 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L 89.59
3mog_A483 Probable 3-hydroxybutyryl-COA dehydrogenase; struc 89.5
2ew2_A316 2-dehydropantoate 2-reductase, putative; alpha-str 89.41
2bcg_G453 Secretory pathway GDP dissociation inhibitor; RABG 89.37
1pzg_A331 LDH, lactate dehydrogenase; apicomplexa, APAD, tet 89.32
3k96_A356 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA 89.25
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 88.97
3qha_A296 Putative oxidoreductase; seattle structural genomi 88.94
3dfz_A223 SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase 88.94
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 88.76
4dio_A405 NAD(P) transhydrogenase subunit alpha PART 1; stru 88.72
3g0o_A303 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine 88.71
4ffl_A363 PYLC; amino acid, biosynthesis of pyrrolysine, iso 88.69
3l6d_A306 Putative oxidoreductase; structural genomics, prot 88.18
1t2d_A322 LDH-P, L-lactate dehydrogenase; ternary complex, o 88.11
2hjr_A328 Malate dehydrogenase; malaria, structural genomics 88.06
1ks9_A291 KPA reductase;, 2-dehydropantoate 2-reductase; PAN 87.97
1lld_A319 L-lactate dehydrogenase; oxidoreductase(CHOH (D)-N 87.97
2x5o_A439 UDP-N-acetylmuramoylalanine--D-glutamate ligase; A 87.8
1d5t_A433 Guanine nucleotide dissociation inhibitor; ultra-h 87.66
1jw9_B249 Molybdopterin biosynthesis MOEB protein; MOEB: mod 87.65
2raf_A209 Putative dinucleotide-binding oxidoreductase; NP_7 87.43
1kyq_A274 Met8P, siroheme biosynthesis protein Met8; homodim 87.16
1ur5_A309 Malate dehydrogenase; oxidoreductase, tricarboxyli 87.05
1zcj_A463 Peroxisomal bifunctional enzyme; peroxisomal multi 87.05
1z82_A335 Glycerol-3-phosphate dehydrogenase; TM0378, struct 86.95
3p2y_A381 Alanine dehydrogenase/pyridine nucleotide transhy; 86.91
2y0c_A478 BCEC, UDP-glucose dehydrogenase; oxidoreductase, c 86.72
4a7p_A446 UDP-glucose dehydrogenase; oxidoreductase, carbohy 86.19
3lk7_A451 UDP-N-acetylmuramoylalanine--D-glutamate ligase; a 86.11
4huj_A220 Uncharacterized protein; PSI-biology, nysgrc, stru 86.01
2v6b_A304 L-LDH, L-lactate dehydrogenase; oxidoreductase, ra 85.95
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 85.93
3k6j_A460 Protein F01G10.3, confirmed by transcript evidenc; 85.88
2a9f_A398 Putative malic enzyme ((S)-malate:NAD+ oxidoreduct 85.86
1kdg_A546 CDH, cellobiose dehydrogenase; GMC oxidoreductase, 85.76
3qsg_A312 NAD-binding phosphogluconate dehydrogenase-like P; 85.75
1coy_A507 Cholesterol oxidase; oxidoreductase(oxygen recepto 85.73
1x13_A401 NAD(P) transhydrogenase subunit alpha; NAD(H)-bind 85.68
1y56_A493 Hypothetical protein PH1363; dehydrogenase, protei 85.65
1ldn_A316 L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NA 85.53
1evy_A366 Glycerol-3-phosphate dehydrogenase; rossmann fold, 85.51
1l7d_A384 Nicotinamide nucleotide transhydrogenase, subunit 85.46
3c7a_A404 Octopine dehydrogenase; L) stereospecific opine de 85.44
2q3e_A467 UDP-glucose 6-dehydrogenase; hexamer, structural g 85.04
3hwr_A318 2-dehydropantoate 2-reductase; YP_299159.1, PANE/A 84.92
3g79_A478 NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; 84.84
3doj_A310 AT3G25530, dehydrogenase-like protein; gamma-hydro 84.82
1zej_A293 HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural 84.8
4ezb_A317 Uncharacterized conserved protein; structural geno 84.77
2uyy_A316 N-PAC protein; long-chain dehydrogenase, cytokine; 84.73
3vtf_A444 UDP-glucose 6-dehydrogenase; two discrete alpha/be 84.62
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 84.6
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 84.57
3phh_A269 Shikimate dehydrogenase; shikimate pathway, helico 84.46
3gvi_A324 Malate dehydrogenase; NAD, oxidoreductase, tricarb 84.46
1vpd_A299 Tartronate semialdehyde reductase; structural geno 84.29
2qyt_A317 2-dehydropantoate 2-reductase; APC81190, porphyrom 83.89
3gt0_A247 Pyrroline-5-carboxylate reductase; structural geno 83.8
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 83.74
3d0o_A317 L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, gly 83.68
2cul_A232 Glucose-inhibited division protein A-related PROT 83.65
1vl6_A388 Malate oxidoreductase; TM0542, NAD-dependent malic 83.65
1yj8_A375 Glycerol-3-phosphate dehydrogenase; SGPP, structur 83.62
3fi9_A343 Malate dehydrogenase; structural genomics, oxidore 83.27
3cky_A301 2-hydroxymethyl glutarate dehydrogenase; rossmann 83.05
1guz_A310 Malate dehydrogenase; oxidoreductase, tricarboxyli 82.99
3p7m_A321 Malate dehydrogenase; putative dehydrogenase, enzy 82.97
1mv8_A436 GMD, GDP-mannose 6-dehydrogenase; rossman fold, do 82.86
3dtt_A245 NADP oxidoreductase; structural genomics, joint ce 82.6
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 82.5
3c24_A286 Putative oxidoreductase; YP_511008.1, structural g 82.37
4dll_A320 2-hydroxy-3-oxopropionate reductase; structural ge 82.33
1txg_A335 Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxid 82.21
3pef_A287 6-phosphogluconate dehydrogenase, NAD-binding; gam 82.08
3pid_A432 UDP-glucose 6-dehydrogenase; rossmann fold, oxidor 82.08
3pqe_A326 L-LDH, L-lactate dehydrogenase; FBP, oxidoreductas 82.06
3rui_A340 Ubiquitin-like modifier-activating enzyme ATG7; au 82.06
2h78_A302 Hibadh, 3-hydroxyisobutyrate dehydrogenase; APC601 81.93
1hyh_A309 L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2 81.92
2vns_A215 Metalloreductase steap3; metal-binding, transmembr 81.8
3pdu_A287 3-hydroxyisobutyrate dehydrogenase family protein; 81.67
1a5z_A319 L-lactate dehydrogenase; oxidoreductase, glycolysi 81.41
1zud_1251 Adenylyltransferase THIF; thiamin, thiazole, prote 81.4
2p4q_A497 6-phosphogluconate dehydrogenase, decarboxylating; 81.35
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 81.19
4e21_A358 6-phosphogluconate dehydrogenase (decarboxylating; 80.99
2zyd_A480 6-phosphogluconate dehydrogenase, decarboxylating; 80.98
3h8v_A292 Ubiquitin-like modifier-activating enzyme 5; rossm 80.94
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 80.87
1dlj_A402 UDP-glucose dehydrogenase; rossmann fold, ternary 80.77
1ez4_A318 Lactate dehydrogenase; rossmann fold, oxidoreducta 80.41
2wtb_A725 MFP2, fatty acid multifunctional protein (ATMFP2); 80.39
2i6t_A303 Ubiquitin-conjugating enzyme E2-like isoform A; L- 80.33
3ius_A286 Uncharacterized conserved protein; APC63810, silic 80.27
3eag_A326 UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME 80.22
3l9w_A413 Glutathione-regulated potassium-efflux system Pro 80.18
1jay_A212 Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossma 80.07
3ktd_A341 Prephenate dehydrogenase; structural genomics, joi 80.06
2rcy_A262 Pyrroline carboxylate reductase; malaria, structur 80.04
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
Probab=100.00  E-value=1.7e-147  Score=1240.49  Aligned_cols=617  Identities=62%  Similarity=1.022  Sum_probs=485.5

Q ss_pred             CCcccEEEECcchHHHHHHHHHhhCCCcEEEEccCCCCCCcccccCCCCccchhhHHHHHHHhccHHHHHHhhcCCeEee
Q psy9395           4 KSKFDVIVVGGGHAGTEAALVSARMGQKTLLLSHNIDTIGQMSCNPSIGGIGKSHLVKEIDAMGGIMAIATDKSGIQFRI   83 (637)
Q Consensus         4 ~~~yDViVIGgG~AGl~AA~~lA~~G~~V~LiE~~~~~~G~~~cn~s~gg~~~~~l~~el~~~gg~~~~~~~~~gi~~~~   83 (637)
                      +..|||||||||+||++||++||+.|++|+|||++...+|.+.||++.+|.+.++++++++.+++.+..+.+..++++..
T Consensus        26 ~~~yDVIVIGgG~AGl~AAlaLAr~G~kVlLIEk~~~~iG~~~Cnps~ggia~~~lv~ei~algg~~~~~~d~~gi~f~~  105 (651)
T 3ces_A           26 PDPFDVIIIGGGHAGTEAAMAAARMGQQTLLLTHNIDTLGQMSCNPAIGGIGKGHLVKEVDALGGLMAKAIDQAGIQFRI  105 (651)
T ss_dssp             SSCEEEEEECCSHHHHHHHHHHHHTTCCEEEEESCGGGTTCCSSSSEEESTTHHHHHHHHHHTTCSHHHHHHHHEEEEEE
T ss_pred             CCcCCEEEECChHHHHHHHHHHHhCCCCEEEEeecccccccccccccccchhhHHHHHHHHHhccHHHHHhhhcccchhh
Confidence            35699999999999999999999999999999997557889999999999999999999999999888888999999999


Q ss_pred             eccccCchhhhhhhccCHHHHHHHHHHHHHhcCCeEEEcceeEEEEEeCCeEEEEEEecceEEEeceEEEecccccCCce
Q psy9395          84 LNSSKGAAVRATRAQVDRILYKQAIRFYLENQLNLYLFQEEVDDLIIKTNKILGVVTKIGIKFFSKTVILTTGTFLNGKI  163 (637)
Q Consensus        84 l~~~~gp~~~~~~~~~d~~~~~~~l~~~l~~~~gv~i~~~~V~~i~~~~~~v~gV~~~~g~~i~a~~VIlAtG~~~~~~~  163 (637)
                      ++..++|+++.++.++|+..+...+.+.+++++|+++++++|+++..+++++++|.+.+|..+.|+.||+|||+|++++.
T Consensus       106 l~~~kgpav~~~r~~~Dr~~~~~~L~e~Le~~~GV~I~~~~V~~L~~e~g~V~GV~t~dG~~I~Ad~VVLATGt~s~~~~  185 (651)
T 3ces_A          106 LNASKGPAVRATRAQADRVLYRQAVRTALENQPNLMIFQQAVEDLIVENDRVVGAVTQMGLKFRAKAVVLTVGTFLDGKI  185 (651)
T ss_dssp             ESTTSCGGGCEEEEEECHHHHHHHHHHHHHTCTTEEEEECCEEEEEESSSBEEEEEETTSEEEEEEEEEECCSTTTCCEE
T ss_pred             hhcccCcccccchhhCCHHHHHHHHHHHHHhCCCCEEEEEEEEEEEecCCEEEEEEECCCCEEECCEEEEcCCCCccCcc
Confidence            99889999888888999999999999999876799999899999988888899999988989999999999999999999


Q ss_pred             eecccccCCCCccccchHHHHHHHHhcCccceecccCCCCcccccccccchhhcccCCCCCCceeeecCCCcCCCccccc
Q psy9395         164 HIGLKSYSAGRFGDFSTTSLAKRLKELQLSHGRLKTGTPPRIDKRTIDFSKMEEQIGDFDPVPVFSVLGNINLHPKQLSC  243 (637)
Q Consensus       164 ~ig~~~~~~g~~g~~~~~~l~~~l~~~G~~~~~~~~g~~p~~~~~si~~~~~~~~~~d~~~~~~fs~~~~~~~~~~~~sc  243 (637)
                      ++|...++.|+.|+..+..++..|.++|+++.++++|+||+++.++||+++++.+++| ..+.+|||++.......+++|
T Consensus       186 i~G~~~~~~griGg~~a~eLA~~L~~lG~~v~~~~tgtpprid~~sId~~~~~~q~~d-~~~~~fsf~~~~~~~~~q~~c  264 (651)
T 3ces_A          186 HIGLDNYSGGRAGDPPSIPLSRRLRELPLRVGRLKTGTPPRIDARTIDFSVLAQQHGD-NPMPVFSFMGNASQHPQQVPC  264 (651)
T ss_dssp             ECC-------------CCHHHHHHHTTTCCEEEECCEECCEEEGGGSCGGGSEEECCC-SSCCCSSTTCCGGGSCCCCCE
T ss_pred             ccCcccCCCCCccchhhhHHHHHHHhcCCeEEEecCCCCCcccccccChHHheeeccC-CCCCCCccCCCCCCcccceec
Confidence            9999888888999888889999999999999999999999999999999999999999 788889998652104579999


Q ss_pred             ccccccccccccccccccccccccccccccCCCCcccHHHHhhccCCCcccccccccCCCCCcceecCcccCCCCHHHHH
Q psy9395         244 FITHTNEKTHNIIRSEFKNSPIFSGKIESIGPRYCPSIEDKVYRFPKKKSHHIFLEPEGIVINEYYPNGISTSLPFEAQI  323 (637)
Q Consensus       244 ~~t~t~~~~~~ii~~~~~~~~~~~g~~~~~G~r~~psie~~~~~f~~~~~~~~~le~~gl~~~~~~~~g~~~~l~~~~q~  323 (637)
                      ++++|+.++|++++.+++.+++|.|.+.+.|||||||||+++.+|+++..|++||||||++++++|++|+|++||+++|.
T Consensus       265 ~~t~t~~~~~~ii~~~~~~~~~~~g~i~~~Gprycpsie~k~~rf~~k~~~~i~lepeg~~~~~~y~~G~st~lp~~~q~  344 (651)
T 3ces_A          265 YITHTNEKTHDVIRSNLDRSPMYAGVIEGVGPRYCPSIEDKVMRFADRNQHQIFLEPEGLTSNEIYPNGISTSLPFDVQM  344 (651)
T ss_dssp             EEEECCHHHHHHHHHTGGGC---------------CCHHHHHHHSCSSSCCEEEEEESCTTCCEEEEETCCCCSCHHHHH
T ss_pred             ceeCccHHHHHHHHhcccccCcccccccccCCcccccccccccccCCCccceeEeccccccCCeeeecCCCCCCCHHHHH
Confidence            99999999999999999999999999999999999999999999999889999999999999999999999999999999


Q ss_pred             HHHHhccCCcceEEeccccccccceeCccccCccccccCCCCEEEEEeecCCCCHHHHHHHHHHHHHHHHHHhCCCCCCC
Q psy9395         324 ELVQSIDGMKNANIIRPGYAIEYDYFNPCNLKSSLETKQIHGLFFAGQINGTTGYEEAASQGLLAGLNAALFSQDRDPWI  403 (637)
Q Consensus       324 ~~~~~i~gle~a~v~~~G~~~e~~~v~~~~l~~tlesk~v~gLf~aGei~G~~Gy~eA~a~G~~AG~naa~~~~~~~~~~  403 (637)
                      +++++|||||||+|+||||+||||||||++|++|||+|.+|||||||||||++||+||||||++||+|||++++|++|++
T Consensus       345 ~~~~~ipGle~a~i~r~Gy~ieyd~i~p~~L~~tle~k~~~gLf~AGqinGttGYeEAaaqGl~AG~nAa~~~~~~~~~~  424 (651)
T 3ces_A          345 QIVRSMQGMENAKIVRPGYAIEYDFFDPRDLKPTLESKFIQGLFFAGQINGTTGYEEAAAQGLLAGLNAARLSADKEGWA  424 (651)
T ss_dssp             HHHHTSTTCTTCCEEECCEEEEEEEECGGGBCTTSBBSSSBTEEECSGGGTCCCHHHHHHHHHHHHHHHHHHHTTCCCCC
T ss_pred             HHHhhCCCccceEEEeccceeccCccchhhcCccccccCCCCeEEEEEecCCcChHHHHHHHHHHHHHHHHHhcCCCCCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCccchhhhhHHHHhhhcCCCCccccccchHHHhhhcccccccccccccccccCCCCHHHHHHHHHHHHHHHHHHHHhhc
Q psy9395         404 PGRDQAYLGVLVDDLITKGIQEPYRMFTSRAEYRLNLREDNADLRLTEIGWKLGCVSYKQWKIFEKKREIITKELQRLKD  483 (637)
Q Consensus       404 ~~r~~~~ig~l~~~l~~~~~~epyrm~tsr~e~rl~~r~dn~~~r~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~l~~  483 (637)
                      ++|++||||||||||+||||+||||||||||||||+||+||||.||||+|+++|||+++||+.|++|++.+++++++|++
T Consensus       425 ~~r~~ayiG~liddl~t~g~~epyrm~tsrae~rl~lr~dnad~rl~~~~~~~gl~~~~~~~~~~~~~~~~~~~~~~l~~  504 (651)
T 3ces_A          425 PARSQAYLGVLVDDLCTLGTKEPYRMFTSRAEYRLMLREDNADLRLTEIGRELGLVDDERWARFNEKLENIERERQRLKS  504 (651)
T ss_dssp             CCTTTCHHHHHHHHHHHHSSCCCGGGHHHHHTTCSTTCGGGHHHHHHHHHHHHTCCCHHHHHHHHHHHHHHHHHHHHHHT
T ss_pred             CChhhhhhhhHHHHHHHhcccchHHhhhhHHHHHHHhcccchhhhchHhHhHhCCCCHHHHHHHHHHHHHHHHHHHHHhc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ceeCCccccccccccccccccCcccCHHhhhcCCCCChhhHhcccccCCCCCccccCCc-HHHHHHHHHHhhcHHHHHHH
Q psy9395         484 TWINPSILNTGESERVLGKRIKHEYSLSNLLTWPNVNYNTLTSLKGINGKNLYNTEIYQ-EDIKKQLKIQLQYEGYILRQ  562 (637)
Q Consensus       484 ~~~~~~~~~~~~~~~~~~~~~~~~~s~~~ll~r~~v~~~~l~~~~~~~~~~~~~~~~~~-~~~~~~veie~kY~gYi~rq  562 (637)
                      ++++|.+.++..+.....+++....|++|||+||+|+|++|.++.|....       ++ +++.++|||++||+|||+||
T Consensus       505 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~-------~~~~~~~~~~~~~~~y~~y~~~~  577 (651)
T 3ces_A          505 TWVTPSAEAAAEVNAHLTAPLSREASGEDLLRRPEMTYEKLTTLTPFAPA-------LTDEQAAEQVEIQVKYEGYIARQ  577 (651)
T ss_dssp             CEECTTSTTHHHHHTTSSSCCSSCEEHHHHHTSTTCCHHHHTTSTTTCCC-------CSCHHHHHHHHHHHHTTC-----
T ss_pred             CccCchHHHHHHHHHhcCCcccccCCHHHHhCCCCCCHHHHHhhcCCccC-------CCHHHHHHHHHHHhhHHHHHHHH
Confidence            99998766665665555566777889999999999999999998775222       67 89999999999999999999


Q ss_pred             HHHHHHHHhhcccCCCCCCCCCCCcCccHHHHHHhhccCCCCHHHhhcCCCCCHHHHHHHHHHHhc
Q psy9395         563 INEVEKNKINENLKLPHNLDYMKIQSLSIEARQKLNKYKPETIGQASRISGVTPAALTLLLIYLKS  628 (637)
Q Consensus       563 ~~~i~~~~~~e~~~iP~d~dY~~i~~LS~E~~ekL~~~rP~tlgqAsrI~GvtPa~i~~L~~~l~~  628 (637)
                      +++|++++++|+++||+||||+.|+|||+|+||||+++||.||||||||||||||||+.|++||++
T Consensus       578 ~~~~~~~~~~e~~~~p~~~~y~~~~~ls~e~~~kl~~~~p~~~~~a~ri~gv~p~~~~~l~~~~~~  643 (651)
T 3ces_A          578 QDEIEKQLRNENTLLPATLDYRQVSGLSNEVIAKLNDHKPASIGQASRISGVTPAAISILLVWLKK  643 (651)
T ss_dssp             ------------------------------------------------------------------
T ss_pred             HHHHHHHHHhhcCCCcCCCCcccCCCcCHHHHHHHHhcCCCCHHHHhhCCCCCHHHHHHHHHHHhh
Confidence            999999999999999999999999999999999999999999999999999999999999999986
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>3g5s_A Methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TRMFO; tRNA methyltransferase FAD folate, FAD, flavoprotein; HET: MSE FAD GSH; 1.05A {Thermus thermophilus} PDB: 3g5q_A* 3g5r_A* Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Back     alignment and structure
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Back     alignment and structure
>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Back     alignment and structure
>3q9t_A Choline dehydrogenase and related flavoproteins; glucose-methanol-choline oxidoreductase family, formate OXID formyl-FAD, oxidoreductase; HET: FAY; 2.24A {Aspergillus oryzae} Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti} Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>3c4a_A Probable tryptophan hydroxylase VIOD; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.30A {Chromobacterium violaceum atcc 12472} Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii} Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A* Back     alignment and structure
>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* Back     alignment and structure
>3ihm_A Styrene monooxygenase A; rossman fold, anti-parallel beta strands, dimer, cavity, oxidoreductase; 2.30A {Pseudomonas putida} Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>3fpz_A Thiazole biosynthetic enzyme; FAD, mitochondrion, N thiamine biosynthesis, transit peptide, biosynthetic protei; HET: AHZ; 1.82A {Saccharomyces cerevisiae} Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1 Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A* Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Back     alignment and structure
>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Back     alignment and structure
>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>1o94_A Tmadh, trimethylamine dehydrogenase; electron transport, protein complex; HET: FMN ADP AMP; 2.0A {Methylophilus methylotrophus} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 PDB: 1djn_A* 1o95_A* 2tmd_A* 1djq_A* Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>3ado_A Lambda-crystallin; L-gulonate 3-dehydrogenase, structural genomics, riken struc genomics/proteomics initiative, RSGI, acetylation; 1.70A {Oryctolagus cuniculus} PDB: 3adp_A* 3f3s_A* Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>3i83_A 2-dehydropantoate 2-reductase; structural genomics, oxidoreductase, NADP, pantothenate BIOS PSI-2, protein structure initiative; 1.90A {Methylococcus capsulatus} Back     alignment and structure
>3hn2_A 2-dehydropantoate 2-reductase; PSI-2, NYSGXRC, structural GE protein structure initiative; 2.50A {Geobacter metallireducens} Back     alignment and structure
>4e12_A Diketoreductase; oxidoreductase, NADH; HET: 1PE; 1.93A {Acinetobacter baylyi} PDB: 4dyd_A* 4e13_A* Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>3g17_A Similar to 2-dehydropantoate 2-reductase; structural genomics, putative 2-dehydropantoate 2-reductase, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>1f0y_A HCDH, L-3-hydroxyacyl-COA dehydrogenase; abortive ternary complex, oxidoreductase; HET: CAA NAD; 1.80A {Homo sapiens} SCOP: a.100.1.3 c.2.1.6 PDB: 3rqs_A 1lsj_A* 1il0_A* 1lso_A* 1m76_A* 1m75_A* 1f14_A 1f12_A 1f17_A* 3had_A* 2hdh_A* 3hdh_A* Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>3ego_A Probable 2-dehydropantoate 2-reductase; structural genomics, PANE, unknown function, cytoplasm, NADP, oxidoreductase; 1.90A {Bacillus subtilis} Back     alignment and structure
>3ghy_A Ketopantoate reductase protein; oxidoreductase, NAD-binding domain, PSI-2, NYSGXRC, structur genomics, protein structure initiative; 2.00A {Ralstonia solanacearum} Back     alignment and structure
>3gg2_A Sugar dehydrogenase, UDP-glucose/GDP-mannose dehydrogenase family; structural genomics, oxidoreductase, PSI-2; HET: UGA; 1.70A {Porphyromonas gingivalis} Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3tl2_A Malate dehydrogenase; center for structural genomics of infectious diseases, csgid dehydrogenase, oxidoreductase, citric acid cycle; 1.70A {Bacillus anthracis} Back     alignment and structure
>2ewd_A Lactate dehydrogenase,; protein-substrate_cofactor analog complex, oxidoreductase; HET: A3D; 2.00A {Cryptosporidium parvum} PDB: 2frm_A 2fn7_A* 2fnz_A* 2fm3_A Back     alignment and structure
>1y6j_A L-lactate dehydrogenase; southeast collaboratory for structural genomics, secsg, protein struc initiative, PSI, oxidoreductase; 3.01A {Clostridium thermocellum} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1bg6_A N-(1-D-carboxylethyl)-L-norvaline dehydrogenase; L) stereospecific opine dehydrogenase, oxidoreductase; 1.80A {Arthrobacter SP} SCOP: a.100.1.5 c.2.1.6 Back     alignment and structure
>3mog_A Probable 3-hydroxybutyryl-COA dehydrogenase; structural genomics, PSI, protein structure initiative, NYSG oxidoreductase; 2.20A {Escherichia coli} Back     alignment and structure
>2ew2_A 2-dehydropantoate 2-reductase, putative; alpha-structure, alpha-beta structure, structural genomics, protein structure initiative; HET: MSE; 2.00A {Enterococcus faecalis} Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>1pzg_A LDH, lactate dehydrogenase; apicomplexa, APAD, tetramer, rossmann fold, oxidoreductase; HET: CME A3D; 1.60A {Toxoplasma gondii} SCOP: c.2.1.5 d.162.1.1 PDB: 1pzf_A* 1pze_A* 1pzh_A* 3om9_A* 1sov_A 1sow_A* 3czm_A* Back     alignment and structure
>3k96_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; GPSA, IDP01976, oxidoreductase, phospholipid biosynthesis; HET: EPE; 2.10A {Coxiella burnetii} Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>3qha_A Putative oxidoreductase; seattle structural genomics center for infectious disease, S mycobacterium avium 104, rossmann fold; 2.25A {Mycobacterium avium} Back     alignment and structure
>3dfz_A SIRC, precorrin-2 dehydrogenase; NAD dehydrogenase, cobalamin biosynthesis, NAD, oxidoreducta porphyrin biosynthesis; 2.30A {Bacillus megaterium} Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>4dio_A NAD(P) transhydrogenase subunit alpha PART 1; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.60A {Sinorhizobium meliloti} Back     alignment and structure
>3g0o_A 3-hydroxyisobutyrate dehydrogenase; NAD(P), valine catabolism, tartaric acid, target 11128H, NYSGXRC, PSI-2, structural genomics; HET: TLA; 1.80A {Salmonella typhimurium} Back     alignment and structure
>4ffl_A PYLC; amino acid, biosynthesis of pyrrolysine, isopeptide bond for ATP-grAsp fold, ligase, ATP-binding, L-lysine and 3R-methyl ornithine; HET: LYS ADP ATP; 1.50A {Methanosarcina barkeri} PDB: 4ffm_A* 4ffn_A* 4ffo_A* 4ffp_A* 4ffr_A* Back     alignment and structure
>3l6d_A Putative oxidoreductase; structural genomics, protein structure initiative, oxidoredu PSI-2; HET: MSE; 1.90A {Pseudomonas putida} Back     alignment and structure
>1t2d_A LDH-P, L-lactate dehydrogenase; ternary complex, oxidoreductase; HET: NAD; 1.10A {Plasmodium falciparum} SCOP: c.2.1.5 d.162.1.1 PDB: 1t25_A* 1t26_A* 1t2c_A* 1t24_A* 2x8l_A 2ydn_A* 2a94_A* 1u4s_A* 1u5a_A* 1u5c_A* 1u4o_A* 1t2e_A* 1xiv_A* 1ceq_A 1ldg_A* 1cet_A* 1oc4_A* 2a92_A* 2aa3_A* Back     alignment and structure
>2hjr_A Malate dehydrogenase; malaria, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: CIT APR; 2.20A {Cryptosporidium parvum} Back     alignment and structure
>1ks9_A KPA reductase;, 2-dehydropantoate 2-reductase; PANE, APBA, ketopantoate reductase, rossman fold, monomer, APO, oxidoreductase; 1.70A {Escherichia coli} SCOP: a.100.1.7 c.2.1.6 PDB: 1yon_A* 1yjq_A* 2ofp_A* Back     alignment and structure
>1lld_A L-lactate dehydrogenase; oxidoreductase(CHOH (D)-NAD (A)); HET: NAD; 2.00A {Bifidobacterium longum subsp} SCOP: c.2.1.5 d.162.1.1 PDB: 1lth_T* Back     alignment and structure
>2x5o_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; ATP-binding, cell cycle, cell division, cell shape, cell WAL biogenesis/degradation; HET: KCX VSV; 1.46A {Escherichia coli} PDB: 2wjp_A* 2xpc_A* 2y1o_A* 2jff_A* 2jfh_A* 2uuo_A* 2uup_A* 2vtd_A* 2vte_A* 2jfg_A* 2y66_A* 2y67_A* 2y68_A* 4uag_A* 1e0d_A* 1uag_A* 1eeh_A* 3uag_A* 2uag_A* Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Back     alignment and structure
>1jw9_B Molybdopterin biosynthesis MOEB protein; MOEB: modified rossmann fold, (2) Cys-X-X-Cys zinc-binding M MOAD: ubiquitin-like fold; 1.70A {Escherichia coli} SCOP: c.111.1.1 PDB: 1jwa_B* 1jwb_B* Back     alignment and structure
>2raf_A Putative dinucleotide-binding oxidoreductase; NP_786167.1, NADP oxidoreductase coenzyme F420-dependent, structural genomics; HET: MSE NAP; 1.60A {Lactobacillus plantarum WCFS1} Back     alignment and structure
>1kyq_A Met8P, siroheme biosynthesis protein Met8; homodimer, oxidoreductase, lyase; HET: NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.2.1.11 e.37.1.1 Back     alignment and structure
>1ur5_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle; HET: NAD; 1.75A {Chloroflexus aurantiacus} SCOP: c.2.1.5 d.162.1.1 PDB: 1uxg_A* 1guy_A* 1uxk_A* 1uxh_A* 1uxj_A* 1uxi_A* Back     alignment and structure
>1zcj_A Peroxisomal bifunctional enzyme; peroxisomal multifunctional enzyme type 1, L-bifunction enzyme, MFE-1, fatty acid beta oxidation; 1.90A {Rattus norvegicus} Back     alignment and structure
>1z82_A Glycerol-3-phosphate dehydrogenase; TM0378, structural genom joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE NDP G3H G3P; 2.00A {Thermotoga maritima} Back     alignment and structure
>3p2y_A Alanine dehydrogenase/pyridine nucleotide transhy; seattle structural genomics center for infectious disease, S tuberculosis; 1.82A {Mycobacterium smegmatis str} Back     alignment and structure
>2y0c_A BCEC, UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide, C fibrosis; HET: UGA; 1.75A {Burkholderia cepacia} PDB: 2y0d_A* 2y0e_A* Back     alignment and structure
>4a7p_A UDP-glucose dehydrogenase; oxidoreductase, carbohydrate synthesis, exopolysaccharide; HET: NAD; 3.40A {Sphingomonas elodea} Back     alignment and structure
>3lk7_A UDP-N-acetylmuramoylalanine--D-glutamate ligase; agalacitae, PSI, MCSG, structural genomics, midwest center for structural genomics; HET: MSE; 1.50A {Streptococcus agalactiae} Back     alignment and structure
>4huj_A Uncharacterized protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, dinucleotide-binding; 1.77A {Sinorhizobium meliloti} Back     alignment and structure
>2v6b_A L-LDH, L-lactate dehydrogenase; oxidoreductase, radioresistance, NAD, cytoplasm, mesophilic, glycolysis; 2.50A {Deinococcus radiodurans} Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>3k6j_A Protein F01G10.3, confirmed by transcript evidenc; rossmann fold, oxidoreductase; 2.20A {Caenorhabditis elegans} Back     alignment and structure
>2a9f_A Putative malic enzyme ((S)-malate:NAD+ oxidoreductase (decarboxylating)); hypothetical protein, structural genomics, PSI; 2.50A {Streptococcus pyogenes} Back     alignment and structure
>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* Back     alignment and structure
>3qsg_A NAD-binding phosphogluconate dehydrogenase-like P; structural genomics, PSI-biology, midwest center for structu genomics; 1.90A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Back     alignment and structure
>1x13_A NAD(P) transhydrogenase subunit alpha; NAD(H)-binding domain, rossmann fold, oxidoreductase; 1.90A {Escherichia coli} PDB: 1x14_A* 1x15_A* 2bru_A* Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>1ldn_A L-lactate dehydrogenase; oxidoreductase(CHOH(D)-NAD(A)); HET: FBP NAD; 2.50A {Geobacillus stearothermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1ldb_A 2ldb_A* Back     alignment and structure
>1evy_A Glycerol-3-phosphate dehydrogenase; rossmann fold, oxidoreductase; HET: MYS; 1.75A {Leishmania mexicana} SCOP: a.100.1.6 c.2.1.6 PDB: 1evz_A* 1jdj_A* 1m66_A* 1m67_A* 1n1e_A* 1n1g_A* Back     alignment and structure
>1l7d_A Nicotinamide nucleotide transhydrogenase, subunit alpha 1; transhydrogenase domain I, oxidoreductase; 1.81A {Rhodospirillum rubrum} SCOP: c.2.1.4 c.23.12.2 PDB: 1hzz_A* 1f8g_A 1l7e_A* 1u28_A* 1u2d_A* 1u2g_A* 1xlt_A* 2oo5_A* 2oor_A* 2frd_A* 2fsv_A* 1nm5_A* 2fr8_A* 1ptj_A* Back     alignment and structure
>3c7a_A Octopine dehydrogenase; L) stereospecific opine dehydrogenas, oxidorecutase, oxidoreductase; HET: NAD; 2.10A {Pecten maximus} PDB: 3c7c_B* 3c7d_B* 3iqd_B* Back     alignment and structure
>2q3e_A UDP-glucose 6-dehydrogenase; hexamer, structural genomics, S genomics consortium, SGC, oxidoreductase; HET: NAD UPG; 2.00A {Homo sapiens} PDB: 2qg4_A* 3khu_A* 3itk_A* 3tdk_A* 3ptz_A* 3prj_A* 3tf5_A Back     alignment and structure
>3hwr_A 2-dehydropantoate 2-reductase; YP_299159.1, PANE/APBA family ketopantoate reductase, struct genomics, joint center for structural genomics; HET: NDP BCN; 2.15A {Ralstonia eutropha} Back     alignment and structure
>3g79_A NDP-N-acetyl-D-galactosaminuronic acid dehydrogen; structural genomics, protein structure initiative; 2.40A {Methanosarcina mazei GO1} Back     alignment and structure
>3doj_A AT3G25530, dehydrogenase-like protein; gamma-hydroxybutyrate dehydrogenase, 4-hydroxybutyrate dehydrogenase; 2.10A {Arabidopsis thaliana} Back     alignment and structure
>1zej_A HBD-9, 3-hydroxyacyl-COA dehydrogenase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI; HET: PE8; 2.00A {Archaeoglobus fulgidus} Back     alignment and structure
>4ezb_A Uncharacterized conserved protein; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>2uyy_A N-PAC protein; long-chain dehydrogenase, cytokine; HET: NA7; 2.5A {Homo sapiens} Back     alignment and structure
>3vtf_A UDP-glucose 6-dehydrogenase; two discrete alpha/beta domains, oxidoreducta; HET: UPG; 2.00A {Pyrobaculum islandicum} Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>3phh_A Shikimate dehydrogenase; shikimate pathway, helicobacter PYL oxidoreductase, alpha/beta domain, rossmann fold; HET: SKM; 1.42A {Helicobacter pylori} PDB: 3phg_A* 3phi_A* 3phj_A* 4foo_A 4fpx_A 4fos_A* 4fr5_A* 4fq8_A* Back     alignment and structure
>3gvi_A Malate dehydrogenase; NAD, oxidoreductase, tricarboxylic acid cycle, structural genomics; HET: ADP; 2.25A {Brucella melitensis biovar ABORTUS2308} PDB: 3gvh_A* Back     alignment and structure
>1vpd_A Tartronate semialdehyde reductase; structural genomics, MCSG, protein structure initiative, PSI, midwest center for structural genomics; HET: MSE TLA; 1.65A {Salmonella typhimurium} SCOP: a.100.1.1 c.2.1.6 Back     alignment and structure
>2qyt_A 2-dehydropantoate 2-reductase; APC81190, porphyromonas gingi W83, structural genomics, PSI-2; HET: MSE; 2.15A {Porphyromonas gingivalis} Back     alignment and structure
>3gt0_A Pyrroline-5-carboxylate reductase; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG; 2.00A {Bacillus cereus atcc 14579} Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>3d0o_A L-LDH 1, L-lactate dehydrogenase 1; cytoplasm, glycolysis, NAD, oxidoreductase, phosphoprotein; 1.80A {Staphylococcus aureus} PDB: 3d4p_A* 3h3j_A* Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>1vl6_A Malate oxidoreductase; TM0542, NAD-dependent malic enzyme, structural genomics, JCS protein structure initiative, PSI; 2.61A {Thermotoga maritima} SCOP: c.2.1.7 c.58.1.3 PDB: 2hae_A* Back     alignment and structure
>1yj8_A Glycerol-3-phosphate dehydrogenase; SGPP, structural genomics, PSI; 2.85A {Plasmodium falciparum} Back     alignment and structure
>3fi9_A Malate dehydrogenase; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Porphyromonas gingivalis} Back     alignment and structure
>3cky_A 2-hydroxymethyl glutarate dehydrogenase; rossmann fold, two domain enzyme, oxidoreductase; 2.30A {Eubacterium barkeri} Back     alignment and structure
>1guz_A Malate dehydrogenase; oxidoreductase, tricarboxylic acid cycle, NAD; HET: NAD; 2.0A {Chlorobium vibrioforme} SCOP: c.2.1.5 d.162.1.1 PDB: 1gv1_A 1gv0_A* Back     alignment and structure
>3p7m_A Malate dehydrogenase; putative dehydrogenase, enzyme, structural genomics, center structural genomics of infectious diseases, csgid; 2.20A {Francisella tularensis} Back     alignment and structure
>1mv8_A GMD, GDP-mannose 6-dehydrogenase; rossman fold, domain-swapped dimer, enzyme complex with COFA product, oxidoreductase; HET: SUC NAD GDX; 1.55A {Pseudomonas aeruginosa} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1mfz_A* 1muu_A* Back     alignment and structure
>3dtt_A NADP oxidoreductase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: NAP; 1.70A {Arthrobacter SP} Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure
>3c24_A Putative oxidoreductase; YP_511008.1, structural genomics, center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE; 1.62A {Jannaschia SP} Back     alignment and structure
>4dll_A 2-hydroxy-3-oxopropionate reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; 2.11A {Polaromonas SP} Back     alignment and structure
>1txg_A Glycerol-3-phosphate dehydrogenase [NAD(P)+]; oxidoreductase; 1.70A {Archaeoglobus fulgidus} SCOP: a.100.1.6 c.2.1.6 Back     alignment and structure
>3pef_A 6-phosphogluconate dehydrogenase, NAD-binding; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R geobacter metallireducens; HET: NAP; 2.07A {Geobacter metallireducens} Back     alignment and structure
>3pid_A UDP-glucose 6-dehydrogenase; rossmann fold, oxidoreductase; 1.40A {Klebsiella pneumoniae} PDB: 3pln_A* 3pjg_A* 3phl_A* 3plr_A* Back     alignment and structure
>3pqe_A L-LDH, L-lactate dehydrogenase; FBP, oxidoreductase; 2.20A {Bacillus subtilis} PDB: 3pqf_A* 3pqd_A* Back     alignment and structure
>3rui_A Ubiquitin-like modifier-activating enzyme ATG7; autophagosome formation, non-canonical E1, ATP BI UBL, ATG8, ATG12, ATG10, ATG3, UBL activation, thiolation; 1.91A {Saccharomyces cerevisiae} PDB: 3t7e_A 3vh3_A 3vh4_A* Back     alignment and structure
>1hyh_A L-hicdh, L-2-hydroxyisocaproate dehydrogenase; L-2-hydroxycarboxylate dehydrogenase, L-lactate dehydrogenas oxidoreductase (CHOH(D)-NAD+(A)); HET: NAD; 2.20A {Weissella confusa} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>2vns_A Metalloreductase steap3; metal-binding, transmembrane, rossmann fold, transport, cell cycle, transferrin, flavoprotein, alternative splicing; HET: CIT; 2.0A {Homo sapiens} PDB: 2vq3_A* Back     alignment and structure
>3pdu_A 3-hydroxyisobutyrate dehydrogenase family protein; gamma-hydroxybutyrate dehydrogenase, succinic semialdehyde R glyoxylate metabolism; HET: NAP; 1.89A {Geobacter sulfurreducens} Back     alignment and structure
>1a5z_A L-lactate dehydrogenase; oxidoreductase, glycolysis, hyperthermophiles, thermotoga MA protein stability; HET: FBP NAD; 2.10A {Thermotoga maritima} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>1zud_1 Adenylyltransferase THIF; thiamin, thiazole, protein-protein complex, THIF, TRAN biosynthetic protein complex; 1.98A {Escherichia coli} PDB: 1zfn_A* 1zkm_A Back     alignment and structure
>2p4q_A 6-phosphogluconate dehydrogenase, decarboxylating; rossmann fold, oxidoreductase; HET: FLC; 2.37A {Saccharomyces cerevisiae} Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>4e21_A 6-phosphogluconate dehydrogenase (decarboxylating; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.30A {Geobacter metallireducens} Back     alignment and structure
>2zyd_A 6-phosphogluconate dehydrogenase, decarboxylating; NADP, pentose phosphate pathway, oxidoreductase, 6-phosphogl dehydrogenase; HET: GLO; 1.50A {Escherichia coli} PDB: 2zya_A* 3fwn_A* 2zyg_A 2w8z_A* 2w90_A* Back     alignment and structure
>3h8v_A Ubiquitin-like modifier-activating enzyme 5; rossman fold, ATP-binding, UBL conjugation pathway, transfer structural genomics consortium, SGC; HET: ATP; 2.00A {Homo sapiens} PDB: 3guc_A* Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>1dlj_A UDP-glucose dehydrogenase; rossmann fold, ternary complex, crystallographic dimer, oxidoreductase; HET: NAI UGA; 1.80A {Streptococcus pyogenes} SCOP: a.100.1.4 c.2.1.6 c.26.3.1 PDB: 1dli_A* Back     alignment and structure
>1ez4_A Lactate dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.30A {Lactobacillus pentosus} SCOP: c.2.1.5 d.162.1.1 Back     alignment and structure
>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>2i6t_A Ubiquitin-conjugating enzyme E2-like isoform A; L-lactate dehydrogenase, oxidoreductase, ubiquitin-protein L unknown function; 2.10A {Homo sapiens} PDB: 3dl2_A Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>3eag_A UDP-N-acetylmuramate:L-alanyl-gamma-D-glutamyl-ME diaminopimelate ligase; UDP-N-acetylmuramate:L-alanyl-G glutamyl-MESO-diaminopimelate ligase; 2.55A {Neisseria meningitidis MC58} Back     alignment and structure
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A* Back     alignment and structure
>1jay_A Coenzyme F420H2:NADP+ oxidoreductase (FNO); rossman fold, structural genomics; HET: NAP F42; 1.65A {Archaeoglobus fulgidus} SCOP: c.2.1.6 PDB: 1jax_A* Back     alignment and structure
>3ktd_A Prephenate dehydrogenase; structural genomics, joint center F structural genomics, JCSG, protein structure initiative; 2.60A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>2rcy_A Pyrroline carboxylate reductase; malaria, structural genomics, pyrroline reductase, oxidoredu structural genomics consortium, SGC; HET: NAP; 2.30A {Plasmodium falciparum} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 637
d2cula1230 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {T 1e-64
d1rp0a1278 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi 5e-17
d2i0za1251 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {B 2e-10
d1dxla1221 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehyd 1e-08
d1gesa1217 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase 9e-08
d3lada1229 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehyd 1e-07
d2gqfa1253 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein H 3e-07
d1mo9a1261 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketop 2e-06
d1fl2a1184 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide 2e-06
d1v59a1233 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehyd 3e-06
d1neka2330 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase 4e-06
d1ebda1223 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehyd 5e-06
d3grsa1221 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase 6e-06
d1onfa1259 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase 7e-06
d1y0pa2308 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 ( 1e-05
d1ojta1229 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide deh 1e-05
d1h6va1235 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin 1e-05
d1d5ta1336 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide di 1e-05
d1qo8a2317 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 ( 2e-05
d2bcgg1297 c.3.1.3 (G:5-301) Guanine nucleotide dissociation 2e-05
d1feca1240 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductas 2e-05
d1seza1373 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen ox 3e-05
d2bs2a2336 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wo 3e-05
d1lvla1220 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehyd 3e-05
d1d4ca2322 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 ( 4e-05
d1ryia1276 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO { 7e-05
d1aoga1238 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductas 7e-05
d1vdca1192 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase 7e-05
d1trba1190 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase 2e-04
d2gf3a1281 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bac 3e-04
d1xdia1233 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehyd 3e-04
d2v5za1383 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {H 4e-04
d2gjca1311 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Th 5e-04
d1nhpa1198 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enter 0.001
d1kf6a2311 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Es 0.001
d1chua2305 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {E 0.002
d3coxa1370 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of 0.002
d2ivda1347 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen ox 0.002
d2f5va1379 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {W 0.003
d1b5qa1347 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Mai 0.004
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Length = 230 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: GidA-like
domain: GidA-related protein TTHA1897
species: Thermus thermophilus [TaxId: 274]

 Score =  210 bits (535), Expect = 1e-64
 Identities = 47/254 (18%), Positives = 87/254 (34%), Gaps = 33/254 (12%)

Query: 5   SKFDVIVVGGGHAGTEAALVSARMGQKTLLLSHNIDTIGQMSCNPSIGGIGKSHLVKEID 64
           + + V++VG G +G E A   A+ G +  LL+ ++D +      P       S L +  D
Sbjct: 1   AAYQVLIVGAGFSGAETAFWLAQKGVRVGLLTQSLDAVMMPFLPPKPPFPPGSLLERAYD 60

Query: 65  AMGGIMAIATDKSGIQFRILNSSKGAAVRATRAQVDRILYKQAIRFYLENQLNLYLFQEE 124
                                      V A  A+   +L              L+LFQ  
Sbjct: 61  PK----------------------DERVWAFHARAKYLLE---------GLRPLHLFQAT 89

Query: 125 VDDLIIKTNKILGVVTKIGIKFFSKTVILTTGTFLNGKIHIGLKSYSAGRFGDFSTTSLA 184
              L+++ N+++GV T  G     + V+L  G+FL  ++ +G     AGR  + S   L 
Sbjct: 90  ATGLLLEGNRVVGVRTWEGPPARGEKVVLAVGSFLGARLFLGGVVEEAGRLSEASYPDLL 149

Query: 185 KRLKELQLSHGRLKTGTP--PRIDKRTIDFSKMEEQIGDFDPVPVFSVLGNINLHPKQLS 242
           + L  L       +   P  P      + +     +  +     +  + G   +      
Sbjct: 150 EDLSRLGFRFVEREGEVPETPSTPGYRVRYLAFHPEEWEEKTFRLKRLEGLYAVGLCVRE 209

Query: 243 CFITHTNEKTHNII 256
                 +E+   + 
Sbjct: 210 GDYARMSEEGKRLA 223
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Length = 278 Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Length = 251 Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Length = 221 Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Length = 217 Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Length = 229 Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Length = 253 Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Length = 261 Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Length = 184 Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 233 Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Length = 330 Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Length = 223 Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 221 Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Length = 259 Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 308 Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Length = 229 Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 235 Back     information, alignment and structure
>d1d5ta1 c.3.1.3 (A:-2-291,A:389-431) Guanine nucleotide dissociation inhibitor, GDI {Cow (Bos taurus) [TaxId: 9913]} Length = 336 Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 317 Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 297 Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Length = 240 Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Length = 373 Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Length = 336 Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Length = 220 Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Length = 322 Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Length = 276 Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Length = 238 Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 192 Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Length = 190 Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Length = 281 Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 233 Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Length = 383 Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 311 Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Length = 198 Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Length = 311 Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Length = 305 Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Length = 370 Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Length = 347 Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Length = 379 Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Length = 347 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query637
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 100.0
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 99.95
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 99.82
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 99.73
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 99.72
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 99.7
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 99.49
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 99.47
d1kf6a2311 Fumarate reductase {Escherichia coli [TaxId: 562]} 99.46
d2bs2a2336 Fumarate reductase {Wolinella succinogenes [TaxId: 99.45
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 99.44
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 99.42
d1neka2330 Succinate dehydogenase {Escherichia coli [TaxId: 5 99.37
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 99.35
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 99.32
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 99.3
d1chua2305 L-aspartate oxidase {Escherichia coli [TaxId: 562] 99.28
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 99.26
d1feca1240 Trypanothione reductase {Crithidia fasciculata [Ta 99.14
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 99.1
d1jnra2356 Adenylylsulfate reductase A subunit {Archaeon Arch 99.08
d1xdia1233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 99.04
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 99.02
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 99.01
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 99.0
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 98.94
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 98.93
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 98.92
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 98.91
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 98.9
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 98.9
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 98.87
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 98.87
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 98.86
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 98.85
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 98.85
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 98.83
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 98.82
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 98.81
d2v5za1383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 98.8
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 98.79
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 98.75
d2gmha1380 Electron transfer flavoprotein-ubiquinone oxidored 98.73
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 98.73
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 98.72
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 98.72
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 98.71
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 98.71
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 98.71
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 98.71
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 98.64
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 98.62
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 98.61
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 98.6
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 98.59
d3coxa1370 Cholesterol oxidase of GMC family {Brevibacterium 98.58
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 98.54
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 98.54
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 98.54
d1kdga1360 Flavoprotein domain of flavocytochrome cellobiose 98.54
d1n4wa1367 Cholesterol oxidase of GMC family {Streptomyces sp 98.44
d1aoga1238 Trypanothione reductase {Trypanosoma cruzi [TaxId: 98.44
d1cf3a1385 Glucose oxidase {Aspergillus niger [TaxId: 5061]} 98.4
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 98.37
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 98.35
d1gpea1391 Glucose oxidase {Penicillium amagasakiense [TaxId: 98.34
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 98.31
d1i8ta1298 UDP-galactopyranose mutase, N-terminal domain {Esc 98.3
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 98.25
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 98.22
d2f5va1379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 98.2
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 98.19
d2iida1370 L-aminoacid oxidase {Malayan pit viper (Calloselas 98.14
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 98.13
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 97.99
d1fcda1186 Flavocytochrome c sulfide dehydrogenase, FCSD, fla 97.93
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 97.9
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 97.89
d1pn0a1360 Phenol hydroxylase {Soil-living yeast (Trichosporo 97.88
d1gtea4196 Dihydropyrimidine dehydrogenase, domain 2 {Pig (Su 97.87
d2bi7a1314 UDP-galactopyranose mutase, N-terminal domain {Kle 97.86
d1lqta2239 Ferredoxin:NADP reductase FprA {Mycobacterium tube 97.86
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 97.85
d1djqa3233 Trimethylamine dehydrogenase, middle domain {Methy 97.8
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 97.59
d1cjca2230 Adrenodoxin reductase of mitochondrial p450 system 97.58
d1gtea3153 Dihydropyrimidine dehydrogenase, domain 3 {Pig (Su 97.58
d1ju2a1351 Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxI 97.54
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 97.51
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 97.46
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 97.31
d1djqa2156 Trimethylamine dehydrogenase, C-terminal domain {M 97.22
d1kifa1246 D-aminoacid oxidase, N-terminal domain {Pig (Sus s 96.9
d1vdca2130 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 96.68
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 96.15
d1bg6a2184 N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {A 95.64
d1l7da1183 Nicotinamide nucleotide transhydrogenase dI compon 95.45
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 95.37
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 95.37
d2jfga193 UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase 95.28
d1f0ya2192 Short chain L-3-hydroxyacyl CoA dehydrogenase {Hum 95.27
d1vg0a1491 Rab escort protein 1 {Rat (Rattus norvegicus) [Tax 95.19
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 95.1
d1n1ea2189 Glycerol-3- phosphate dehydrogenase {Trypanosome ( 94.88
d1ks9a2167 Ketopantoate reductase PanE {Escherichia coli [Tax 94.71
d1wdka3186 Fatty oxidation complex alpha subunit, middle doma 94.5
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 94.1
d1mv8a2202 GDP-mannose 6-dehydrogenase {Pseudomonas aeruginos 93.5
d1ez4a1146 Lactate dehydrogenase {Lactobacillus pentosus [Tax 93.45
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 93.33
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 93.0
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 92.81
d1ldna1148 Lactate dehydrogenase {Bacillus stearothermophilus 92.77
d1txga2180 Glycerol-3- phosphate dehydrogenase {Archaeoglobus 92.17
d1aoga1238 Trypanothione reductase {Trypanosoma cruzi [TaxId: 92.16
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 92.05
d1kyqa1150 Bifunctional dehydrogenase/ferrochelatase Met8p, N 91.9
d1pzga1154 Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5 91.63
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 91.42
d2gv8a2107 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 90.98
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 90.79
d1pjqa1113 Siroheme synthase CysG, domain 1 {Salmonella typhi 90.62
d1kjqa2111 Glycinamide ribonucleotide transformylase PurT, N- 90.48
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 90.24
d1dlja2196 UDP-glucose dehydrogenase (UDPGDH) {Streptococcus 89.93
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 89.91
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 89.55
d1i0za1160 Lactate dehydrogenase {Human (Homo sapiens), heart 89.35
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 89.3
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 89.22
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 89.05
d2pv7a2152 Prephenate dehydrogenase TyrA {Haemophilus influen 88.77
d1llda1143 Lactate dehydrogenase {Bifidobacterium longum, str 88.61
d1cjca1225 Adrenodoxin reductase of mitochondrial p450 system 88.23
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 88.12
d1uxja1142 Malate dehydrogenase {Chloroflexus aurantiacus [Ta 88.03
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 87.83
d3etja278 N5-carboxyaminoimidazole ribonucleotide synthetase 87.73
d2pgda2176 6-phosphogluconate dehydrogenase {Sheep (Ovis orie 87.55
d1hyha1146 L-2-hydroxyisocapronate dehydrogenase, L-HICDH {La 87.37
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 87.36
d2ldxa1159 Lactate dehydrogenase {Mouse (Mus musculus) [TaxId 87.27
d1npya1167 Shikimate 5-dehydrogenase-like protein HI0607 {Hae 86.99
d1y6ja1142 Lactate dehydrogenase {Clostridium thermocellum [T 86.95
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 85.94
d1guza1142 Malate dehydrogenase {Chlorobium vibrioforme [TaxI 85.24
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 85.23
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 84.94
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 84.87
d1lqta1216 Ferredoxin:NADP reductase FprA {Mycobacterium tube 84.56
d3cuma2162 Hydroxyisobutyrate dehydrogenase {Pseudomonas aeru 84.56
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 84.37
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 83.63
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 83.62
d1jw9b_247 Molybdenum cofactor biosynthesis protein MoeB {Esc 83.61
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 83.41
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 83.36
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 83.23
d1ojua1142 Malate dehydrogenase {Archaeon Archaeoglobus fulgi 83.15
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 83.11
d1hyea1145 MJ0490, lactate/malate dehydrogenase {Archaeon Met 83.03
d2g5ca2171 Prephenate dehydrogenase TyrA {Aquifex aeolicus [T 82.86
d1vpda2161 Hydroxyisobutyrate dehydrogenase {Salmonella typhi 82.79
d1a9xa4121 Carbamoyl phosphate synthetase (CPS), large subuni 82.62
d1t2da1150 Lactate dehydrogenase {Malaria parasite (Plasmodiu 82.47
d1a9xa3127 Carbamoyl phosphate synthetase (CPS), large subuni 82.45
d1a5za1140 Lactate dehydrogenase {Thermotoga maritima [TaxId: 82.38
d1pgja2178 6-phosphogluconate dehydrogenase {Trypanosoma bruc 82.24
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 82.0
d1wuda177 HRDC domain from RecQ helicase {Escherichia coli [ 81.71
d1mlda1144 Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 982 81.55
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 81.45
d1b5qa1347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 81.37
d1id1a_153 Rck domain from putative potassium channel Kch {Es 81.08
d1w4xa2235 Phenylacetone monooxygenase {Thermobifida fusca [T 80.11
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: GidA-like
domain: GidA-related protein TTHA1897
species: Thermus thermophilus [TaxId: 274]

Probab=100.00  E-value=9.5e-39  Score=312.44  Aligned_cols=224  Identities=22%  Similarity=0.291  Sum_probs=192.8

Q ss_pred             cccEEEECcchHHHHHHHHHhhCCCcEEEEccCCCCCCcccccCCCCccchhhHHHHHHHhccHHHHHHhhcCCeEeeec
Q psy9395           6 KFDVIVVGGGHAGTEAALVSARMGQKTLLLSHNIDTIGQMSCNPSIGGIGKSHLVKEIDAMGGIMAIATDKSGIQFRILN   85 (637)
Q Consensus         6 ~yDViVIGgG~AGl~AA~~lA~~G~~V~LiE~~~~~~G~~~cn~s~gg~~~~~l~~el~~~gg~~~~~~~~~gi~~~~l~   85 (637)
                      .||||||||||||++||+++||.|++|+||+++.+.+|.++||++.++..++++.++++                     
T Consensus         2 ~YDVIVIGgG~AG~eAA~~aAR~G~ktllit~~~~~ig~~~cnp~~gg~~kg~l~reid---------------------   60 (230)
T d2cula1           2 AYQVLIVGAGFSGAETAFWLAQKGVRVGLLTQSLDAVMMPFLPPKPPFPPGSLLERAYD---------------------   60 (230)
T ss_dssp             CCSEEEECCSHHHHHHHHHHHHTTCCEEEEESCGGGTTCCSSCCCSCCCTTCHHHHHCC---------------------
T ss_pred             CCcEEEECcCHHHHHHHHHHHHCCCcEEEEEeccchhcccccCCccccCCCcceeeeee---------------------
Confidence            49999999999999999999999999999999888899999999999999888887653                     


Q ss_pred             cccCchhhhhhhccCHHHHHHHHHHHHHhcCCeEEEcceeEEEEEeCCeEEEEEEecceEEEeceEEEecccccCCceee
Q psy9395          86 SSKGAAVRATRAQVDRILYKQAIRFYLENQLNLYLFQEEVDDLIIKTNKILGVVTKIGIKFFSKTVILTTGTFLNGKIHI  165 (637)
Q Consensus        86 ~~~gp~~~~~~~~~d~~~~~~~l~~~l~~~~gv~i~~~~V~~i~~~~~~v~gV~~~~g~~i~a~~VIlAtG~~~~~~~~i  165 (637)
                       +++|++|++++|         +++.+..++|+.+++.+|+++..+++++.+|.+.+|..|+|+.||||||+|+++++|+
T Consensus        61 -~kG~av~a~raQ---------~k~~l~~~~nL~i~q~~V~dli~e~~~v~gV~t~~G~~~~AkaVILtTGTFL~G~ihi  130 (230)
T d2cula1          61 -PKDERVWAFHAR---------AKYLLEGLRPLHLFQATATGLLLEGNRVVGVRTWEGPPARGEKVVLAVGSFLGARLFL  130 (230)
T ss_dssp             -TTCCCHHHHHHH---------HHHHHHTCTTEEEEECCEEEEEEETTEEEEEEETTSCCEECSEEEECCTTCSSCEEEE
T ss_pred             -ccchhhhhHHHH---------HHHHHhhhcCHHHHhccceeeEecccceeeEEeccccEEEEeEEEEccCcceeeEEEE
Confidence             466888877766         3455666789999999999999999999999999999999999999999999999999


Q ss_pred             cccccCCCCccccchHHHHHHHHhcCccceecccCCC--CcccccccccchhhcccCCCCCCceeeecCCC-cCCCcccc
Q psy9395         166 GLKSYSAGRFGDFSTTSLAKRLKELQLSHGRLKTGTP--PRIDKRTIDFSKMEEQIGDFDPVPVFSVLGNI-NLHPKQLS  242 (637)
Q Consensus       166 g~~~~~~g~~g~~~~~~l~~~l~~~G~~~~~~~~g~~--p~~~~~si~~~~~~~~~~d~~~~~~fs~~~~~-~~~~~~~s  242 (637)
                      |...++.||.|+.++..|++.|.++|+++.|+|||||  ||+++++|||+.++.|++| ..+..|+..... .......+
T Consensus       131 G~~~~~~GR~ge~~s~~Ls~~L~~lGf~~~rlkTgTPa~pR~~~~sId~~~~~~q~~d-~~~f~~~~~~~~~~~~~~~~~  209 (230)
T d2cula1         131 GGVVEEAGRLSEASYPDLLEDLSRLGFRFVEREGEVPETPSTPGYRVRYLAFHPEEWE-EKTFRLKRLEGLYAVGLCVRE  209 (230)
T ss_dssp             TTEEESEEETTEECCSHHHHHHHHTTCCEEEEEEEEC-----CCEEEEEEEECGGGEE-TTTTEETTSBSEEECGGGTSC
T ss_pred             EeeeeeccccCCchhhhHHHHHHhcCCceeeecCCCCCCCCCCCCeecccccccccCC-CCCceeEeeccccccceeecc
Confidence            9999999999999999999999999999999999999  9999999999999999999 655555544322 12223468


Q ss_pred             ccccccccccccccccccc
Q psy9395         243 CFITHTNEKTHNIIRSEFK  261 (637)
Q Consensus       243 c~~t~t~~~~~~ii~~~~~  261 (637)
                      |++++++.++|.++.+++|
T Consensus       210 ~~~~~~~~~~~~l~~~~~~  228 (230)
T d2cula1         210 GDYARMSEEGKRLAEHLLH  228 (230)
T ss_dssp             CCHHHHHHHHHHHHHHHHH
T ss_pred             ccHHHHhHHHHHHHHHHhh
Confidence            8899998888877666554
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1fcda1 c.3.1.5 (A:1-114,A:256-327) Flavocytochrome c sulfide dehydrogenase, FCSD, flavin-binding subunit {Purple phototrophic bacterium (Chromatium vinosum) [TaxId: 1049]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1pn0a1 c.3.1.2 (A:1-240,A:342-461) Phenol hydroxylase {Soil-living yeast (Trichosporon cutaneum) [TaxId: 5554]} Back     information, alignment and structure
>d1gtea4 c.4.1.1 (A:184-287,A:441-532) Dihydropyrimidine dehydrogenase, domain 2 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1lqta2 c.4.1.1 (A:2-108,A:325-456) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1djqa3 c.4.1.1 (A:341-489,A:646-729) Trimethylamine dehydrogenase, middle domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1cjca2 c.4.1.1 (A:6-106,A:332-460) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1gtea3 c.3.1.1 (A:288-440) Dihydropyrimidine dehydrogenase, domain 3 {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ju2a1 c.3.1.2 (A:1-293,A:464-521) Hydroxynitrile lyase {Almond (Prunus dulcis) [TaxId: 3755]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1djqa2 c.3.1.1 (A:490-645) Trimethylamine dehydrogenase, C-terminal domain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1kifa1 c.4.1.2 (A:1-194,A:288-339) D-aminoacid oxidase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1bg6a2 c.2.1.6 (A:4-187) N-(1-D-carboxylethyl)-L-norvaline dehydrogenase {Arthrobacter, strain 1c [TaxId: 1663]} Back     information, alignment and structure
>d1l7da1 c.2.1.4 (A:144-326) Nicotinamide nucleotide transhydrogenase dI component {Rhodospirillum rubrum [TaxId: 1085]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d2jfga1 c.5.1.1 (A:1-93) UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase MurD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1f0ya2 c.2.1.6 (A:12-203) Short chain L-3-hydroxyacyl CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vg0a1 c.3.1.3 (A:3-444,A:558-606) Rab escort protein 1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1n1ea2 c.2.1.6 (A:9-197) Glycerol-3- phosphate dehydrogenase {Trypanosome (Leishmania mexicana) [TaxId: 5665]} Back     information, alignment and structure
>d1ks9a2 c.2.1.6 (A:1-167) Ketopantoate reductase PanE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wdka3 c.2.1.6 (A:311-496) Fatty oxidation complex alpha subunit, middle domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mv8a2 c.2.1.6 (A:1-202) GDP-mannose 6-dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ez4a1 c.2.1.5 (A:16-162) Lactate dehydrogenase {Lactobacillus pentosus [TaxId: 1589]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ldna1 c.2.1.5 (A:15-162) Lactate dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1txga2 c.2.1.6 (A:1-180) Glycerol-3- phosphate dehydrogenase {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1kyqa1 c.2.1.11 (A:1-150) Bifunctional dehydrogenase/ferrochelatase Met8p, N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pzga1 c.2.1.5 (A:14-163) Lactate dehydrogenase {Toxoplasma gondii [TaxId: 5811]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2gv8a2 c.3.1.5 (A:181-287) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1pjqa1 c.2.1.11 (A:1-113) Siroheme synthase CysG, domain 1 {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1kjqa2 c.30.1.1 (A:2-112) Glycinamide ribonucleotide transformylase PurT, N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1dlja2 c.2.1.6 (A:1-196) UDP-glucose dehydrogenase (UDPGDH) {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i0za1 c.2.1.5 (A:1-160) Lactate dehydrogenase {Human (Homo sapiens), heart isoform (H chain) [TaxId: 9606]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2pv7a2 c.2.1.6 (A:92-243) Prephenate dehydrogenase TyrA {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1llda1 c.2.1.5 (A:7-149) Lactate dehydrogenase {Bifidobacterium longum, strain am101-2 [TaxId: 216816]} Back     information, alignment and structure
>d1cjca1 c.3.1.1 (A:107-331) Adrenodoxin reductase of mitochondrial p450 systems {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uxja1 c.2.1.5 (A:2-143) Malate dehydrogenase {Chloroflexus aurantiacus [TaxId: 1108]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d3etja2 c.30.1.1 (A:1-78) N5-carboxyaminoimidazole ribonucleotide synthetase PurK (AIRC), N-domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2pgda2 c.2.1.6 (A:1-176) 6-phosphogluconate dehydrogenase {Sheep (Ovis orientalis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1hyha1 c.2.1.5 (A:21-166) L-2-hydroxyisocapronate dehydrogenase, L-HICDH {Lactobacillus confusus [TaxId: 1583]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2ldxa1 c.2.1.5 (A:1-159) Lactate dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1npya1 c.2.1.7 (A:103-269) Shikimate 5-dehydrogenase-like protein HI0607 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1y6ja1 c.2.1.5 (A:7-148) Lactate dehydrogenase {Clostridium thermocellum [TaxId: 1515]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1guza1 c.2.1.5 (A:1-142) Malate dehydrogenase {Chlorobium vibrioforme [TaxId: 1098]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lqta1 c.3.1.1 (A:109-324) Ferredoxin:NADP reductase FprA {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d3cuma2 c.2.1.6 (A:1-162) Hydroxyisobutyrate dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1jw9b_ c.111.1.1 (B:) Molybdenum cofactor biosynthesis protein MoeB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ojua1 c.2.1.5 (A:22-163) Malate dehydrogenase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1hyea1 c.2.1.5 (A:1-145) MJ0490, lactate/malate dehydrogenase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2g5ca2 c.2.1.6 (A:30-200) Prephenate dehydrogenase TyrA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1vpda2 c.2.1.6 (A:3-163) Hydroxyisobutyrate dehydrogenase {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1a9xa4 c.30.1.1 (A:556-676) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t2da1 c.2.1.5 (A:1-150) Lactate dehydrogenase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1a9xa3 c.30.1.1 (A:1-127) Carbamoyl phosphate synthetase (CPS), large subunit PreATP-grasp domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1a5za1 c.2.1.5 (A:22-163) Lactate dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pgja2 c.2.1.6 (A:1-178) 6-phosphogluconate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1wuda1 a.60.8.1 (A:530-606) HRDC domain from RecQ helicase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1mlda1 c.2.1.5 (A:1-144) Malate dehydrogenase {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w4xa2 c.3.1.5 (A:155-389) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure