Psyllid ID: psy9410

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730------

MRRIFCFIYDKYGNKLPQVITRFAPEPNGYLHIGHAKSIFINFELAYKYNGLCNLRFDDTNPLKENKEYVNSIIKTIKWLNFNWDKVKKRIYYASDYFDILYKIAEYLIISGDAYVDSQNTEEIYINRGNLHEPGRNSPFYNRLPSESLNLFRRMRSGEFKDGAHVLRVKINMKSKNINMRDPIIYRIRHVNHYRTNNNWCIYPMYDYAHPISDAIENITHSICTLEFQDHRPFYEWILNKIDKTNFIKRPFPKQYEFSRLNLTHTITSKRKLLKLLEKKIVDGWDDPRMPTLIGMRRRGYTPESIKLFCKRIGVSKSDSWINIEILEQALRDDLDIKAPRIMAVLNPIKLIISNFLDNQEIECTAPLFSRQHTQYKEKLRYFPISKILWIERDDFMEIPTKKYFRLYPPIGKNSGNRVRLRYGYVVECTGFKKNKNNEVVEVYCKYFPDSKSGTKLSSNYKVKGNIHWISKSHALSIEARLYDRLFIDPYPNIVNNKDFKLLINPNSKKVISAYLEPNLKLIFPKKHAQFEQNLLPQTQCTKCGYPGCRQYAEAIANKKANYNQCPTGGRKGIIKLAKYLNKPIIPLNTIYGNEKSRCCAIIKENKCIGCTLCIQSCPVDAIIGAAKHMHTIFSKLCTGCDLCIKKCPVNCISMIEVTPCRTGWDAWSQKKADDARKRYYLRKKRLFHEKKENYAKLKKATIQFKKNNRETQKSLIEMAVKRIKELKNKENKKIK

cccHHHHHHHHHccccccEEEcccccccccHHHHHHHHHHHHHHHHHHcccEEEEEccccccccHHHHHHHHHHHHccccccccccccccEEEccccHHHHHHHHHHHHHcccEEEccccHHHHHHHcccccccccccccccccHHHHHHHHHHHHccccccccEEEEEEcccccccccccccHHHHccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHccccccccccccEEEEEccccccEEEHHHHHHHHHHccccccccccccccccccccccccHHHHHHHHHHHccccccccccHHHHHHHHHHHHccccccEEEEEccEEEEEEEcccccEEEEEccccccccccccccEEEEccccEEEEEcccccccccccccccccccccccccEEEEEccEEEEEEEEEEcccccEEEEEEEEEccccccccccccccccEEEEcccccccEEEEEEccccccccccccccccccccccccccccEEEEEEEccccccccccccEEEEEEcEEEEEcccccccccccEEEEEccccccccccccccccHHHHHHHHHccccccccccccccHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHccccccccccccccEEEEEEEEccccccHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHHccccc

cccEEEEHHHHccccccEEEEccccccccEEEEccHHHHHHHHHHHHHccccEEEEEcccccccccHHHHHHHHHHHHHHccccccccccEEEccHHHHHHHHHHHHHHHccccEEccccHHHHHHHcccccccccccccccccHHHHHHHHHHHHccccccccEEEEEEEEcccccccccccEEEEEEEcccccccccEEEEccccccccHHHHHHcccccEEEEEccccccHHHHHHHHcccccccccccccEEEEHHEccEHHHHcHHHHHHHHHccccccccccccccHHHHHcccccHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHccccEEEEEccEEEEEEccccccEEEEEcccccccccccccccEEEcccEEEEEEHHHHccccccccEEEccccccccccEEEEEEEEEEEEEEEEEcccccEEEEEEEEccccccccccccccEEEEEEEEEEHHccccHEEEEHHHHcccccccccccccHHHHcccccEEEEEEEEcccHHHccccccEEEEEEEcccccccccccccccHHHHHHHHHHHccccccccccHHHHHHHHHHcccccEcccEcccccccEEEEEEcccccEcEEEEccccHHHHHHHHHHHHHHHHHHccccccEEccccccEEEEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHcccc

MRRIFCFIYdkygnklpQVITrfapepngylhighakSIFINFELAYKYnglcnlrfddtnplkenKEYVNSIIKTIKWLNFNWDKVKKRIYYASDYFDILYKIAEYLIISgdayvdsqnteEIYInrgnlhepgrnspfynrlpseslNLFRRMrsgefkdgaHVLRVKINMkskninmrdpiiYRIRHVnhyrtnnnwciypmydyahpisDAIENITHsictlefqdhrpFYEWILNKidktnfikrpfpkqyefsrlnlTHTITSKRKLLKLLEKKIvdgwddprmptligmrrrgytpeSIKLFCKRigvsksdswINIEILEQALRddldikapriMAVLNPIKLIISNfldnqeiectaplfsrqhtqykeklryfpiskilwierddfmeiptkkyfrlyppigknsgnrvrLRYGYVVECtgfkknknneVVEVYCKyfpdsksgtklssnykvkgnIHWISKSHALSIEARLYdrlfidpypnivnnkdfkllinpnSKKVISAYlepnlklifpkkhaqfeqnllpqtqctkcgypgcRQYAEAIANKkanynqcptggrkGIIKLAKYlnkpiiplntiygnekSRCCAIikenkcigctlciqscpvDAIIGAAKHMHTIFSKLctgcdlcikkcpvncismievtpcrtgwdawsqKKADDARKRYYLRKKRLFHEKKENYAKLKKATIQFKKNNRETQKSLIEMAVKRIKELKNKENKKIK

MRRIFCFiydkygnklpQVITRFAPEPNGYLHIGHAKSIFINFELAYKYNGLCNLRFDDTNPLKENKEYVNSIIKTikwlnfnwdKVKKRIYYASDYFDILYKIAEYLIISGDAYVDSQNTEEIYINrgnlhepgrnspfynRLPSESLNLFRRMRSgefkdgahvlrvkinmkskninmrdpiIYRIRHVNHYRTNNNWCIYPMYDYAHPISDAIENITHSICTLEFQDHRPFYEWILNKIDKTNFIKRPFPKqyefsrlnlthtitskRKLLKLLEkkivdgwddprmptligmrrrgytpeSIKLFCKrigvsksdswINIEILEQALRDDLDIKAPRIMAVLNPIKLIISNFLDNQEIECTAplfsrqhtqykekLRYFPISKILWIERDDFMEIPTKkyfrlyppigknsgnrvrLRYGYVVEctgfkknknnevVEVYCKyfpdsksgtklssnykVKGNIHWISKSHALSIEARLYDRLFIDPYPNIVNNKDFKLLINPNSKKVISAYLEPNLKLIFPKKHAQFEQNLLPQTQCTKCGYPGCRQYAEAIANKKANYNQCPTGGRKGIIKLAKYLNKPIIPLNTIYGNEKSRCCAIIKENKCIGCTLCIQSCPVDAIIGAAKHMHTIFSKLCTGCDLCIKKCPVNCISMIevtpcrtgwdawsqkkaddaRKRYYLRKkrlfhekkenyaklkkatiqfkknnretqksLIEMAVKRikelknkenkkik

MRRIFCFIYDKYGNKLPQVITRFAPEPNGYLHIGHAKSIFINFELAYKYNGLCNLRFDDTNPLKENKEYVNSIIKTIKWLNFNWDKVKKRIYYASDYFDILYKIAEYLIISGDAYVDSQNTEEIYINRGNLHEPGRNSPFYNRLPSESLNLFRRMRSGEFKDGAHVLRVKINMKSKNINMRDPIIYRIRHVNHYRTNNNWCIYPMYDYAHPISDAIENITHSICTLEFQDHRPFYEWILNKIDKTNFIKRPFPKQYEFSRLNLTHTITSkrkllkllekkIVDGWDDPRMPTLIGMRRRGYTPESIKLFCKRIGVSKSDSWINIEILEQALRDDLDIKAPRIMAVLNPIKLIISNFLDNQEIECTAPLFSRQHTQYKEKLRYFPISKILWIERDDFMEIPTKKYFRLYPPIGKNSGNRVRLRYGYVVECTGFKKNKNNEVVEVYCKYFPDSKSGTKLSSNYKVKGNIHWISKSHALSIEARLYDRLFIDPYPNIVNNKDFKLLINPNSKKVISAYLEPNLKLIFPKKHAQFEQNLLPQTQCTKCGYPGCRQYAEAIANKKANYNQCPTGGRKGIIKLAKYLNKPIIPLNTIYGNEKSRCCAIIKENKCIGCTLCIQSCPVDAIIGAAKHMHTIFSKLCTGCDLCIKKCPVNCISMIEVTPCRTGWDAWSQKKADDArkryylrkkrlFHEKKENYAKLKKATIQFKKNNRETQKSLIEMAVkrikelknkenkkik

**RIFCFIYDKYGNKLPQVITRFAPEPNGYLHIGHAKSIFINFELAYKYNGLCNLRFDDTNPLKENKEYVNSIIKTIKWLNFNWDKVKKRIYYASDYFDILYKIAEYLIISGDAYVDSQNTEEIYINRGNL*****************LNLFRRMRSGEFKDGAHVLRVKINMKSKNINMRDPIIYRIRHVNHYRTNNNWCIYPMYDYAHPISDAIENITHSICTLEFQDHRPFYEWILNKIDKTNFIKRPFPKQYEFSRLNLTHTITSKRKLLKLLEKKIVDGWDDPRMPTLIGMRRRGYTPESIKLFCKRIGVSKSDSWINIEILEQALRDDLDIKAPRIMAVLNPIKLIISNFLDNQEIECTAPLFSRQHTQYKEKLRYFPISKILWIERDDFMEIPTKKYFRLYPPIGKNSGNRVRLRYGYVVECTGFKKNKNNEVVEVYCKYFPDSKSGTKLSSNYKVKGNIHWISKSHALSIEARLYDRLFIDPYPNIVNNKDFKLLINPNSKKVISAYLEPNLKLIFPKKHAQFEQNLLPQTQCTKCGYPGCRQYAEAIANKKANYNQCPTGGRKGIIKLAKYLNKPIIPLNTIYGNEKSRCCAIIKENKCIGCTLCIQSCPVDAIIGAAKHMHTIFSKLCTGCDLCIKKCPVNCISMIEVTPCRTGWDAWSQKKADDARKRYYLRKKRLFHEKKENYAKLK*************************************

***IFCFIYDKYGNKLPQVITRFAPEPNGYLHIGHAKSIFINFELAYKYNGLCNLRFDDTNPLKENKEYVNSIIKTIKWLNFNWDKVKKRIYYASDYFDILYKIAEYLIISGDAYVDSQNTEEIY*************PFYNRLPSESLNLFRRMRSGEFKDGAHVLRVKINMKSKNINMRDPIIYRIRHVNHYRTNNNWCIYPMYDYAHPISDAIENITHSICTLEFQDHRPFYEWILNKIDKTNFIKRPFPKQYEFSRLNLTHTITSKRKLLKLLEKKIVDGWDDPRMPTLIGMRRRGYTPESIKLFCKRIGVSKSDSWINIEILEQALRDDLDIKAPRIMAVLNPIKLIISNFLDNQEIECTAPLFSRQHTQYKEKLRYFPISKILWIERDDFMEIPTKKYFRLYPPIGKNSGNRVRLRYGYVVECTGFKKNKNNEVVEVYCKYFP**************KGNIHWISKSHALSIEARLYDRLFIDPYPNIVNNKDFKLLINPNSKKVISAYLEPNLKLIFPKKHAQFEQNLLPQTQCTKCGYPGCRQYAEAIANKKA***************************************AIIKENKCIGCTLCIQSCPVDAIIGAAKHMHTIFSKLCTGCDLCIKKCPVNCISMIEVTPCRTGWDAWSQ*****ARKRYYLRKKRLFHEKKENYAKLKK***************LIEMAVK**************

MRRIFCFIYDKYGNKLPQVITRFAPEPNGYLHIGHAKSIFINFELAYKYNGLCNLRFDDTNPLKENKEYVNSIIKTIKWLNFNWDKVKKRIYYASDYFDILYKIAEYLIISGDAYVDSQNTEEIYINRGNLHEPGRNSPFYNRLPSESLNLFRRMRSGEFKDGAHVLRVKINMKSKNINMRDPIIYRIRHVNHYRTNNNWCIYPMYDYAHPISDAIENITHSICTLEFQDHRPFYEWILNKIDKTNFIKRPFPKQYEFSRLNLTHTITSKRKLLKLLEKKIVDGWDDPRMPTLIGMRRRGYTPESIKLFCKRIGVSKSDSWINIEILEQALRDDLDIKAPRIMAVLNPIKLIISNFLDNQEIECTAPLFSRQH***KEKLRYFPISKILWIERDDFMEIPTKKYFRLYPPIGKNSGNRVRLRYGYVVECTGFKKNKNNEVVEVYCKYFPDSKSGTKLSSNYKVKGNIHWISKSHALSIEARLYDRLFIDPYPNIVNNKDFKLLINPNSKKVISAYLEPNLKLIFPKKHAQFEQNLLPQTQCTKCGYPGCRQYAEAIANKKANYNQCPTGGRKGIIKLAKYLNKPIIPLNTIYGNEKSRCCAIIKENKCIGCTLCIQSCPVDAIIGAAKHMHTIFSKLCTGCDLCIKKCPVNCISMIEVTPCRTGWDAWSQKKADDARKRYYLRKKRLFHEKKENYAKLKKATIQFKKNNRETQKSLIEMAVKRIKELKNKEN****

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

ooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		736	2.2.26 [Sep-21-2011]
B1XW11		590	Glutamine--tRNA ligase OS	yes	N/A	0.716	0.893	0.576	0.0
Q1LQ72		582	Glutamine--tRNA ligase OS	yes	N/A	0.699	0.884	0.576	0.0
B3R5N3		585	Glutamine--tRNA ligase OS	yes	N/A	0.699	0.880	0.574	0.0
A4SZM1		590	Glutamine--tRNA ligase OS	yes	N/A	0.698	0.871	0.575	0.0
Q0K808		585	Glutamine--tRNA ligase OS	yes	N/A	0.699	0.880	0.570	0.0
Q8Y199		580	Glutamine--tRNA ligase OS	yes	N/A	0.699	0.887	0.562	0.0
B2U846		576	Glutamine--tRNA ligase OS	yes	N/A	0.699	0.894	0.566	0.0
Q7VU94		587	Glutamine--tRNA ligase OS	yes	N/A	0.686	0.860	0.557	1e-177
Q7W4T0		587	Glutamine--tRNA ligase OS	yes	N/A	0.686	0.860	0.557	1e-176
Q7WGA6		587	Glutamine--tRNA ligase OS	yes	N/A	0.686	0.860	0.555	1e-176

>sp\|B1XW11\|SYQ_POLNS Glutamine--tRNA ligase OS=Polynucleobacter necessarius subsp. necessarius (strain STIR1) GN=glnS PE=3 SV=1	Back alignment and function desciption

 Score =  659 bits (1699), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/543 (57%), Positives = 402/543 (74%), Gaps = 16/543 (2%)

Query: 13  GNKLPQVITRFAPEPNGYLHIGHAKSIFINFELAYKYN-----GLCNLRFDDTNPLKENK 67
           G  +P +ITRF PEPNGYLHIGHAKSI +NF LA  YN       CN+R DDTNP+KE+ 
Sbjct: 43  GEAIPSIITRFPPEPNGYLHIGHAKSICLNFGLASDYNNQPGGARCNMRLDDTNPVKEDV 102

Query: 68  EYVNSIIKTIKWLNFNWDKVKKRIYYASDYFDILYKIAEYLIISGDAYVDSQNTEEIYIN 127
           EY +SI+  +KWL F+W      +Y+ASDYFD LY+ AE LI SG AYVDSQ+ ++I+ N
Sbjct: 103 EYADSILDAVKWLGFDW---GTHLYHASDYFDRLYEFAEILIQSGKAYVDSQSADDIHTN 159

Query: 128 RGNLHEPGRNSPFYNRLPSESLNLFRRMRSGEFKDGAHVLRVKINMKSKNINMRDPIIYR 187
           RGN  + G+NSPF +R P E+L LFR MR G+FKDG HVLR+KI+M   NI MRDP++YR
Sbjct: 160 RGNFGQAGKNSPFRDRTPEENLQLFRDMRDGKFKDGEHVLRLKIDMAHPNIVMRDPVVYR 219

Query: 188 IRHVNHYRTNNNWCIYPMYDYAHPISDAIENITHSICTLEFQDHRPFYEWILNKIDKTNF 247
           IRH +H+RT + WCIYP+YD+ H ISDA+ENI+HSICTLEF+++RP Y+WI+N + +   
Sbjct: 220 IRHTDHHRTGSKWCIYPLYDFTHCISDALENISHSICTLEFENNRPLYDWIVNSLKELGV 279

Query: 248 IKRPFPKQYEFSRLNLTHTITSKRKLLKLLEKKIVDGWDDPRMPTLIGMRRRGYTPESIK 307
            K P P Q+EF+RLNLT+TITSKRKLL+L+E+K V+GWDDPRMPT++G+RRRGYTPESI+
Sbjct: 280 FKDPVPHQHEFARLNLTYTITSKRKLLQLVEEKHVEGWDDPRMPTIVGIRRRGYTPESIR 339

Query: 308 LFCKRIGVSKSDSWINIEILEQALRDDLDIKAPRIMAVLNPIKLIISNFLDNQEIECTAP 367
           LFC+RIGVSK+DSWI++  L+QALRDDL+++APR  AVL P+KL++ NF    +  C+AP
Sbjct: 340 LFCERIGVSKADSWIDMSTLDQALRDDLEVRAPRATAVLKPLKLVVENFDAPTKEACSAP 399

Query: 368 LFSRQHTQYKE-KLRYFPISKILWIERDDFMEIPTKKYFRLYPPIGKNSGNRVRLRYGYV 426
               +H  Y E   R F  ++ LWIE DDFM+ P K +FRLYPPI    G+RVRLR+G+V
Sbjct: 400 ----RHPNYPEWGNREFNFTRELWIEADDFMQEPIKGFFRLYPPIDDQPGSRVRLRHGFV 455

Query: 427 VECTGFKKNKNNEVVEVYCKYFPDSKSGTKLSSNYKVKGNIHWISKSHALSIEARLYDRL 486
           VECTGF+ +    V +V   +FPDSKSGT  S+NYKVKGNIHWIS + A+  E RLYD L
Sbjct: 456 VECTGFETDAQGNVTQVNVTHFPDSKSGTPGSNNYKVKGNIHWISAAEAIPAEVRLYDHL 515

Query: 487 FIDPYPNIVNNKDFKLLINPNSKKVISAYLEPNLKLIFPKKHAQFEQN--LLPQTQCTKC 544
           F DPYP+   +K+F   INPNSK+ ISAYLEP +K    +   QFE++   +     +K 
Sbjct: 516 FTDPYPD-SGDKNFLDAINPNSKQTISAYLEPCMKDAKAEDRFQFERHGYFVADQSDSKP 574

Query: 545 GYP 547
           G P
Sbjct: 575 GKP 577

Polynucleobacter necessarius subsp. necessarius (strain STIR1) (taxid: 452638)
EC: 6EC: .EC: 1EC: .EC: 1EC: .EC: 1EC: 8

>sp\|Q1LQ72\|SYQ_RALME Glutamine--tRNA ligase OS=Ralstonia metallidurans (strain CH34 / ATCC 43123 / DSM 2839) GN=glnS PE=3 SV=1	Back alignment and function description

>sp\|B3R5N3\|SYQ_CUPTR Glutamine--tRNA ligase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=glnS PE=3 SV=1	Back alignment and function description

>sp\|A4SZM1\|SYQ_POLSQ Glutamine--tRNA ligase OS=Polynucleobacter necessarius subsp. asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) GN=glnS PE=3 SV=1	Back alignment and function description

>sp\|Q0K808\|SYQ_CUPNH Glutamine--tRNA ligase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=glnS PE=3 SV=1	Back alignment and function description

>sp\|Q8Y199\|SYQ_RALSO Glutamine--tRNA ligase OS=Ralstonia solanacearum (strain GMI1000) GN=glnS PE=3 SV=1	Back alignment and function description

>sp\|B2U846\|SYQ_RALPJ Glutamine--tRNA ligase OS=Ralstonia pickettii (strain 12J) GN=glnS PE=3 SV=1	Back alignment and function description

>sp\|Q7VU94\|SYQ_BORPE Glutamine--tRNA ligase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=glnS PE=3 SV=1	Back alignment and function description

>sp\|Q7W4T0\|SYQ_BORPA Glutamine--tRNA ligase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=glnS PE=3 SV=1	Back alignment and function description

>sp\|Q7WGA6\|SYQ_BORBR Glutamine--tRNA ligase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=glnS PE=3 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		736
340786344		591	glutaminyl-tRNA synthetase [Collimonas f	0.711	0.886	0.627	0.0
134093864		582	glutaminyl-tRNA synthetase [Herminiimona	0.716	0.905	0.618	0.0
152980200		582	glutaminyl-tRNA synthetase [Janthinobact	0.697	0.881	0.619	0.0
395761173		588	glutaminyl-tRNA ligase [Janthinobacteriu	0.698	0.874	0.614	0.0
237746870		588	glutaminyl-tRNA synthetase [Oxalobacter	0.690	0.863	0.623	0.0
329901659		578	Glutaminyl-tRNA synthetase [Oxalobactera	0.698	0.889	0.611	0.0
237749019		585	glutaminyl-tRNA synthetase [Oxalobacter	0.690	0.868	0.613	0.0
399017430		604	glutaminyl-tRNA synthetase [Herbaspirill	0.703	0.857	0.600	0.0
445495342		588	glutamine-tRNA ligase GlnS [Janthinobact	0.698	0.874	0.597	0.0
427403090		595	glutaminyl-tRNA synthetase [Massilia tim	0.701	0.867	0.591	0.0

>gi\|340786344\|ref\|YP_004751809.1\| glutaminyl-tRNA synthetase [Collimonas fungivorans Ter331] gi\|340551611\|gb\|AEK60986.1\| Glutaminyl-tRNA synthetase [Collimonas fungivorans Ter331]	Back alignment and taxonomy information

 Score =  741 bits (1914), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/526 (62%), Positives = 418/526 (79%), Gaps = 2/526 (0%)

Query: 10  DKYGNKLPQVITRFAPEPNGYLHIGHAKSIFINFELAYKYNGLCNLRFDDTNPLKENKEY 69
           D  G  LPQV+TRF PEPNGYLHIGHAKSI +NF LA  Y G C+LRFDDTNP KE +EY
Sbjct: 38  DSQGQPLPQVVTRFPPEPNGYLHIGHAKSICVNFGLARDYAGRCHLRFDDTNPEKEEQEY 97

Query: 70  VNSIIKTIKWLNFNW-DKVKKRIYYASDYFDILYKIAEYLIISGDAYVDSQNTEEIYINR 128
           V++II +++WL F+W D   + +Y+AS+YFD LY++AEYLI +G AYVDSQ+ E++  NR
Sbjct: 98  VDTIIDSVRWLGFDWTDNTGEHLYFASNYFDKLYEMAEYLITAGLAYVDSQSAEQMTANR 157

Query: 129 GNLHEPGRNSPFYNRLPSESLNLFRRMRSGEFKDGAHVLRVKINMKSKNINMRDPIIYRI 188
           GN  EPG++SPF NR   ESL+LFRRM++GEFKDG H++R +I+M S N+N+RDP IYRI
Sbjct: 158 GNFGEPGKDSPFRNRSAEESLDLFRRMKAGEFKDGEHIVRARIDMASPNMNLRDPAIYRI 217

Query: 189 RHVNHYRTNNNWCIYPMYDYAHPISDAIENITHSICTLEFQDHRPFYEWILNKIDKTNFI 248
           RH +H+RT + WCIYPMYDY HPISDA+ENI+HSICTLEFQDHRPFY+W+L  +    F+
Sbjct: 218 RHAHHHRTGDKWCIYPMYDYTHPISDALENISHSICTLEFQDHRPFYDWLLEHLSSAGFL 277

Query: 249 KRPFPKQYEFSRLNLTHTITSKRKLLKLLEKKIVDGWDDPRMPTLIGMRRRGYTPESIKL 308
           ++P P QYEFSRLN+T+ ITSKRKL +L+++ IVDGWDDPRMPTL+G+RRRG+TPES++L
Sbjct: 278 QKPVPHQYEFSRLNVTYVITSKRKLRQLVDEGIVDGWDDPRMPTLVGIRRRGFTPESLQL 337

Query: 309 FCKRIGVSKSDSWINIEILEQALRDDLDIKAPRIMAVLNPIKLIISNFLDNQEIECTAPL 368
           FC R GV+KSD WI++  LE ALR+DLD KAPR  AVL P+KLII NF + + + C AP+
Sbjct: 338 FCDRTGVTKSDGWIDMSSLEGALREDLDPKAPRASAVLQPLKLIIDNFPEGETVACHAPV 397

Query: 369 FSRQHTQYKEKLRYFPISKILWIERDDFMEIPTKKYFRLYPPIGKNSGNRVRLRYGYVVE 428
           +   H ++   LR+FPISK LWIE++DFME P K YFRL+PP     G+RVRLR+GYVVE
Sbjct: 398 YPPAHPEHATALRHFPISKTLWIEQEDFMETPVKGYFRLFPPSADKPGSRVRLRHGYVVE 457

Query: 429 CTGFKKNKNNEVVEVYCKYFPDSKSGTKLSSNYKVKGNIHWISKSHALSIEARLYDRLFI 488
           CTGF K+ + +V  V+C YFPDSKSGT+ S+NYKVKGNIHWIS +HA+  E RLYDRLF 
Sbjct: 458 CTGFDKDADGKVTAVHCTYFPDSKSGTEGSANYKVKGNIHWISVAHAIEAEVRLYDRLFT 517

Query: 489 DPYPNIVNNKDFKLLINPNSKKVISAYLEPNLKLIFPKKHAQFEQN 534
           DP+P+    KDFK  +NP++KKVISAYLEP LK   P++  QFE++
Sbjct: 518 DPHPD-AGGKDFKAALNPDAKKVISAYLEPGLKDAQPEQRYQFERH 562

Source: Collimonas fungivorans Ter331

Species: Collimonas fungivorans

Genus: Collimonas

Family: Oxalobacteraceae

Order: Burkholderiales

Class: Betaproteobacteria

Phylum: Proteobacteria

Superkingdom: Bacteria

>gi\|134093864\|ref\|YP_001098939.1\| glutaminyl-tRNA synthetase [Herminiimonas arsenicoxydans] gi\|133737767\|emb\|CAL60812.1\| glutamine tRNA synthetase (Glutamine--tRNA ligase) (GlnRS) [Herminiimonas arsenicoxydans]	Back alignment and taxonomy information

>gi\|152980200\|ref\|YP_001352269.1\| glutaminyl-tRNA synthetase [Janthinobacterium sp. Marseille] gi\|151280277\|gb\|ABR88687.1\| Glutaminyl-tRNA synthetase [Janthinobacterium sp. Marseille]	Back alignment and taxonomy information

>gi\|395761173\|ref\|ZP_10441842.1\| glutaminyl-tRNA ligase [Janthinobacterium lividum PAMC 25724]	Back alignment and taxonomy information

>gi\|237746870\|ref\|ZP_04577350.1\| glutaminyl-tRNA synthetase [Oxalobacter formigenes HOxBLS] gi\|229378221\|gb\|EEO28312.1\| glutaminyl-tRNA synthetase [Oxalobacter formigenes HOxBLS]	Back alignment and taxonomy information

>gi\|329901659\|ref\|ZP_08272873.1\| Glutaminyl-tRNA synthetase [Oxalobacteraceae bacterium IMCC9480] gi\|327549049\|gb\|EGF33654.1\| Glutaminyl-tRNA synthetase [Oxalobacteraceae bacterium IMCC9480]	Back alignment and taxonomy information

>gi\|237749019\|ref\|ZP_04579499.1\| glutaminyl-tRNA synthetase [Oxalobacter formigenes OXCC13] gi\|229380381\|gb\|EEO30472.1\| glutaminyl-tRNA synthetase [Oxalobacter formigenes OXCC13]	Back alignment and taxonomy information

>gi\|399017430\|ref\|ZP_10719622.1\| glutaminyl-tRNA synthetase [Herbaspirillum sp. CF444] gi\|398103304\|gb\|EJL93475.1\| glutaminyl-tRNA synthetase [Herbaspirillum sp. CF444]	Back alignment and taxonomy information

>gi\|445495342\|ref\|ZP_21462386.1\| glutamine-tRNA ligase GlnS [Janthinobacterium sp. HH01] gi\|444791503\|gb\|ELX13050.1\| glutamine-tRNA ligase GlnS [Janthinobacterium sp. HH01]	Back alignment and taxonomy information

>gi\|427403090\|ref\|ZP_18894087.1\| glutaminyl-tRNA synthetase [Massilia timonae CCUG 45783] gi\|425718101\|gb\|EKU81053.1\| glutaminyl-tRNA synthetase [Massilia timonae CCUG 45783]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		736
TIGR_CMR\|GSU_3366		554	GSU_3366 "glutaminyl-tRNA synt	0.631	0.839	0.523	1.6e-132
UNIPROTKB\|Q9KTA6		556	glnS "Glutamine--tRNA ligase"	0.637	0.843	0.494	2.3e-119
TIGR_CMR\|VC_0997		556	VC_0997 "glutaminyl-tRNA synth	0.637	0.843	0.494	2.3e-119
UNIPROTKB\|P00962		554	glnS "glutaminyl-tRNA syntheta	0.635	0.844	0.488	1.4e-117
TIGR_CMR\|SO_1786		556	SO_1786 "glutaminyl-tRNA synth	0.688	0.911	0.459	1e-116
TIGR_CMR\|CPS_3240		556	CPS_3240 "glutaminyl-tRNA synt	0.672	0.890	0.463	3.9e-115
DICTYBASE\|DDB_G0289481		779	glnS "glutamine-tRNA ligase" [	0.646	0.611	0.402	5.1e-90
SGD\|S000005694		809	GLN4 "Glutamine tRNA synthetas	0.646	0.588	0.384	1.8e-78
WB\|WBGene00001336		786	qars-1 [Caenorhabditis elegans	0.547	0.512	0.392	1.4e-71
UNIPROTKB\|G4NHZ1		632	MGG_09393 "Glutaminyl-tRNA syn	0.577	0.672	0.377	1.4e-71

TIGR_CMR\|GSU_3366 GSU_3366 "glutaminyl-tRNA synthetase" [Geobacter sulfurreducens PCA (taxid:243231)]	Back alignment and assigned GO terms

 Score = 1299 (462.3 bits), Expect = 1.6e-132, P = 1.6e-132
 Identities = 254/485 (52%), Positives = 327/485 (67%)

Query:    10 DKYGNKLPQVITRFAPEPNGYLHIGHAKSIFINFELAYKYNGLCNLRFDDTNPLKENKEY 69
             D    K   ++TRF PEPNGYLHIGHAKSI +NF LA  + G C+LRFDDTNP+KE  EY
Sbjct:    20 DLKSGKHRTIVTRFPPEPNGYLHIGHAKSICLNFGLARDFGGRCHLRFDDTNPVKEETEY 79

Query:    70 VNSIIKTIKWLNFNWDKVKKRIYYASDYFDILYKIAEYLIISGDAYVDSQNTEEIYINRG 129
             + SI ++++WL F W +     YYASDYF+ LY+ AE LII G AYVD    +EI   RG
Sbjct:    80 IESIKESVRWLGFEWGE---HCYYASDYFEQLYQWAESLIIQGKAYVDDLTADEIRSYRG 136

Query:   130 NLHEPGRNSPFYNRLPSESLNLFRRMRSGEFKDGAHVLRVKINMKSKNINMRDPIIYRIR 189
              L EPG+ SP  +R   E+L+LFRRMR+GEF DGA VLR +I+M S NIN+RDP++YRI 
Sbjct:   137 TLTEPGKESPSRSRTAEENLDLFRRMRAGEFPDGAKVLRARIDMASPNINLRDPVMYRIL 196

Query:   190 HVNHYRTNNNWCIYPMYDYAHPISDAIENITHSICTLEFQDHRPFYEWILNKIDKTNFIK 249
             H  H    + WCIYPMYDYAH  SDAIE ITHSICTLEF+DH+P YEW L+ +   N   
Sbjct:   197 HAPHPHAGDKWCIYPMYDYAHGQSDAIEGITHSICTLEFEDHKPLYEWFLDNLPVPN--- 253

Query:   250 RPFPKQYEFSRLNLTHTITSXXXXXXXXXXXIVDGWDDPRMPTLIGMRRRGYTPESIKLF 309
             RP  +QYEF+RLNLT+ + S            V GWDDPRMPT++G+RRRG+TPE+I+ F
Sbjct:   254 RP--RQYEFARLNLTYAVMSKRKLLQLVKDGDVTGWDDPRMPTIMGIRRRGFTPEAIRNF 311

Query:   310 CKRIGVSKSDSWINIEILEQALRDDLDIKAPRIMAVLNPIKLIISNFLDNQEIECTAPLF 369
             C  IGV +SDSWI++ ILE+++R DL+ +APR+MAVL P++L+I N+ +      T  L 
Sbjct:   312 CDTIGVGRSDSWIDMSILEESVRQDLNERAPRVMAVLRPLRLVIENYPEG----ATEDLT 367

Query:   370 SRQHTQYKEK-LRYFPISKILWIERDDFMEIPTKKYFRLYPPIGKNSGNRVRLRYGYVVE 428
                H Q  +   R  P  + L+IERDDFME+P K + RL P      G  +RLR  Y+V+
Sbjct:   368 IAYHPQRPDLGSRSVPFGRELFIERDDFMEVPPKGFKRLSP------GEEIRLRGAYIVK 421

Query:   429 CTGFKKNKNNEVVEVYCKYFPDSKSGTKLSSNYKVKGNIHWISKSHALSIEARLYDRLFI 488
             CTG +++    V  V C Y P+++SG    S  KVKG IHW+S +HA++ E RLYDRLF 
Sbjct:   422 CTGVERDGEGNVTTVRCTYDPETRSGLP-GSERKVKGVIHWVSATHAVTAEVRLYDRLFT 480

Query:   489 DPYPN 493
              P P+
Sbjct:   481 VPNPS 485

GO:0004819 "glutamine-tRNA ligase activity" evidence=ISS

GO:0006425 "glutaminyl-tRNA aminoacylation" evidence=ISS

UNIPROTKB\|Q9KTA6 glnS "Glutamine--tRNA ligase" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)]	Back alignment and assigned GO terms

TIGR_CMR\|VC_0997 VC_0997 "glutaminyl-tRNA synthetase" [Vibrio cholerae O1 biovar El Tor (taxid:686)]	Back alignment and assigned GO terms

UNIPROTKB\|P00962 glnS "glutaminyl-tRNA synthetase" [Escherichia coli K-12 (taxid:83333)]	Back alignment and assigned GO terms

TIGR_CMR\|SO_1786 SO_1786 "glutaminyl-tRNA synthetase" [Shewanella oneidensis MR-1 (taxid:211586)]	Back alignment and assigned GO terms

TIGR_CMR\|CPS_3240 CPS_3240 "glutaminyl-tRNA synthetase" [Colwellia psychrerythraea 34H (taxid:167879)]	Back alignment and assigned GO terms

DICTYBASE\|DDB_G0289481 glnS "glutamine-tRNA ligase" [Dictyostelium discoideum (taxid:44689)]	Back alignment and assigned GO terms

SGD\|S000005694 GLN4 "Glutamine tRNA synthetase" [Saccharomyces cerevisiae (taxid:4932)]	Back alignment and assigned GO terms

WB\|WBGene00001336 qars-1 [Caenorhabditis elegans (taxid:6239)]	Back alignment and assigned GO terms

UNIPROTKB\|G4NHZ1 MGG_09393 "Glutaminyl-tRNA synthetase" [Magnaporthe oryzae 70-15 (taxid:242507)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
B0U6D0	SYQ_XYLFM	6, ., 1, ., 1, ., 1, 8	0.4660	0.6820	0.8655	yes	N/A
Q5F7G0	SYQ_NEIG1	6, ., 1, ., 1, ., 1, 8	0.5122	0.6888	0.9021	yes	N/A
Q1QMM1	SYQ_NITHX	6, ., 1, ., 1, ., 1, 8	0.4780	0.6847	0.9032	yes	N/A
Q7VU94	SYQ_BORPE	6, ., 1, ., 1, ., 1, 8	0.5570	0.6861	0.8603	yes	N/A
Q87RG4	SYQ_VIBPA	6, ., 1, ., 1, ., 1, 8	0.4914	0.6834	0.9046	yes	N/A
Q7UX42	SYQ_RHOBA	6, ., 1, ., 1, ., 1, 8	0.4876	0.6847	0.8386	yes	N/A
Q8PNZ5	SYQ_XANAC	6, ., 1, ., 1, ., 1, 8	0.4715	0.6793	0.8635	yes	N/A
Q7NX86	SYQ_CHRVO	6, ., 1, ., 1, ., 1, 8	0.5057	0.6739	0.8857	yes	N/A
A4SZM1	SYQ_POLSQ	6, ., 1, ., 1, ., 1, 8	0.5757	0.6983	0.8711	yes	N/A
Q4QK64	SYQ_HAEI8	6, ., 1, ., 1, ., 1, 8	0.4971	0.6820	0.9012	yes	N/A
A5F2T1	SYQ_VIBC3	6, ., 1, ., 1, ., 1, 8	0.4885	0.6820	0.9028	yes	N/A
B5BCC3	SYQ_SALPK	6, ., 1, ., 1, ., 1, 8	0.4952	0.6834	0.9063	yes	N/A
Q0K808	SYQ_CUPNH	6, ., 1, ., 1, ., 1, 8	0.5706	0.6997	0.8803	yes	N/A
C3LTP5	SYQ_VIBCM	6, ., 1, ., 1, ., 1, 8	0.4885	0.6820	0.9028	yes	N/A
Q8ZQX5	SYQ_SALTY	6, ., 1, ., 1, ., 1, 8	0.4952	0.6834	0.9063	yes	N/A
Q8Y199	SYQ_RALSO	6, ., 1, ., 1, ., 1, 8	0.5627	0.6997	0.8879	yes	N/A
A9MUG5	SYQ_SALPB	6, ., 1, ., 1, ., 1, 8	0.4923	0.6847	0.9081	yes	N/A
A6VP11	SYQ_ACTSZ	6, ., 1, ., 1, ., 1, 8	0.5019	0.6698	0.8819	yes	N/A
B3R5N3	SYQ_CUPTR	6, ., 1, ., 1, ., 1, 8	0.5743	0.6997	0.8803	yes	N/A
Q188C8	SYQ_CLOD6	6, ., 1, ., 1, ., 1, 8	0.4981	0.6834	0.9079	yes	N/A
Q4UR70	SYQ_XANC8	6, ., 1, ., 1, ., 1, 8	0.4693	0.6942	0.8825	yes	N/A
Q87YQ1	SYQ_PSESM	6, ., 1, ., 1, ., 1, 8	0.4847	0.6847	0.8857	yes	N/A
Q3BX52	SYQ_XANC5	6, ., 1, ., 1, ., 1, 8	0.4715	0.6793	0.8635	yes	N/A
Q1LQ72	SYQ_RALME	6, ., 1, ., 1, ., 1, 8	0.5765	0.6997	0.8848	yes	N/A
Q88IU5	SYQ_PSEPK	6, ., 1, ., 1, ., 1, 8	0.4980	0.6847	0.8888	yes	N/A
Q2NZL7	SYQ_XANOM	6, ., 1, ., 1, ., 1, 8	0.4640	0.6793	0.8635	yes	N/A
Q2KVX0	SYQ_BORA1	6, ., 1, ., 1, ., 1, 8	0.5473	0.6861	0.8617	yes	N/A
P43831	SYQ_HAEIN	6, ., 1, ., 1, ., 1, 8	0.4952	0.6820	0.9012	yes	N/A
B1XW11	SYQ_POLNS	6, ., 1, ., 1, ., 1, 8	0.5764	0.7160	0.8932	yes	N/A
Q7W4T0	SYQ_BORPA	6, ., 1, ., 1, ., 1, 8	0.5570	0.6861	0.8603	yes	N/A
Q5GWF4	SYQ_XANOR	6, ., 1, ., 1, ., 1, 8	0.4640	0.6793	0.8635	yes	N/A
Q57RP8	SYQ_SALCH	6, ., 1, ., 1, ., 1, 8	0.4952	0.6834	0.9063	yes	N/A
Q8XMP3	SYQ_CLOPE	6, ., 1, ., 1, ., 1, 8	0.5038	0.6820	0.9094	yes	N/A
Q9PDP1	SYQ_XYLFA	6, ., 1, ., 1, ., 1, 8	0.4679	0.6820	0.8655	yes	N/A
A5N6Y3	SYQ_CLOK5	6, ., 1, ., 1, ., 1, 8	0.4759	0.7051	0.9334	yes	N/A
B4EV71	SYQ_PROMH	6, ., 1, ., 1, ., 1, 8	0.5038	0.6698	0.8882	yes	N/A
Q0TTG1	SYQ_CLOP1	6, ., 1, ., 1, ., 1, 8	0.5038	0.6820	0.9094	yes	N/A
P57000	SYQ_NEIMA	6, ., 1, ., 1, ., 1, 8	0.5160	0.6888	0.9021	yes	N/A
Q89KR6	SYQ_BRAJA	6, ., 1, ., 1, ., 1, 8	0.4980	0.6739	0.8888	yes	N/A
Q8PCB3	SYQ_XANCP	6, ., 1, ., 1, ., 1, 8	0.4693	0.6942	0.8825	yes	N/A
Q87DU6	SYQ_XYLFT	6, ., 1, ., 1, ., 1, 8	0.4660	0.6820	0.8655	yes	N/A
Q3SRI8	SYQ_NITWN	6, ., 1, ., 1, ., 1, 8	0.4738	0.6725	0.8855	yes	N/A
B2U846	SYQ_RALPJ	6, ., 1, ., 1, ., 1, 8	0.5665	0.6997	0.8940	yes	N/A
C0PWA7	SYQ_SALPC	6, ., 1, ., 1, ., 1, 8	0.4952	0.6834	0.9063	yes	N/A
A8AJD6	SYQ_CITK8	6, ., 1, ., 1, ., 1, 8	0.4914	0.6834	0.9063	yes	N/A
Q9KTA6	SYQ_VIBCH	6, ., 1, ., 1, ., 1, 8	0.4885	0.6820	0.9028	yes	N/A
Q81ZS7	SYQ_NITEU	6, ., 1, ., 1, ., 1, 8	0.5664	0.6779	0.8974	yes	N/A
Q0SVB1	SYQ_CLOPS	6, ., 1, ., 1, ., 1, 8	0.5076	0.6820	0.9094	yes	N/A
Q7WGA6	SYQ_BORBR	6, ., 1, ., 1, ., 1, 8	0.5551	0.6861	0.8603	yes	N/A
P56927	SYQ_NEIMB	6, ., 1, ., 1, ., 1, 8	0.5141	0.6888	0.9021	yes	N/A

EC Number Prediction by EFICAz Software

Prediction Level	EC number	Confidence of Prediction
4th Layer	6.1.1.18	0.914
3rd Layer	6.1.1	0.921

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database

ID	Alignment Graph	Length	Definition	E-value
Query		736
PRK05347		554	PRK05347, PRK05347, glutaminyl-tRNA synthetase; Pr	0.0
PRK14703		771	PRK14703, PRK14703, glutaminyl-tRNA synthetase/Yqe	0.0
TIGR00440		522	TIGR00440, glnS, glutaminyl-tRNA synthetase	0.0
PLN02859		788	PLN02859, PLN02859, glutamine-tRNA ligase	1e-152
PTZ00437		574	PTZ00437, PTZ00437, glutaminyl-tRNA synthetase; Pr	1e-121
COG0008		472	COG0008, GlnS, Glutamyl- and glutaminyl-tRNA synth	1e-111
pfam00749		314	pfam00749, tRNA-synt_1c, tRNA synthetases class I	1e-108
PRK06991		270	PRK06991, PRK06991, ferredoxin; Provisional	2e-89
PRK04156		567	PRK04156, gltX, glutamyl-tRNA synthetase; Provisio	3e-80
TIGR00463		556	TIGR00463, gltX_arch, glutamyl-tRNA synthetase, ar	9e-79
PLN02907		722	PLN02907, PLN02907, glutamate-tRNA ligase	3e-76
cd00807		238	cd00807, GlnRS_core, catalytic core domain of glut	2e-75
PLN03233		523	PLN03233, PLN03233, putative glutamate-tRNA ligase	4e-69
PTZ00402		601	PTZ00402, PTZ00402, glutamyl-tRNA synthetase; Prov	2e-66
PRK05113		191	PRK05113, PRK05113, electron transport complex pro	7e-61
COG2878		198	COG2878, COG2878, Predicted NADH:ubiquinone oxidor	6e-58
TIGR01944		165	TIGR01944, rnfB, electron transport complex, RnfAB	2e-55
PRK08764		135	PRK08764, PRK08764, ferredoxin; Provisional	5e-49
pfam03950		174	pfam03950, tRNA-synt_1c_C, tRNA synthetases class	4e-47
cd00807		238	cd00807, GlnRS_core, catalytic core domain of glut	1e-46
cd00418		230	cd00418, GlxRS_core, catalytic core domain of glut	4e-29
cd00418		230	cd00418, GlxRS_core, catalytic core domain of glut	6e-27
cd09287		240	cd09287, GluRS_non_core, catalytic core domain of	4e-24
cd09287		240	cd09287, GluRS_non_core, catalytic core domain of	6e-23
PRK12558		445	PRK12558, PRK12558, glutamyl-tRNA synthetase; Prov	2e-20
cd00808		239	cd00808, GluRS_core, catalytic core domain of disc	8e-20
PRK07118		280	PRK07118, PRK07118, ferredoxin; Validated	3e-18
TIGR00464		470	TIGR00464, gltX_bact, glutamyl-tRNA synthetase, ba	1e-15
PRK01406		476	PRK01406, gltX, glutamyl-tRNA synthetase; Reviewed	7e-14
PRK14895		513	PRK14895, gltX, glutamyl-tRNA synthetase; Provisio	2e-13
PRK05710		299	PRK05710, PRK05710, glutamyl-Q tRNA(Asp) synthetas	3e-12
COG1145		99	COG1145, NapF, Ferredoxin [Energy production and c	4e-11
pfam04060		35	pfam04060, FeS, Putative Fe-S cluster	8e-11
PLN02627		535	PLN02627, PLN02627, glutamyl-tRNA synthetase	1e-10
pfam13187		44	pfam13187, Fer4_9, 4Fe-4S dicluster domain	7e-10
COG1146		68	COG1146, COG1146, Ferredoxin [Energy production an	9e-10
PRK07118		280	PRK07118, PRK07118, ferredoxin; Validated	1e-09
PRK05888		164	PRK05888, PRK05888, NADH dehydrogenase subunit I;	3e-09
COG1144		91	COG1144, COG1144, Pyruvate:ferredoxin oxidoreducta	3e-08
COG1149		284	COG1149, COG1149, MinD superfamily P-loop ATPase c	7e-08
pfam12838		48	pfam12838, Fer4_7, 4Fe-4S dicluster domain	8e-08
cd00802		143	cd00802, class_I_aaRS_core, catalytic core domain	9e-08
TIGR02179		78	TIGR02179, PorD_KorD, 2-oxoacid:acceptor oxidoredu	1e-07
pfam13237		51	pfam13237, Fer4_10, 4Fe-4S dicluster domain	2e-07
TIGR01971		122	TIGR01971, NuoI, NADH-quinone oxidoreductase, chai	6e-07
PRK08318		420	PRK08318, PRK08318, dihydropyrimidine dehydrogenas	1e-06
PRK12771		564	PRK12771, PRK12771, putative glutamate synthase (N	2e-06
PRK13795		636	PRK13795, PRK13795, hypothetical protein; Provisio	4e-06
TIGR02512		374	TIGR02512, FeFe_hydrog_A, [FeFe] hydrogenase, grou	5e-06
COG1143		172	COG1143, NuoI, Formate hydrogenlyase subunit 6/NAD	5e-06
pfam13183		54	pfam13183, Fer4_8, 4Fe-4S dicluster domain	6e-06
PRK09623		105	PRK09623, vorD, 2-ketoisovalerate ferredoxin oxido	7e-06
TIGR04041		276	TIGR04041, activase_YjjW, glycine radical enzyme a	2e-05
PRK09898		208	PRK09898, PRK09898, hypothetical protein; Provisio	4e-05
pfam13484		67	pfam13484, Fer4_16, 4Fe-4S double cluster binding	7e-05
COG1245		591	COG1245, COG1245, Predicted ATPase, RNase L inhibi	7e-05
TIGR03838		271	TIGR03838, queuosine_YadB, glutamyl-queuosine tRNA	8e-05
TIGR00403		183	TIGR00403, ndhI, NADH-plastoquinone oxidoreductase	1e-04
PRK08348		120	PRK08348, PRK08348, NADH-plastoquinone oxidoreduct	1e-04
COG1456		467	COG1456, CdhE, CO dehydrogenase/acetyl-CoA synthas	1e-04
PRK13409		590	PRK13409, PRK13409, putative ATPase RIL; Provision	2e-04
pfam00037		24	pfam00037, Fer4, 4Fe-4S binding domain	2e-04
COG1142		165	COG1142, HycB, Fe-S-cluster-containing hydrogenase	2e-04
cd02156		105	cd02156, nt_trans, nucleotidyl transferase superfa	2e-04
CHL00014		167	CHL00014, ndhI, NADH dehydrogenase subunit I	2e-04
COG4231		640	COG4231, COG4231, Indolepyruvate ferredoxin oxidor	2e-04
COG0437		203	COG0437, HybA, Fe-S-cluster-containing hydrogenase	3e-04
PRK02651		81	PRK02651, PRK02651, photosystem I subunit VII; Pro	3e-04
PRK04165		450	PRK04165, PRK04165, acetyl-CoA decarbonylase/synth	3e-04
PRK09624		105	PRK09624, porD, pyuvate ferredoxin oxidoreductase	3e-04
TIGR04105		462	TIGR04105, FeFe_hydrog_B1, [FeFe] hydrogenase, gro	3e-04
COG2221		317	COG2221, DsrA, Dissimilatory sulfite reductase (de	3e-04
COG1148		622	COG1148, HdrA, Heterodisulfide reductase, subunit	4e-04
PRK05035		695	PRK05035, PRK05035, electron transport complex pro	4e-04
TIGR03336		595	TIGR03336, IOR_alpha, indolepyruvate ferredoxin ox	6e-04
PRK14028		312	PRK14028, PRK14028, pyruvate ferredoxin oxidoreduc	7e-04
TIGR02163		255	TIGR02163, napH_, ferredoxin-type protein, NapH/Ma	8e-04
TIGR02700		234	TIGR02700, flavo_MJ0208, archaeoflavoprotein, MJ02	0.001
TIGR03224		411	TIGR03224, benzo_boxA, benzoyl-CoA oxygenase/reduc	0.001
TIGR02494		295	TIGR02494, PFLE_PFLC, glycyl-radical enzyme activa	0.001
PRK09625		133	PRK09625, porD, pyruvate flavodoxin oxidoreductase	0.001
PRK13795		636	PRK13795, PRK13795, hypothetical protein; Provisio	0.002
TIGR04105		462	TIGR04105, FeFe_hydrog_B1, [FeFe] hydrogenase, gro	0.002
TIGR03048		80	TIGR03048, PS_I_psaC, photosystem I iron-sulfur pr	0.002
PLN00071		81	PLN00071, PLN00071, photosystem I subunit VII; Pro	0.002
TIGR04270		535	TIGR04270, Rama_corrin_act, methylamine methyltran	0.002
TIGR01582		283	TIGR01582, FDH-beta, formate dehydrogenase, beta s	0.003
pfam12837		24	pfam12837, Fer4_6, 4Fe-4S binding domain	0.003

>gnl\|CDD\|235424 PRK05347, PRK05347, glutaminyl-tRNA synthetase; Provisional	Back alignment and domain information

 Score =  874 bits (2261), Expect = 0.0
 Identities = 286/520 (55%), Positives = 365/520 (70%), Gaps = 22/520 (4%)

Query: 14  NKLPQVITRFAPEPNGYLHIGHAKSIFINFELAYKYNGLCNLRFDDTNPLKENKEYVNSI 73
            K  +V TRF PEPNGYLHIGHAKSI +NF LA  Y G CNLRFDDTNP KE++EYV+SI
Sbjct: 25  GKHTRVHTRFPPEPNGYLHIGHAKSICLNFGLAQDYGGKCNLRFDDTNPEKEDQEYVDSI 84

Query: 74  IKTIKWLNFNWDKVKKRIYYASDYFDILYKIAEYLIISGDAYVDSQNTEEIYINRGNLHE 133
            + ++WL F+W      + YASDYFD LY+ A  LI  G AYVD  + EEI   RG L E
Sbjct: 85  KEDVRWLGFDWSG---ELRYASDYFDQLYEYAVELIKKGKAYVDDLSAEEIREYRGTLTE 141

Query: 134 PGRNSPFYNRLPSESLNLFRRMRSGEFKDGAHVLRVKINMKSKNINMRDPIIYRIRHVNH 193
           PG+NSP+ +R   E+L+LF RMR+GEF +G+ VLR KI+M S NINMRDP++YRIRH +H
Sbjct: 142 PGKNSPYRDRSVEENLDLFERMRAGEFPEGSAVLRAKIDMASPNINMRDPVLYRIRHAHH 201

Query: 194 YRTNNNWCIYPMYDYAHPISDAIENITHSICTLEFQDHRPFYEWILNKIDKTNFIKRPFP 253
           +RT + WCIYPMYD+AH ISDAIE ITHS+CTLEF+DHRP Y+W+L+ +        P P
Sbjct: 202 HRTGDKWCIYPMYDFAHCISDAIEGITHSLCTLEFEDHRPLYDWVLDNL-----PIPPHP 256

Query: 254 KQYEFSRLNLTHTITSKRKLLKLLEKKIVDGWDDPRMPTLIGMRRRGYTPESIKLFCKRI 313
           +QYEFSRLNLT+T+ SKRKL +L+E+K VDGWDDPRMPT+ G+RRRGYTPESI+ FC+RI
Sbjct: 257 RQYEFSRLNLTYTVMSKRKLKQLVEEKHVDGWDDPRMPTISGLRRRGYTPESIREFCERI 316

Query: 314 GVSKSDSWINIEILEQALRDDLDIKAPRIMAVLNPIKLIISNFLDNQEIECTAPLFSRQH 373
           GV+K DS I++ +LE  +R+DL+  APR MAVL+P+KL+I+N+ + Q  E  AP     H
Sbjct: 317 GVTKQDSVIDMSMLESCIREDLNENAPRAMAVLDPLKLVITNYPEGQVEELEAP----NH 372

Query: 374 TQYKEK-LRYFPISKILWIERDDFMEIPTKKYFRLYPPIGKNSGNRVRLRYGYVVECTGF 432
            +  E   R  P S+ L+IER+DFME P KKYFRL P      G  VRLR  YV++C   
Sbjct: 373 PEDPEMGTREVPFSRELYIEREDFMEEPPKKYFRLVP------GKEVRLRNAYVIKCEEV 426

Query: 433 KKNKNNEVVEVYCKYFPDSKSGTKLSSNYKVKGNIHWISKSHALSIEARLYDRLFIDPYP 492
            K+ +  + E++C Y PD+ SG   +   KVKG IHW+S +HA+  E RLYDRLF  P P
Sbjct: 427 VKDADGNITEIHCTYDPDTLSG-NPADGRKVKGTIHWVSAAHAVPAEVRLYDRLFTVPNP 485

Query: 493 NIVNNKDFKLLINPNSKKVISAYLEPNLKLIFPKKHAQFE 532
                KDF   +NP+S  +   ++EP+L    P+   QFE
Sbjct: 486 A--AGKDFLDFLNPDSLVIKQGFVEPSLADAKPEDRFQFE 523

Length = 554

>gnl\|CDD\|237793 PRK14703, PRK14703, glutaminyl-tRNA synthetase/YqeY domain fusion protein; Provisional	Back alignment and domain information

>gnl\|CDD\|232977 TIGR00440, glnS, glutaminyl-tRNA synthetase	Back alignment and domain information

>gnl\|CDD\|178450 PLN02859, PLN02859, glutamine-tRNA ligase	Back alignment and domain information

>gnl\|CDD\|240418 PTZ00437, PTZ00437, glutaminyl-tRNA synthetase; Provisional	Back alignment and domain information

>gnl\|CDD\|223087 COG0008, GlnS, Glutamyl- and glutaminyl-tRNA synthetases [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>gnl\|CDD\|216096 pfam00749, tRNA-synt_1c, tRNA synthetases class I (E and Q), catalytic domain	Back alignment and domain information

>gnl\|CDD\|235903 PRK06991, PRK06991, ferredoxin; Provisional	Back alignment and domain information

>gnl\|CDD\|235229 PRK04156, gltX, glutamyl-tRNA synthetase; Provisional	Back alignment and domain information

>gnl\|CDD\|232985 TIGR00463, gltX_arch, glutamyl-tRNA synthetase, archaeal and eukaryotic family	Back alignment and domain information

>gnl\|CDD\|215492 PLN02907, PLN02907, glutamate-tRNA ligase	Back alignment and domain information

>gnl\|CDD\|185676 cd00807, GlnRS_core, catalytic core domain of glutaminyl-tRNA synthetase	Back alignment and domain information

>gnl\|CDD\|178772 PLN03233, PLN03233, putative glutamate-tRNA ligase; Provisional	Back alignment and domain information

>gnl\|CDD\|240404 PTZ00402, PTZ00402, glutamyl-tRNA synthetase; Provisional	Back alignment and domain information

>gnl\|CDD\|235347 PRK05113, PRK05113, electron transport complex protein RnfB; Provisional	Back alignment and domain information

>gnl\|CDD\|225433 COG2878, COG2878, Predicted NADH:ubiquinone oxidoreductase, subunit RnfB [Energy production and conversion]	Back alignment and domain information

>gnl\|CDD\|233648 TIGR01944, rnfB, electron transport complex, RnfABCDGE type, B subunit	Back alignment and domain information

>gnl\|CDD\|181550 PRK08764, PRK08764, ferredoxin; Provisional	Back alignment and domain information

>gnl\|CDD\|217810 pfam03950, tRNA-synt_1c_C, tRNA synthetases class I (E and Q), anti-codon binding domain	Back alignment and domain information

>gnl\|CDD\|185676 cd00807, GlnRS_core, catalytic core domain of glutaminyl-tRNA synthetase	Back alignment and domain information

>gnl\|CDD\|185672 cd00418, GlxRS_core, catalytic core domain of glutamyl-tRNA and glutaminyl-tRNA synthetase	Back alignment and domain information

>gnl\|CDD\|185672 cd00418, GlxRS_core, catalytic core domain of glutamyl-tRNA and glutaminyl-tRNA synthetase	Back alignment and domain information

>gnl\|CDD\|185682 cd09287, GluRS_non_core, catalytic core domain of non-discriminating glutamyl-tRNA synthetase	Back alignment and domain information

>gnl\|CDD\|185682 cd09287, GluRS_non_core, catalytic core domain of non-discriminating glutamyl-tRNA synthetase	Back alignment and domain information

>gnl\|CDD\|183594 PRK12558, PRK12558, glutamyl-tRNA synthetase; Provisional	Back alignment and domain information

>gnl\|CDD\|173905 cd00808, GluRS_core, catalytic core domain of discriminating glutamyl-tRNA synthetase	Back alignment and domain information

>gnl\|CDD\|235941 PRK07118, PRK07118, ferredoxin; Validated	Back alignment and domain information

>gnl\|CDD\|232986 TIGR00464, gltX_bact, glutamyl-tRNA synthetase, bacterial family	Back alignment and domain information

>gnl\|CDD\|234953 PRK01406, gltX, glutamyl-tRNA synthetase; Reviewed	Back alignment and domain information

>gnl\|CDD\|184889 PRK14895, gltX, glutamyl-tRNA synthetase; Provisional	Back alignment and domain information

>gnl\|CDD\|235573 PRK05710, PRK05710, glutamyl-Q tRNA(Asp) synthetase; Reviewed	Back alignment and domain information

>gnl\|CDD\|224068 COG1145, NapF, Ferredoxin [Energy production and conversion]	Back alignment and domain information

>gnl\|CDD\|112857 pfam04060, FeS, Putative Fe-S cluster	Back alignment and domain information

>gnl\|CDD\|178234 PLN02627, PLN02627, glutamyl-tRNA synthetase	Back alignment and domain information

>gnl\|CDD\|221966 pfam13187, Fer4_9, 4Fe-4S dicluster domain	Back alignment and domain information

>gnl\|CDD\|224069 COG1146, COG1146, Ferredoxin [Energy production and conversion]	Back alignment and domain information

>gnl\|CDD\|235941 PRK07118, PRK07118, ferredoxin; Validated	Back alignment and domain information

>gnl\|CDD\|235637 PRK05888, PRK05888, NADH dehydrogenase subunit I; Provisional	Back alignment and domain information

>gnl\|CDD\|224067 COG1144, COG1144, Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, delta subunit [Energy production and conversion]	Back alignment and domain information

>gnl\|CDD\|224071 COG1149, COG1149, MinD superfamily P-loop ATPase containing an inserted ferredoxin domain [Energy production and conversion]	Back alignment and domain information

>gnl\|CDD\|221801 pfam12838, Fer4_7, 4Fe-4S dicluster domain	Back alignment and domain information

>gnl\|CDD\|173901 cd00802, class_I_aaRS_core, catalytic core domain of class I amino acyl-tRNA synthetase	Back alignment and domain information

>gnl\|CDD\|131234 TIGR02179, PorD_KorD, 2-oxoacid:acceptor oxidoreductase, delta subunit, pyruvate/2-ketoisovalerate family	Back alignment and domain information

>gnl\|CDD\|205417 pfam13237, Fer4_10, 4Fe-4S dicluster domain	Back alignment and domain information

>gnl\|CDD\|233661 TIGR01971, NuoI, NADH-quinone oxidoreductase, chain I	Back alignment and domain information

>gnl\|CDD\|236237 PRK08318, PRK08318, dihydropyrimidine dehydrogenase subunit B; Validated	Back alignment and domain information

>gnl\|CDD\|237198 PRK12771, PRK12771, putative glutamate synthase (NADPH) small subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|237510 PRK13795, PRK13795, hypothetical protein; Provisional	Back alignment and domain information

>gnl\|CDD\|233903 TIGR02512, FeFe_hydrog_A, [FeFe] hydrogenase, group A	Back alignment and domain information

>gnl\|CDD\|224066 COG1143, NuoI, Formate hydrogenlyase subunit 6/NADH:ubiquinone oxidoreductase 23 kD subunit (chain I) [Energy production and conversion]	Back alignment and domain information

>gnl\|CDD\|221963 pfam13183, Fer4_8, 4Fe-4S dicluster domain	Back alignment and domain information

>gnl\|CDD\|170016 PRK09623, vorD, 2-ketoisovalerate ferredoxin oxidoreductase subunit delta; Reviewed	Back alignment and domain information

>gnl\|CDD\|188556 TIGR04041, activase_YjjW, glycine radical enzyme activase, YjjW family	Back alignment and domain information

>gnl\|CDD\|182135 PRK09898, PRK09898, hypothetical protein; Provisional	Back alignment and domain information

>gnl\|CDD\|222168 pfam13484, Fer4_16, 4Fe-4S double cluster binding domain	Back alignment and domain information

>gnl\|CDD\|224166 COG1245, COG1245, Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only]	Back alignment and domain information

>gnl\|CDD\|234370 TIGR03838, queuosine_YadB, glutamyl-queuosine tRNA(Asp) synthetase	Back alignment and domain information

>gnl\|CDD\|129498 TIGR00403, ndhI, NADH-plastoquinone oxidoreductase subunit I protein	Back alignment and domain information

>gnl\|CDD\|181399 PRK08348, PRK08348, NADH-plastoquinone oxidoreductase subunit; Provisional	Back alignment and domain information

>gnl\|CDD\|224373 COG1456, CdhE, CO dehydrogenase/acetyl-CoA synthase gamma subunit (corrinoid Fe-S protein) [Energy production and conversion]	Back alignment and domain information

>gnl\|CDD\|184037 PRK13409, PRK13409, putative ATPase RIL; Provisional	Back alignment and domain information

>gnl\|CDD\|215671 pfam00037, Fer4, 4Fe-4S binding domain	Back alignment and domain information

>gnl\|CDD\|224065 COG1142, HycB, Fe-S-cluster-containing hydrogenase components 2 [Energy production and conversion]	Back alignment and domain information

>gnl\|CDD\|173912 cd02156, nt_trans, nucleotidyl transferase superfamily	Back alignment and domain information

>gnl\|CDD\|214334 CHL00014, ndhI, NADH dehydrogenase subunit I	Back alignment and domain information

>gnl\|CDD\|226684 COG4231, COG4231, Indolepyruvate ferredoxin oxidoreductase, alpha and beta subunits [Energy production and conversion]	Back alignment and domain information

>gnl\|CDD\|223514 COG0437, HybA, Fe-S-cluster-containing hydrogenase components 1 [Energy production and conversion]	Back alignment and domain information

>gnl\|CDD\|179457 PRK02651, PRK02651, photosystem I subunit VII; Provisional	Back alignment and domain information

>gnl\|CDD\|235235 PRK04165, PRK04165, acetyl-CoA decarbonylase/synthase complex subunit gamma; Provisional	Back alignment and domain information

>gnl\|CDD\|170017 PRK09624, porD, pyuvate ferredoxin oxidoreductase subunit delta; Reviewed	Back alignment and domain information

>gnl\|CDD\|234472 TIGR04105, FeFe_hydrog_B1, [FeFe] hydrogenase, group B1/B3	Back alignment and domain information

>gnl\|CDD\|225131 COG2221, DsrA, Dissimilatory sulfite reductase (desulfoviridin), alpha and beta subunits [Energy production and conversion]	Back alignment and domain information

>gnl\|CDD\|224070 COG1148, HdrA, Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion]	Back alignment and domain information

>gnl\|CDD\|235334 PRK05035, PRK05035, electron transport complex protein RnfC; Provisional	Back alignment and domain information

>gnl\|CDD\|234170 TIGR03336, IOR_alpha, indolepyruvate ferredoxin oxidoreductase, alpha subunit	Back alignment and domain information

>gnl\|CDD\|172522 PRK14028, PRK14028, pyruvate ferredoxin oxidoreductase subunit gamma/delta; Provisional	Back alignment and domain information

>gnl\|CDD\|233754 TIGR02163, napH_, ferredoxin-type protein, NapH/MauN family	Back alignment and domain information

>gnl\|CDD\|131747 TIGR02700, flavo_MJ0208, archaeoflavoprotein, MJ0208 family	Back alignment and domain information

>gnl\|CDD\|132268 TIGR03224, benzo_boxA, benzoyl-CoA oxygenase/reductase, BoxA protein	Back alignment and domain information

>gnl\|CDD\|233895 TIGR02494, PFLE_PFLC, glycyl-radical enzyme activating protein family	Back alignment and domain information

>gnl\|CDD\|236596 PRK09625, porD, pyruvate flavodoxin oxidoreductase subunit delta; Reviewed	Back alignment and domain information

>gnl\|CDD\|237510 PRK13795, PRK13795, hypothetical protein; Provisional	Back alignment and domain information

>gnl\|CDD\|234472 TIGR04105, FeFe_hydrog_B1, [FeFe] hydrogenase, group B1/B3	Back alignment and domain information

>gnl\|CDD\|132092 TIGR03048, PS_I_psaC, photosystem I iron-sulfur protein PsaC	Back alignment and domain information

>gnl\|CDD\|177700 PLN00071, PLN00071, photosystem I subunit VII; Provisional	Back alignment and domain information

>gnl\|CDD\|211993 TIGR04270, Rama_corrin_act, methylamine methyltransferase corrinoid protein reductive activase	Back alignment and domain information

>gnl\|CDD\|233481 TIGR01582, FDH-beta, formate dehydrogenase, beta subunit, Fe-S containing	Back alignment and domain information

>gnl\|CDD\|205098 pfam12837, Fer4_6, 4Fe-4S binding domain	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		736
PRK05347		554	glutaminyl-tRNA synthetase; Provisional	100.0
PTZ00437		574	glutaminyl-tRNA synthetase; Provisional	100.0
TIGR00440		522	glnS glutaminyl-tRNA synthetase. This protein is a	100.0
PRK14703		771	glutaminyl-tRNA synthetase/YqeY domain fusion prot	100.0
PLN02859		788	glutamine-tRNA ligase	100.0
PLN03233		523	putative glutamate-tRNA ligase; Provisional	100.0
PTZ00402		601	glutamyl-tRNA synthetase; Provisional	100.0
PLN02907		722	glutamate-tRNA ligase	100.0
KOG1148\|consensus		764		100.0
KOG1147\|consensus		712		100.0
PRK04156		567	gltX glutamyl-tRNA synthetase; Provisional	100.0
TIGR00463		560	gltX_arch glutamyl-tRNA synthetase, archaeal and e	100.0
COG0008		472	GlnS Glutamyl- and glutaminyl-tRNA synthetases [Tr	100.0
KOG1149\|consensus		524		100.0
PLN02627		535	glutamyl-tRNA synthetase	100.0
cd00807		238	GlnRS_core catalytic core domain of glutaminyl-tRN	100.0
PRK12410		433	glutamylglutaminyl-tRNA synthetase; Provisional	100.0
PRK12558		445	glutamyl-tRNA synthetase; Provisional	100.0
cd09287		240	GluRS_non_core catalytic core domain of non-discri	100.0
PRK01406		476	gltX glutamyl-tRNA synthetase; Reviewed	100.0
PF00749		314	tRNA-synt_1c: tRNA synthetases class I (E and Q),	100.0
PRK14895		513	gltX glutamyl-tRNA synthetase; Provisional	100.0
TIGR00464		470	gltX_bact glutamyl-tRNA synthetase, bacterial fami	100.0
PRK05710		299	glutamyl-Q tRNA(Asp) synthetase; Reviewed	100.0
TIGR03838		272	queuosine_YadB glutamyl-queuosine tRNA(Asp) synthe	100.0
cd00418		230	GlxRS_core catalytic core domain of glutamyl-tRNA	100.0
cd00808		239	GluRS_core catalytic core domain of discriminating	100.0
PF03950		174	tRNA-synt_1c_C: tRNA synthetases class I (E and Q)	100.0
COG0215		464	CysS Cysteinyl-tRNA synthetase [Translation, ribos	99.97
PF01406		300	tRNA-synt_1e: tRNA synthetases class I (C) catalyt	99.97
PLN02946		557	cysteine-tRNA ligase	99.96
PRK14536		490	cysS cysteinyl-tRNA synthetase; Provisional	99.95
PRK06991		270	ferredoxin; Provisional	99.95
TIGR00435		465	cysS cysteinyl-tRNA synthetase. This model finds t	99.95
PRK12418		384	cysteinyl-tRNA synthetase; Provisional	99.94
PRK14535		699	cysS cysteinyl-tRNA synthetase; Provisional	99.94
PRK14534		481	cysS cysteinyl-tRNA synthetase; Provisional	99.94
PRK00260		463	cysS cysteinyl-tRNA synthetase; Validated	99.94
TIGR03447		411	mycothiol_MshC cysteine--1-D-myo-inosityl 2-amino-	99.94
KOG2007\|consensus		586		99.93
PTZ00399		651	cysteinyl-tRNA-synthetase; Provisional	99.93
cd00671		212	ArgRS_core catalytic core domain of arginyl-tRNA s	99.82
COG2878		198	Predicted NADH:ubiquinone oxidoreductase, subunit	99.81
PRK08764		135	ferredoxin; Provisional	99.81
PRK01611		507	argS arginyl-tRNA synthetase; Reviewed	99.78
PRK05113		191	electron transport complex protein RnfB; Provision	99.76
TIGR01944		165	rnfB electron transport complex, RnfABCDGE type, B	99.73
PRK11893		511	methionyl-tRNA synthetase; Reviewed	99.67
cd00814		319	MetRS_core catalytic core domain of methioninyl-tR	99.53
PRK12451		562	arginyl-tRNA synthetase; Reviewed	99.53
PRK07118		280	ferredoxin; Validated	99.53
COG0143		558	MetG Methionyl-tRNA synthetase [Translation, ribos	99.52
TIGR00456		566	argS arginyl-tRNA synthetase. This model recognize	99.52
PF13247		98	Fer4_11: 4Fe-4S dicluster domain; PDB: 2VPY_F 2VPX	99.5
cd00668		312	Ile_Leu_Val_MetRS_core catalytic core domain of is	99.5
PLN02224		616	methionine-tRNA ligase	99.48
COG0437		203	HybA Fe-S-cluster-containing hydrogenase component	99.48
cd00672		213	CysRS_core catalytic core domain of cysteinyl tRNA	99.47
TIGR00398		530	metG methionyl-tRNA synthetase. The methionyl-tRNA	99.47
PRK12267		648	methionyl-tRNA synthetase; Reviewed	99.45
PRK00133		673	metG methionyl-tRNA synthetase; Reviewed	99.45
COG0018		577	ArgS Arginyl-tRNA synthetase [Translation, ribosom	99.42
PLN02610		801	probable methionyl-tRNA synthetase	99.41
PRK12268		556	methionyl-tRNA synthetase; Reviewed	99.41
cd00802		143	class_I_aaRS_core catalytic core domain of class I	99.41
PLN02286		576	arginine-tRNA ligase	99.34
cd00818		338	IleRS_core catalytic core domain of isoleucyl-tRNA	99.33
TIGR03478		321	DMSO_red_II_bet DMSO reductase family type II enzy	99.32
PF09334		391	tRNA-synt_1g: tRNA synthetases class I (M); InterP	99.31
cd00812		314	LeuRS_core catalytic core domain of leucyl-tRNA sy	99.31
TIGR01660		492	narH nitrate reductase, beta subunit. The Nitrate	99.29
PF00750		354	tRNA-synt_1d: tRNA synthetases class I (R); InterP	99.26
PF14697		59	Fer4_21: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE	99.26
COG1142		165	HycB Fe-S-cluster-containing hydrogenase component	99.24
COG1143		172	NuoI Formate hydrogenlyase subunit 6/NADH:ubiquino	99.23
PRK08493		819	NADH dehydrogenase subunit G; Validated	99.23
cd00817		382	ValRS_core catalytic core domain of valyl-tRNA syn	99.22
PRK14993		244	tetrathionate reductase subunit B; Provisional	99.19
TIGR03149		225	cyt_nit_nrfC cytochrome c nitrite reductase, Fe-S	99.18
PRK09898		208	hypothetical protein; Provisional	99.15
PRK07569		234	bidirectional hydrogenase complex protein HoxU; Va	99.15
COG3383		978	Uncharacterized anaerobic dehydrogenase [General f	99.15
cd00674		353	LysRS_core_class_I catalytic core domain of class	99.14
TIGR01582		283	FDH-beta formate dehydrogenase, beta subunit, Fe-S	99.13
PRK10882		328	hydrogenase 2 protein HybA; Provisional	99.13
PRK00750		510	lysK lysyl-tRNA synthetase; Reviewed	99.08
PTZ00305		297	NADH:ubiquinone oxidoreductase; Provisional	99.08
TIGR01973		603	NuoG NADH-quinone oxidoreductase, chain G. This mo	99.06
COG1148		622	HdrA Heterodisulfide reductase, subunit A and rela	99.06
PF13187		55	Fer4_9: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_	99.04
PRK09130		687	NADH dehydrogenase subunit G; Validated	99.02
PRK08166		847	NADH dehydrogenase subunit G; Validated	99.02
PRK05035		695	electron transport complex protein RnfC; Provision	99.01
PRK07860		797	NADH dehydrogenase subunit G; Validated	99.0
PRK09129		776	NADH dehydrogenase subunit G; Validated	99.0
KOG0436\|consensus		578		99.0
TIGR02951		161	DMSO_dmsB DMSO reductase, iron-sulfur subunit. Thi	98.99
COG1144		91	Pyruvate:ferredoxin oxidoreductase and related 2-o	98.99
PRK10330		181	formate dehydrogenase-H ferredoxin subunit; Provis	98.98
PRK08348		120	NADH-plastoquinone oxidoreductase subunit; Provisi	98.93
COG1034		693	NuoG NADH dehydrogenase/NADH:ubiquinone oxidoreduc	98.92
TIGR02936		91	fdxN_nitrog ferredoxin III, nif-specific. Members	98.92
PRK09624		105	porD pyuvate ferredoxin oxidoreductase subunit del	98.9
PRK08222		181	hydrogenase 4 subunit H; Validated	98.88
TIGR02179		78	PorD_KorD 2-oxoacid:acceptor oxidoreductase, delta	98.86
PRK09625		133	porD pyruvate flavodoxin oxidoreductase subunit de	98.85
KOG3256\|consensus		212		98.85
PRK09623		105	vorD 2-ketoisovalerate ferredoxin oxidoreductase s	98.84
PRK09626		103	oorD 2-oxoglutarate-acceptor oxidoreductase subuni	98.83
TIGR00403		183	ndhI NADH-plastoquinone oxidoreductase subunit I p	98.81
TIGR00397		213	mauM_napG MauM/NapG family ferredoxin-type protein	98.8
PF12838		52	Fer4_7: 4Fe-4S dicluster domain; InterPro: IPR0014	98.8
PRK12769		654	putative oxidoreductase Fe-S binding subunit; Revi	98.79
TIGR02494		295	PFLE_PFLC glycyl-radical enzyme activating protein	98.79
COG1146		68	Ferredoxin [Energy production and conversion]	98.79
PRK12387		180	formate hydrogenlyase complex iron-sulfur subunit;	98.78
CHL00065		81	psaC photosystem I subunit VII	98.77
PRK05888		164	NADH dehydrogenase subunit I; Provisional	98.75
PRK06273		165	ferredoxin; Provisional	98.75
PLN00071		81	photosystem I subunit VII; Provisional	98.74
PF13237		52	Fer4_10: 4Fe-4S dicluster domain; PDB: 2FGO_A.	98.73
COG1149		284	MinD superfamily P-loop ATPase containing an inser	98.73
PRK13208		800	valS valyl-tRNA synthetase; Reviewed	98.71
TIGR02060		132	aprB adenosine phosphosulphate reductase, beta sub	98.71
PRK12809		639	putative oxidoreductase Fe-S binding subunit; Revi	98.71
COG1145		99	NapF Ferredoxin [Energy production and conversion]	98.71
CHL00014		167	ndhI NADH dehydrogenase subunit I	98.7
PRK09476		254	napG quinol dehydrogenase periplasmic component; P	98.7
TIGR00467		515	lysS_arch lysyl-tRNA synthetase, archaeal and spir	98.68
PRK10194		163	ferredoxin-type protein; Provisional	98.67
PRK09477		271	napH quinol dehydrogenase membrane component; Prov	98.66
TIGR00422		861	valS valyl-tRNA synthetase. The valyl-tRNA synthet	98.64
TIGR01971		122	NuoI NADH-quinone oxidoreductase, chain I. This mo	98.64
TIGR03048		80	PS_I_psaC photosystem I iron-sulfur protein PsaC.	98.63
TIGR02163		255	napH_ ferredoxin-type protein, NapH/MauN family. M	98.6
PRK10194		163	ferredoxin-type protein; Provisional	98.52
PRK02651		81	photosystem I subunit VII; Provisional	98.51
PRK05729		874	valS valyl-tRNA synthetase; Reviewed	98.51
PF13247		98	Fer4_11: 4Fe-4S dicluster domain; PDB: 2VPY_F 2VPX	98.51
TIGR00402		101	napF ferredoxin-type protein NapF. The gene codes	98.49
PRK07118		280	ferredoxin; Validated	98.48
PRK08318		420	dihydropyrimidine dehydrogenase subunit B; Validat	98.47
TIGR02700		234	flavo_MJ0208 archaeoflavoprotein, MJ0208 family. T	98.47
COG1140		513	NarY Nitrate reductase beta subunit [Energy produc	98.45
TIGR01660		492	narH nitrate reductase, beta subunit. The Nitrate	98.45
COG4656		529	RnfC Predicted NADH:ubiquinone oxidoreductase, sub	98.44
PRK00783		263	DNA-directed RNA polymerase subunit D; Provisional	98.43
PRK14028		312	pyruvate ferredoxin oxidoreductase subunit gamma/d	98.43
COG1142		165	HycB Fe-S-cluster-containing hydrogenase component	98.39
cd07030		259	RNAP_D D subunit of Archaeal RNA polymerase. The D	98.37
TIGR03478		321	DMSO_red_II_bet DMSO reductase family type II enzy	98.35
TIGR02512		374	Fe_only_hydrog hydrogenases, Fe-only. This model d	98.34
COG2768		354	Uncharacterized Fe-S center protein [General funct	98.32
TIGR03224		411	benzo_boxA benzoyl-CoA oxygenase/reductase, BoxA p	98.3
TIGR02912		314	sulfite_red_C sulfite reductase, subunit C. Member	98.29
TIGR03294		228	FrhG coenzyme F420 hydrogenase, subunit gamma. Thi	98.25
TIGR00397		213	mauM_napG MauM/NapG family ferredoxin-type protein	98.23
PF12837		24	Fer4_6: 4Fe-4S binding domain; InterPro: IPR001450	98.22
TIGR03287		391	methan_mark_16 putative methanogenesis marker 16 m	98.21
TIGR02176		1165	pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxid	98.2
TIGR03149		225	cyt_nit_nrfC cytochrome c nitrite reductase, Fe-S	98.19
COG2221		317	DsrA Dissimilatory sulfite reductase (desulfovirid	98.19
TIGR01582		283	FDH-beta formate dehydrogenase, beta subunit, Fe-S	98.17
PRK14993		244	tetrathionate reductase subunit B; Provisional	98.14
PRK13984		604	putative oxidoreductase; Provisional	98.14
PRK09476		254	napG quinol dehydrogenase periplasmic component; P	98.14
COG0437		203	HybA Fe-S-cluster-containing hydrogenase component	98.13
PRK15449		95	ferredoxin-like protein FixX; Provisional	98.1
PF01921		360	tRNA-synt_1f: tRNA synthetases class I (K); InterP	98.08
cd00806		280	TrpRS_core catalytic core domain of tryptophanyl-t	98.08
PRK09898		208	hypothetical protein; Provisional	98.06
PRK10330		181	formate dehydrogenase-H ferredoxin subunit; Provis	98.05
TIGR00396		842	leuS_bact leucyl-tRNA synthetase, eubacterial and	98.04
PRK13795		636	hypothetical protein; Provisional	98.03
TIGR02745		434	ccoG_rdxA_fixG cytochrome c oxidase accessory prot	98.03
PRK00390		805	leuS leucyl-tRNA synthetase; Validated	98.01
TIGR02951		161	DMSO_dmsB DMSO reductase, iron-sulfur subunit. Thi	98.01
PRK09326		341	F420H2 dehydrogenase subunit F; Provisional	98.0
PRK10882		328	hydrogenase 2 protein HybA; Provisional	97.99
PF13484		67	Fer4_16: 4Fe-4S double cluster binding domain	97.99
PF00037		24	Fer4: 4Fe-4S binding domain; InterPro: IPR001450 T	97.96
TIGR03315		1012	Se_ygfK putative selenate reductase, YgfK subunit.	97.84
PRK12771		564	putative glutamate synthase (NADPH) small subunit;	97.84
PRK12809		639	putative oxidoreductase Fe-S binding subunit; Revi	97.81
PLN02563		963	aminoacyl-tRNA ligase	97.8
PF12837		24	Fer4_6: 4Fe-4S binding domain; InterPro: IPR001450	97.78
COG4231		640	Indolepyruvate ferredoxin oxidoreductase, alpha an	97.76
COG1245		591	Predicted ATPase, RNase L inhibitor (RLI) homolog	97.75
TIGR02066		341	dsrB sulfite reductase, dissimilatory-type beta su	97.73
PF00037		24	Fer4: 4Fe-4S binding domain; InterPro: IPR001450 T	97.7
PRK09853		1019	putative selenate reductase subunit YgfK; Provisio	97.7
COG1384		521	LysS Lysyl-tRNA synthetase (class I) [Translation,	97.68
TIGR00392		861	ileS isoleucyl-tRNA synthetase. The isoleucyl tRNA	97.67
TIGR03336		595	IOR_alpha indolepyruvate ferredoxin oxidoreductase	97.67
COG1148		622	HdrA Heterodisulfide reductase, subunit A and rela	97.65
COG0495		814	LeuS Leucyl-tRNA synthetase [Translation, ribosoma	97.63
PTZ00419		995	valyl-tRNA synthetase-like protein; Provisional	97.63
PRK05743		912	ileS isoleucyl-tRNA synthetase; Reviewed	97.61
COG1143		172	NuoI Formate hydrogenlyase subunit 6/NADH:ubiquino	97.6
PRK14900		1052	valS valyl-tRNA synthetase; Provisional	97.6
PLN02943		958	aminoacyl-tRNA ligase	97.6
PF13183		57	Fer4_8: 4Fe-4S dicluster domain; PDB: 2BS4_B 1E7P_	97.58
PF04060		35	FeS: Putative Fe-S cluster; InterPro: IPR007202 Th	97.57
PRK13409		590	putative ATPase RIL; Provisional	97.57
PF14697		59	Fer4_21: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE	97.53
PF12797		22	Fer4_2: 4Fe-4S binding domain; InterPro: IPR001450	97.52
PRK06039		975	ileS isoleucyl-tRNA synthetase; Reviewed	97.46
PRK12769		654	putative oxidoreductase Fe-S binding subunit; Revi	97.45
PTZ00427		1205	isoleucine-tRNA ligase, putative; Provisional	97.45
TIGR01945		435	rnfC electron transport complex, RnfABCDGE type, C	97.43
PLN02381		1066	valyl-tRNA synthetase	97.43
PF00133		601	tRNA-synt_1: tRNA synthetases class I (I, L, M and	97.38
PLN02843		974	isoleucyl-tRNA synthetase	97.34
PLN02882		1159	aminoacyl-tRNA ligase	97.34
KOG0435\|consensus		876		97.3
TIGR00395		938	leuS_arch leucyl-tRNA synthetase, archaeal and cyt	97.28
PRK13984		604	putative oxidoreductase; Provisional	97.28
COG0525		877	ValS Valyl-tRNA synthetase [Translation, ribosomal	97.28
COG2440		99	FixX Ferredoxin-like protein [Energy production an	97.22
PRK13804		961	ileS isoleucyl-tRNA synthetase; Provisional	97.2
PF12798		15	Fer4_3: 4Fe-4S binding domain; InterPro: IPR001450	97.19
PRK00941		781	acetyl-CoA decarbonylase/synthase complex subunit	97.16
PRK08222		181	hydrogenase 4 subunit H; Validated	97.14
PRK12387		180	formate hydrogenlyase complex iron-sulfur subunit;	97.1
TIGR00314		784	cdhA CO dehydrogenase/acetyl-CoA synthase complex,	97.09
PF13459		65	Fer4_15: 4Fe-4S single cluster domain	97.09
TIGR00233		328	trpS tryptophanyl-tRNA synthetase. This model repr	97.09
PF13534		61	Fer4_17: 4Fe-4S dicluster domain; PDB: 1ZOY_B 3AE9	97.07
PRK07570		250	succinate dehydrogenase/fumarate reductase iron-su	97.05
COG1141		68	Fer Ferredoxin [Energy production and conversion]	97.03
PRK12814		652	putative NADPH-dependent glutamate synthase small	97.01
cd01916		731	ACS_1 Acetyl-CoA synthase (ACS), also known as ace	97.01
TIGR00276		282	iron-sulfur cluster binding protein, putative. Thi	97.0
TIGR03290		144	CoB_CoM_SS_C CoB--CoM heterodisulfide reductase, s	96.95
PRK12285		368	tryptophanyl-tRNA synthetase; Reviewed	96.92
TIGR00384		220	dhsB succinate dehydrogenase and fumarate reductas	96.92
PF13370		58	Fer4_13: 4Fe-4S single cluster domain; PDB: 1FXR_A	96.91
TIGR01936		447	nqrA NADH:ubiquinone oxidoreductase, Na(+)-translo	96.91
PF13187		55	Fer4_9: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_	96.89
TIGR02064		402	dsrA sulfite reductase, dissimilatory-type alpha s	96.89
PF12798		15	Fer4_3: 4Fe-4S binding domain; InterPro: IPR001450	96.86
TIGR02060		132	aprB adenosine phosphosulphate reductase, beta sub	96.84
PRK08348		120	NADH-plastoquinone oxidoreductase subunit; Provisi	96.84
PRK05352		448	Na(+)-translocating NADH-quinone reductase subunit	96.81
PF12838		52	Fer4_7: 4Fe-4S dicluster domain; InterPro: IPR0014	96.77
TIGR00273		432	iron-sulfur cluster-binding protein. Members of th	96.74
KOG0432\|consensus		995		96.71
PRK09625		133	porD pyruvate flavodoxin oxidoreductase subunit de	96.67
TIGR00403		183	ndhI NADH-plastoquinone oxidoreductase subunit I p	96.66
PRK12576		279	succinate dehydrogenase iron-sulfur subunit; Provi	96.65
COG1139		459	Uncharacterized conserved protein containing a fer	96.63
TIGR02486		314	RDH reductive dehalogenase. This model represents	96.62
PRK09624		105	porD pyuvate ferredoxin oxidoreductase subunit del	96.58
PLN02959		1084	aminoacyl-tRNA ligase	96.57
PRK15449		95	ferredoxin-like protein FixX; Provisional	96.53
PRK06273		165	ferredoxin; Provisional	96.53
PRK13030		1159	2-oxoacid ferredoxin oxidoreductase; Provisional	96.51
COG1144		91	Pyruvate:ferredoxin oxidoreductase and related 2-o	96.45
PRK09623		105	vorD 2-ketoisovalerate ferredoxin oxidoreductase s	96.44
TIGR00395		938	leuS_arch leucyl-tRNA synthetase, archaeal and cyt	96.43
PRK12385		244	fumarate reductase iron-sulfur subunit; Provisiona	96.43
PF12797		22	Fer4_2: 4Fe-4S binding domain; InterPro: IPR001450	96.41
KOG2282\|consensus		708		96.4
PF12800		17	Fer4_4: 4Fe-4S binding domain; InterPro: IPR001450	96.39
PRK06991		270	ferredoxin; Provisional	96.38
TIGR03287		391	methan_mark_16 putative methanogenesis marker 16 m	96.35
PF13237		52	Fer4_10: 4Fe-4S dicluster domain; PDB: 2FGO_A.	96.34
PRK04165		450	acetyl-CoA decarbonylase/synthase complex subunit	96.34
TIGR02066		341	dsrB sulfite reductase, dissimilatory-type beta su	96.33
PRK09193		1165	indolepyruvate ferredoxin oxidoreductase; Validate	96.3
PRK13029		1186	2-oxoacid ferredoxin oxidoreductase; Provisional	96.23
TIGR03224		411	benzo_boxA benzoyl-CoA oxygenase/reductase, BoxA p	96.19
PRK05888		164	NADH dehydrogenase subunit I; Provisional	96.18
TIGR01944		165	rnfB electron transport complex, RnfABCDGE type, B	96.16
PRK08640		249	sdhB succinate dehydrogenase iron-sulfur subunit;	96.14
PRK09626		103	oorD 2-oxoglutarate-acceptor oxidoreductase subuni	96.14
PRK11168		396	glpC sn-glycerol-3-phosphate dehydrogenase subunit	96.14
PRK05113		191	electron transport complex protein RnfB; Provision	96.13
TIGR02179		78	PorD_KorD 2-oxoacid:acceptor oxidoreductase, delta	96.11
TIGR03379		397	glycerol3P_GlpC glycerol-3-phosphate dehydrogenase	96.1
PRK06214		530	sulfite reductase; Provisional	96.07
CHL00014		167	ndhI NADH dehydrogenase subunit I	96.05
KOG3256\|consensus		212		96.01
COG1145		99	NapF Ferredoxin [Energy production and conversion]	95.97
COG1600		337	Uncharacterized Fe-S protein [Energy production an	95.97
PRK15055		344	anaerobic sulfite reductase subunit A; Provisional	95.94
PRK05950		232	sdhB succinate dehydrogenase iron-sulfur subunit;	95.89
COG1035		332	FrhB Coenzyme F420-reducing hydrogenase, beta subu	95.88
COG1245		591	Predicted ATPase, RNase L inhibitor (RLI) homolog	95.88
CHL00065		81	psaC photosystem I subunit VII	95.88
PRK08764		135	ferredoxin; Provisional	95.76
TIGR02910		334	sulfite_red_A sulfite reductase, subunit A. Member	95.74
TIGR01971		122	NuoI NADH-quinone oxidoreductase, chain I. This mo	95.7
TIGR00402		101	napF ferredoxin-type protein NapF. The gene codes	95.7
PRK12386		251	fumarate reductase iron-sulfur subunit; Provisiona	95.65
KOG0063\|consensus		592		95.65
PF12800		17	Fer4_4: 4Fe-4S binding domain; InterPro: IPR001450	95.63
COG1152		772	CdhA CO dehydrogenase/acetyl-CoA synthase alpha su	95.62
PLN00071		81	photosystem I subunit VII; Provisional	95.61
COG2768		354	Uncharacterized Fe-S center protein [General funct	95.57
PRK12577		329	succinate dehydrogenase iron-sulfur subunit; Provi	95.56
PRK12300		897	leuS leucyl-tRNA synthetase; Reviewed	95.55
COG3383		978	Uncharacterized anaerobic dehydrogenase [General f	95.52
KOG0063\|consensus		592		95.51
COG0180		314	TrpS Tryptophanyl-tRNA synthetase [Translation, ri	95.5
cd00805		269	TyrRS_core catalytic core domain of tyrosinyl-tRNA	95.48
TIGR02163		255	napH_ ferredoxin-type protein, NapH/MauN family. M	95.47
PRK13552		239	frdB fumarate reductase iron-sulfur subunit; Provi	95.39
TIGR02494		295	PFLE_PFLC glycyl-radical enzyme activating protein	95.38
PRK12575		235	succinate dehydrogenase iron-sulfur subunit; Provi	95.36
TIGR03048		80	PS_I_psaC photosystem I iron-sulfur protein PsaC.	95.33
PRK14028		312	pyruvate ferredoxin oxidoreductase subunit gamma/d	95.28
TIGR02745		434	ccoG_rdxA_fixG cytochrome c oxidase accessory prot	95.16
COG0060		933	IleS Isoleucyl-tRNA synthetase [Translation, ribos	95.1
PRK02651		81	photosystem I subunit VII; Provisional	95.09
TIGR02912		314	sulfite_red_C sulfite reductase, subunit C. Member	95.08
COG0348		386	NapH Polyferredoxin [Energy production and convers	95.06
PRK11274		407	glcF glycolate oxidase iron-sulfur subunit; Provis	95.01
COG1149		284	MinD superfamily P-loop ATPase containing an inser	95.0
PRK12771		564	putative glutamate synthase (NADPH) small subunit;	94.99
TIGR02936		91	fdxN_nitrog ferredoxin III, nif-specific. Members	94.95
COG0479		234	FrdB Succinate dehydrogenase/fumarate reductase, F	94.93
PRK06259		486	succinate dehydrogenase/fumarate reductase iron-su	94.9
PRK09477		271	napH quinol dehydrogenase membrane component; Prov	94.89
PRK08318		420	dihydropyrimidine dehydrogenase subunit B; Validat	94.84
PRK08560		329	tyrosyl-tRNA synthetase; Validated	94.81
PRK13409		590	putative ATPase RIL; Provisional	94.8
COG2878		198	Predicted NADH:ubiquinone oxidoreductase, subunit	94.79
COG1146		68	Ferredoxin [Energy production and conversion]	94.77
TIGR02176		1165	pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxid	94.73
PF13484		67	Fer4_16: 4Fe-4S double cluster binding domain	94.73
PLN00129		276	succinate dehydrogenase [ubiquinone] iron-sulfur s	94.66
COG1453		391	Predicted oxidoreductases of the aldo/keto reducta	94.54
TIGR02484		372	CitB CitB domain protein. CobZ is essential for co	94.5
TIGR02700		234	flavo_MJ0208 archaeoflavoprotein, MJ0208 family. T	94.49
PRK09853		1019	putative selenate reductase subunit YgfK; Provisio	94.41
PRK13795		636	hypothetical protein; Provisional	94.36
COG2221		317	DsrA Dissimilatory sulfite reductase (desulfovirid	94.35
PRK08493		819	NADH dehydrogenase subunit G; Validated	94.32
PRK15033		389	tricarballylate utilization protein B; Provisional	94.3
COG4231		640	Indolepyruvate ferredoxin oxidoreductase, alpha an	94.26
PRK12300		897	leuS leucyl-tRNA synthetase; Reviewed	94.25
COG0247		388	GlpC Fe-S oxidoreductase [Energy production and co	94.24
COG1140		513	NarY Nitrate reductase beta subunit [Energy produc	94.21
PF10588		41	NADH-G_4Fe-4S_3: NADH-ubiquinone oxidoreductase-G	94.18
TIGR02512		374	Fe_only_hydrog hydrogenases, Fe-only. This model d	94.14
PRK12556		332	tryptophanyl-tRNA synthetase; Provisional	94.03
PF13746		69	Fer4_18: 4Fe-4S dicluster domain	93.81
COG1941		247	FrhG Coenzyme F420-reducing hydrogenase, gamma sub	93.34
PF13746		69	Fer4_18: 4Fe-4S dicluster domain	93.31
TIGR00392		861	ileS isoleucyl-tRNA synthetase. The isoleucyl tRNA	93.27
PRK05743		912	ileS isoleucyl-tRNA synthetase; Reviewed	93.14
cd07030		259	RNAP_D D subunit of Archaeal RNA polymerase. The D	92.95
COG1150		195	HdrC Heterodisulfide reductase, subunit C [Energy	92.93
PRK06039		975	ileS isoleucyl-tRNA synthetase; Reviewed	92.66
PRK13354		410	tyrosyl-tRNA synthetase; Provisional	92.58
COG0495		814	LeuS Leucyl-tRNA synthetase [Translation, ribosoma	92.45
TIGR03336		595	IOR_alpha indolepyruvate ferredoxin oxidoreductase	92.28
PRK12282		333	tryptophanyl-tRNA synthetase II; Reviewed	92.26
PLN02486		383	aminoacyl-tRNA ligase	91.85
PRK00783		263	DNA-directed RNA polymerase subunit D; Provisional	91.83
PRK14900		1052	valS valyl-tRNA synthetase; Provisional	91.64
PLN02886		389	aminoacyl-tRNA ligase	91.61
TIGR03294		228	FrhG coenzyme F420 hydrogenase, subunit gamma. Thi	91.56
PLN02959		1084	aminoacyl-tRNA ligase	91.56
COG0008		472	GlnS Glutamyl- and glutaminyl-tRNA synthetases [Tr	91.06
PRK12283		398	tryptophanyl-tRNA synthetase; Reviewed	90.82
cd00395		273	Tyr_Trp_RS_core catalytic core domain of tyrosinyl	90.78
PRK00927		333	tryptophanyl-tRNA synthetase; Reviewed	90.34
PLN02943		958	aminoacyl-tRNA ligase	90.23
PRK14494		229	putative molybdopterin-guanine dinucleotide biosyn	89.81
PRK12284		431	tryptophanyl-tRNA synthetase; Reviewed	89.44
COG1456		467	CdhE CO dehydrogenase/acetyl-CoA synthase gamma su	89.39
PRK05035		695	electron transport complex protein RnfC; Provision	88.86
cd07032		291	RNAP_I_II_AC40 AC40 subunit of Eukaryotic RNA poly	88.69
TIGR03315		1012	Se_ygfK putative selenate reductase, YgfK subunit.	88.07
PRK00390		805	leuS leucyl-tRNA synthetase; Validated	88.0
PRK09326		341	F420H2 dehydrogenase subunit F; Provisional	87.85
TIGR00314		784	cdhA CO dehydrogenase/acetyl-CoA synthase complex,	87.69
PLN02882		1159	aminoacyl-tRNA ligase	87.68
COG0525		877	ValS Valyl-tRNA synthetase [Translation, ribosomal	87.56
PLN02843		974	isoleucyl-tRNA synthetase	87.33
COG1453		391	Predicted oxidoreductases of the aldo/keto reducta	87.25
PF00133		601	tRNA-synt_1: tRNA synthetases class I (I, L, M and	87.14
TIGR01973		603	NuoG NADH-quinone oxidoreductase, chain G. This mo	87.0
PF00579		292	tRNA-synt_1b: tRNA synthetases class I (W and Y);	86.85
TIGR00384		220	dhsB succinate dehydrogenase and fumarate reductas	86.74
PRK13804		961	ileS isoleucyl-tRNA synthetase; Provisional	86.57
TIGR01945		435	rnfC electron transport complex, RnfABCDGE type, C	86.43
COG4871		193	Uncharacterized protein conserved in archaea [Func	85.98
cd02156		105	nt_trans nucleotidyl transferase superfamily. nt_t	85.84
PF06902		64	Fer4_19: Divergent 4Fe-4S mono-cluster; InterPro:	85.47
KOG0433\|consensus		937		85.37
PTZ00427		1205	isoleucine-tRNA ligase, putative; Provisional	85.34
TIGR00396		842	leuS_bact leucyl-tRNA synthetase, eubacterial and	85.05
PRK12576		279	succinate dehydrogenase iron-sulfur subunit; Provi	84.66
PRK00941		781	acetyl-CoA decarbonylase/synthase complex subunit	84.61
cd01916		731	ACS_1 Acetyl-CoA synthase (ACS), also known as ace	84.44
TIGR02064		402	dsrA sulfite reductase, dissimilatory-type alpha s	84.35
PRK12575		235	succinate dehydrogenase iron-sulfur subunit; Provi	84.27
TIGR00273		432	iron-sulfur cluster-binding protein. Members of th	84.23
PRK07569		234	bidirectional hydrogenase complex protein HoxU; Va	84.13
TIGR03290		144	CoB_CoM_SS_C CoB--CoM heterodisulfide reductase, s	83.71
TIGR02486		314	RDH reductive dehalogenase. This model represents	83.42
PTZ00348		682	tyrosyl-tRNA synthetase; Provisional	83.41
PTZ00126		383	tyrosyl-tRNA synthetase; Provisional	83.38
COG1152		772	CdhA CO dehydrogenase/acetyl-CoA synthase alpha su	83.12
PRK09129		776	NADH dehydrogenase subunit G; Validated	82.45
PF13183		57	Fer4_8: 4Fe-4S dicluster domain; PDB: 2BS4_B 1E7P_	82.23
PLN02563		963	aminoacyl-tRNA ligase	82.2
PRK07570		250	succinate dehydrogenase/fumarate reductase iron-su	82.02
PF13459		65	Fer4_15: 4Fe-4S single cluster domain	81.72
COG2440		99	FixX Ferredoxin-like protein [Energy production an	81.59
PRK05950		232	sdhB succinate dehydrogenase iron-sulfur subunit;	81.4
TIGR00276		282	iron-sulfur cluster binding protein, putative. Thi	81.03
PRK07860		797	NADH dehydrogenase subunit G; Validated	81.0
PRK09130		687	NADH dehydrogenase subunit G; Validated	80.93
PRK12577		329	succinate dehydrogenase iron-sulfur subunit; Provi	80.93
COG1150		195	HdrC Heterodisulfide reductase, subunit C [Energy	80.87
PRK12385		244	fumarate reductase iron-sulfur subunit; Provisiona	80.41

>PRK05347 glutaminyl-tRNA synthetase; Provisional	Back alignment and domain information

Probab=100.00  E-value=1.3e-132  Score=1098.59  Aligned_cols=502  Identities=56%  Similarity=0.994  Sum_probs=482.6

Q ss_pred             CcE-EEECCCCCCcCchhHHHHHHHHHHHHHhcCCEEEEEeeCCCcccccHHHHHHHHHHHHHcCCCCCCCCCccccccc
Q psy9410          18 QVI-TRFAPEPNGYLHIGHAKSIFINFELAYKYNGLCNLRFDDTNPLKENKEYVNSIIKTIKWLNFNWDKVKKRIYYASD   96 (736)
Q Consensus        18 ~~v-~RfaP~PtG~lHiGhar~al~n~~~Ar~~~G~~ilR~eDtd~~r~~~~~~~~i~~dl~wLGi~~d~gp~~~~~~Se   96 (736)
                      |+| |||||||||||||||||+|++||++|+++||+|+||||||||+|+.++|+++|++||+|||++||+   +++|||+
T Consensus        28 ~~v~tRFaPsPtG~LHiG~ar~al~n~~~Ar~~~G~~iLRieDTd~~r~~~e~~~~I~~dL~wLGi~~d~---~~~~qS~  104 (554)
T PRK05347         28 TRVHTRFPPEPNGYLHIGHAKSICLNFGLAQDYGGKCNLRFDDTNPEKEDQEYVDSIKEDVRWLGFDWSG---ELRYASD  104 (554)
T ss_pred             CceEEEeCCCCCCcccHHHHHHHHHHHHHHHHhCCEEEEEECCCCCCcCChHHHHHHHHHHHHcCCCCCC---Cceeeec
Confidence            468 999999999999999999999999999999999999999999999999999999999999999987   6999999


Q ss_pred             cHHHHHHHHHHHHHcCCCcccCCCHHHHHHhhcCCCCCCCCCCCCCCChhhhHHHHHHhhCCcccCCceEEEEEeeccCC
Q psy9410          97 YFDILYKIAEYLIISGDAYVDSQNTEEIYINRGNLHEPGRNSPFYNRLPSESLNLFRRMRSGEFKDGAHVLRVKINMKSK  176 (736)
Q Consensus        97 ~~~~~~~~a~~Li~~g~aY~c~~~~e~l~~~r~~~~~~g~~~~~r~~~~~~~~~~~~~m~~g~~~~~~~~~R~k~~~~~~  176 (736)
                      |+++|+++|++||++|+||+|+||+|+|++.|+.+...|.+|+||++++++++++|++|++|.+++|+++||+|+||.++
T Consensus       105 r~~~~y~~a~~Li~~G~AY~c~cs~eei~~~R~~~~~~g~~~~~R~~s~eenl~~~~~m~~G~~~~g~~vlR~Kid~~~~  184 (554)
T PRK05347        105 YFDQLYEYAVELIKKGKAYVDDLSAEEIREYRGTLTEPGKNSPYRDRSVEENLDLFERMRAGEFPEGSAVLRAKIDMASP  184 (554)
T ss_pred             CHHHHHHHHHHHHHcCCEeeCCCCHHHHHHHhhhhhhcCCCCCccCCCHHHHHHHHHHHHCCCCCCCcEEEEEEeeccCC
Confidence            99999999999999999999999999999999988888999999999999999999999999999999999999999999


Q ss_pred             CCCCCCcEEEEeccCCccccCCccccccccccccchhhhccccceeeccccccCchhHHHHHHhhcccCCcCCCCCCceE
Q psy9410         177 NINMRDPIIYRIRHVNHYRTNNNWCIYPMYDYAHPISDAIENITHSICTLEFQDHRPFYEWILNKIDKTNFIKRPFPKQY  256 (736)
Q Consensus       177 ~~~~~D~Vl~R~~~~~h~~~~~~w~i~PtY~fa~~vdD~~~githvirg~e~~~~~~~~~~l~~~l~~~~~~~~~~p~~~  256 (736)
                      |..|+|||++|++.++||++|++|+|||||||||+||||+|||||||||.||.+++++|.|++++||+     ...|.|+
T Consensus       185 n~~~rD~Vi~R~~~~~H~r~G~k~~iyPtYdfA~~vdD~l~gITHvlRg~E~~~~t~~~~~i~~alg~-----~~~P~~~  259 (554)
T PRK05347        185 NINMRDPVLYRIRHAHHHRTGDKWCIYPMYDFAHCISDAIEGITHSLCTLEFEDHRPLYDWVLDNLPI-----PPHPRQY  259 (554)
T ss_pred             CCCCCCCEEEEecCCCCCccCCceeeecCcCccceeeccccCCceEEeccccccChHHHHHHHHHcCC-----CCCCceE
Confidence            99999999999999999999999999999999999999999999999999999999999999999985     1479999


Q ss_pred             EEEeeecCCeecchhhhhhhhhccccCCCCCCCcccHHHHHHcCCCHHHHHHHHHHcCcccCCccccHHHHHHHHhcccC
Q psy9410         257 EFSRLNLTHTITSKRKLLKLLEKKIVDGWDDPRMPTLIGMRRRGYTPESIKLFCKRIGVSKSDSWINIEILEQALRDDLD  336 (736)
Q Consensus       257 ~f~~l~~~g~klSKr~~~~~v~~~~~~gwddpr~~tl~~l~~~G~~peai~~~~~~~g~s~~~~~~~~~~l~~~~~~~l~  336 (736)
                      +|+||+++|+|||||++.+||++|.|.|||||||+||++||+|||+|+||+||++++|||+.+..++|+.|+++||++|+
T Consensus       260 ~F~rln~~~~~LSKRkl~~lV~~g~v~GWDDPRl~Ti~~lrrrG~~PeAi~nf~~~lG~s~~~~~i~~~~L~~~nRk~ld  339 (554)
T PRK05347        260 EFSRLNLTYTVMSKRKLKQLVEEKHVDGWDDPRMPTISGLRRRGYTPESIREFCERIGVTKQDSVIDMSMLESCIREDLN  339 (554)
T ss_pred             EEEEECCCCCccccccchhccccCcccCccCCcchhHHHHHHCCCCHHHHHHHHHHhCCCCCCCeecHHHHHHHHHHHhc
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCceeEEEeceEEEEecCCCCceEEEEcCCCcCCCCcc-CCCceEeeecceeeeecccccccCcccccccCCCCCCCC
Q psy9410         337 IKAPRIMAVLNPIKLIISNFLDNQEIECTAPLFSRQHTQY-KEKLRYFPISKILWIERDDFMEIPTKKYFRLYPPIGKNS  415 (736)
Q Consensus       337 ~~~~r~~~v~~~~kl~~~n~~~~~~~~~~~p~~~~~hp~~-~~g~r~~~~~~~i~ie~~D~~~~~~~~~~~l~~~~~~~~  415 (736)
                      +.|+|+|||.||++|.|.|++++..+.+++|+    ||++ ++|+|++.|+++||||++||++.++++|+||++      
T Consensus       340 ~~a~R~m~V~~pv~v~i~n~~~~~~~~~~~p~----hP~~~~~G~r~i~~~~~iyIe~~D~~~~~~~~~~rl~~------  409 (554)
T PRK05347        340 ENAPRAMAVLDPLKLVITNYPEGQVEELEAPN----HPEDPEMGTREVPFSRELYIEREDFMEEPPKKYFRLVP------  409 (554)
T ss_pred             cCCCceEEEcCCeEEEEEeCCCCceEEEEecC----CCCCCcCceEEEEEcCeEEEEhHHhhccccccccccCC------
Confidence            99999999999999999999887777889999    9999 999999999999999999999999999999999      


Q ss_pred             CcEEEecccEEEEEeeeeecCCCcEEEEEEEEeCCCCCCCCCCCCCCCceeEEeccCCCCeeeEEEeCCCcCCCCCCCcc
Q psy9410         416 GNRVRLRYGYVVECTGFKKNKNNEVVEVYCKYFPDSKSGTKLSSNYKVKGNIHWISKSHALSIEARLYDRLFIDPYPNIV  495 (736)
Q Consensus       416 g~~v~L~~~~~i~~~~~~~d~~g~v~~~~~~~~~~~~~~~~~~~~~k~~~~i~Wvs~~~~~~~ev~~yd~L~~~~~p~~~  495 (736)
                      |++||||++++|+|+++++|++|+|++++|+|++++++++ .+..+|++++|||||+.++++++|++||+||++++|+. 
T Consensus       410 g~~vrL~~~~~i~~~~~~kd~~g~v~~~~~~~~~~~~~g~-~~~~kk~k~~IhWv~~~~~v~~~v~~yd~Lf~~~~p~~-  487 (554)
T PRK05347        410 GKEVRLRNAYVIKCEEVVKDADGNITEIHCTYDPDTLSGN-PADGRKVKGTIHWVSAAHAVPAEVRLYDRLFTVPNPAA-  487 (554)
T ss_pred             CCEEEecCEEEEEEEEEEEcCCCCEEEEEEEEccccccCC-CccCcccCCEEEeeecCCCEeEEEEEeccccCCCCCCc-
Confidence            9999999999999999999999999999999999888764 23345888999999988899999999999999999986 


Q ss_pred             cCCccccccCCCceeeEEEEecccccccCccccccccccccCccc
Q psy9410         496 NNKDFKLLINPNSKKVISAYLEPNLKLIFPKKHAQFEQNLLPQTQ  540 (736)
Q Consensus       496 ~~~d~~~~inp~S~~~~~~~~Ep~l~~~~~~~~~q~er~g~~p~~  540 (736)
                       +++|++++||+|+.+..+++|+++..++.++.+||+|.||+...
T Consensus       488 -~~~~~~~iN~~s~~~~~~~~E~~~~~~~~~~~~QfeR~Gyf~~D  531 (554)
T PRK05347        488 -GKDFLDFLNPDSLVIKQGFVEPSLADAKPEDRFQFEREGYFCAD  531 (554)
T ss_pred             -cccHhHhcCCCceEEEeEEEcHHHhhCCCCCEEEEEEeeEEEec
Confidence             58999999999999999999999999999999999999996443

>PTZ00437 glutaminyl-tRNA synthetase; Provisional	Back alignment and domain information

>TIGR00440 glnS glutaminyl-tRNA synthetase	Back alignment and domain information

>PRK14703 glutaminyl-tRNA synthetase/YqeY domain fusion protein; Provisional	Back alignment and domain information

>PLN02859 glutamine-tRNA ligase	Back alignment and domain information

>PLN03233 putative glutamate-tRNA ligase; Provisional	Back alignment and domain information

>PTZ00402 glutamyl-tRNA synthetase; Provisional	Back alignment and domain information

>PLN02907 glutamate-tRNA ligase	Back alignment and domain information

>KOG1148\|consensus	Back alignment and domain information

>KOG1147\|consensus	Back alignment and domain information

>PRK04156 gltX glutamyl-tRNA synthetase; Provisional	Back alignment and domain information

>TIGR00463 gltX_arch glutamyl-tRNA synthetase, archaeal and eukaryotic family	Back alignment and domain information

>COG0008 GlnS Glutamyl- and glutaminyl-tRNA synthetases [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>KOG1149\|consensus	Back alignment and domain information

>PLN02627 glutamyl-tRNA synthetase	Back alignment and domain information

>cd00807 GlnRS_core catalytic core domain of glutaminyl-tRNA synthetase	Back alignment and domain information

>PRK12410 glutamylglutaminyl-tRNA synthetase; Provisional	Back alignment and domain information

>PRK12558 glutamyl-tRNA synthetase; Provisional	Back alignment and domain information

>cd09287 GluRS_non_core catalytic core domain of non-discriminating glutamyl-tRNA synthetase	Back alignment and domain information

>PRK01406 gltX glutamyl-tRNA synthetase; Reviewed	Back alignment and domain information

>PF00749 tRNA-synt_1c: tRNA synthetases class I (E and Q), catalytic domain; InterPro: IPR020058 The aminoacyl-tRNA synthetases (6	Back alignment and domain information

>PRK14895 gltX glutamyl-tRNA synthetase; Provisional	Back alignment and domain information

>TIGR00464 gltX_bact glutamyl-tRNA synthetase, bacterial family	Back alignment and domain information

>PRK05710 glutamyl-Q tRNA(Asp) synthetase; Reviewed	Back alignment and domain information

>TIGR03838 queuosine_YadB glutamyl-queuosine tRNA(Asp) synthetase	Back alignment and domain information

>cd00418 GlxRS_core catalytic core domain of glutamyl-tRNA and glutaminyl-tRNA synthetase	Back alignment and domain information

>cd00808 GluRS_core catalytic core domain of discriminating glutamyl-tRNA synthetase	Back alignment and domain information

>PF03950 tRNA-synt_1c_C: tRNA synthetases class I (E and Q), anti-codon binding domain; InterPro: IPR020059 The aminoacyl-tRNA synthetases (6	Back alignment and domain information

>COG0215 CysS Cysteinyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PF01406 tRNA-synt_1e: tRNA synthetases class I (C) catalytic domain; InterPro: IPR015803 The aminoacyl-tRNA synthetases (6	Back alignment and domain information

>PLN02946 cysteine-tRNA ligase	Back alignment and domain information

>PRK14536 cysS cysteinyl-tRNA synthetase; Provisional	Back alignment and domain information

>PRK06991 ferredoxin; Provisional	Back alignment and domain information

>TIGR00435 cysS cysteinyl-tRNA synthetase	Back alignment and domain information

>PRK12418 cysteinyl-tRNA synthetase; Provisional	Back alignment and domain information

>PRK14535 cysS cysteinyl-tRNA synthetase; Provisional	Back alignment and domain information

>PRK14534 cysS cysteinyl-tRNA synthetase; Provisional	Back alignment and domain information

>PRK00260 cysS cysteinyl-tRNA synthetase; Validated	Back alignment and domain information

>TIGR03447 mycothiol_MshC cysteine--1-D-myo-inosityl 2-amino-2-deoxy-alpha-D-glucopyranoside ligase	Back alignment and domain information

>KOG2007\|consensus	Back alignment and domain information

>PTZ00399 cysteinyl-tRNA-synthetase; Provisional	Back alignment and domain information

>cd00671 ArgRS_core catalytic core domain of arginyl-tRNA synthetases	Back alignment and domain information

>COG2878 Predicted NADH:ubiquinone oxidoreductase, subunit RnfB [Energy production and conversion]	Back alignment and domain information

>PRK08764 ferredoxin; Provisional	Back alignment and domain information

>PRK01611 argS arginyl-tRNA synthetase; Reviewed	Back alignment and domain information

>PRK05113 electron transport complex protein RnfB; Provisional	Back alignment and domain information

>TIGR01944 rnfB electron transport complex, RnfABCDGE type, B subunit	Back alignment and domain information

>PRK11893 methionyl-tRNA synthetase; Reviewed	Back alignment and domain information

>cd00814 MetRS_core catalytic core domain of methioninyl-tRNA synthetases	Back alignment and domain information

>PRK12451 arginyl-tRNA synthetase; Reviewed	Back alignment and domain information

>PRK07118 ferredoxin; Validated	Back alignment and domain information

>COG0143 MetG Methionyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>TIGR00456 argS arginyl-tRNA synthetase	Back alignment and domain information

>PF13247 Fer4_11: 4Fe-4S dicluster domain; PDB: 2VPY_F 2VPX_B 2VPZ_B 2VPW_F 3IR7_B 1Y5N_B 1R27_D 3EGW_B 1Y5I_B 1Q16_B	Back alignment and domain information

>cd00668 Ile_Leu_Val_MetRS_core catalytic core domain of isoleucyl, leucyl, valyl and methioninyl tRNA synthetases	Back alignment and domain information

>PLN02224 methionine-tRNA ligase	Back alignment and domain information

>COG0437 HybA Fe-S-cluster-containing hydrogenase components 1 [Energy production and conversion]	Back alignment and domain information

>cd00672 CysRS_core catalytic core domain of cysteinyl tRNA synthetase	Back alignment and domain information

>TIGR00398 metG methionyl-tRNA synthetase	Back alignment and domain information

>PRK12267 methionyl-tRNA synthetase; Reviewed	Back alignment and domain information

>PRK00133 metG methionyl-tRNA synthetase; Reviewed	Back alignment and domain information

>COG0018 ArgS Arginyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PLN02610 probable methionyl-tRNA synthetase	Back alignment and domain information

>PRK12268 methionyl-tRNA synthetase; Reviewed	Back alignment and domain information

>cd00802 class_I_aaRS_core catalytic core domain of class I amino acyl-tRNA synthetase	Back alignment and domain information

>PLN02286 arginine-tRNA ligase	Back alignment and domain information

>cd00818 IleRS_core catalytic core domain of isoleucyl-tRNA synthetases	Back alignment and domain information

>TIGR03478 DMSO_red_II_bet DMSO reductase family type II enzyme, iron-sulfur subunit	Back alignment and domain information

>PF09334 tRNA-synt_1g: tRNA synthetases class I (M); InterPro: IPR015413 The aminoacyl-tRNA synthetases (6	Back alignment and domain information

>cd00812 LeuRS_core catalytic core domain of leucyl-tRNA synthetases	Back alignment and domain information

>TIGR01660 narH nitrate reductase, beta subunit	Back alignment and domain information

>PF00750 tRNA-synt_1d: tRNA synthetases class I (R); InterPro: IPR015945 The aminoacyl-tRNA synthetases (6	Back alignment and domain information

>PF14697 Fer4_21: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_C 2O01_C 2WSC_C 3LW5_C 1H7X_C 1H7W_A 1GT8_A 1GTE_B 1GTH_B	Back alignment and domain information

>COG1142 HycB Fe-S-cluster-containing hydrogenase components 2 [Energy production and conversion]	Back alignment and domain information

>COG1143 NuoI Formate hydrogenlyase subunit 6/NADH:ubiquinone oxidoreductase 23 kD subunit (chain I) [Energy production and conversion]	Back alignment and domain information

>PRK08493 NADH dehydrogenase subunit G; Validated	Back alignment and domain information

>cd00817 ValRS_core catalytic core domain of valyl-tRNA synthetases	Back alignment and domain information

>PRK14993 tetrathionate reductase subunit B; Provisional	Back alignment and domain information

>TIGR03149 cyt_nit_nrfC cytochrome c nitrite reductase, Fe-S protein	Back alignment and domain information

>PRK09898 hypothetical protein; Provisional	Back alignment and domain information

>PRK07569 bidirectional hydrogenase complex protein HoxU; Validated	Back alignment and domain information

>COG3383 Uncharacterized anaerobic dehydrogenase [General function prediction only]	Back alignment and domain information

>cd00674 LysRS_core_class_I catalytic core domain of class I lysyl tRNA synthetase	Back alignment and domain information

>TIGR01582 FDH-beta formate dehydrogenase, beta subunit, Fe-S containing	Back alignment and domain information

>PRK10882 hydrogenase 2 protein HybA; Provisional	Back alignment and domain information

>PRK00750 lysK lysyl-tRNA synthetase; Reviewed	Back alignment and domain information

>PTZ00305 NADH:ubiquinone oxidoreductase; Provisional	Back alignment and domain information

>TIGR01973 NuoG NADH-quinone oxidoreductase, chain G	Back alignment and domain information

>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion]	Back alignment and domain information

>PF13187 Fer4_9: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_C 2O01_C 2WSC_C 3LW5_C 2VKR_C 1KQG_B 1KQF_B 3GYX_J	Back alignment and domain information

>PRK09130 NADH dehydrogenase subunit G; Validated	Back alignment and domain information

>PRK08166 NADH dehydrogenase subunit G; Validated	Back alignment and domain information

>PRK05035 electron transport complex protein RnfC; Provisional	Back alignment and domain information

>PRK07860 NADH dehydrogenase subunit G; Validated	Back alignment and domain information

>PRK09129 NADH dehydrogenase subunit G; Validated	Back alignment and domain information

>KOG0436\|consensus	Back alignment and domain information

>TIGR02951 DMSO_dmsB DMSO reductase, iron-sulfur subunit	Back alignment and domain information

>COG1144 Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, delta subunit [Energy production and conversion]	Back alignment and domain information

>PRK10330 formate dehydrogenase-H ferredoxin subunit; Provisional	Back alignment and domain information

>PRK08348 NADH-plastoquinone oxidoreductase subunit; Provisional	Back alignment and domain information

>COG1034 NuoG NADH dehydrogenase/NADH:ubiquinone oxidoreductase 75 kD subunit (chain G) [Energy production and conversion]	Back alignment and domain information

>TIGR02936 fdxN_nitrog ferredoxin III, nif-specific	Back alignment and domain information

>PRK09624 porD pyuvate ferredoxin oxidoreductase subunit delta; Reviewed	Back alignment and domain information

>PRK08222 hydrogenase 4 subunit H; Validated	Back alignment and domain information

>TIGR02179 PorD_KorD 2-oxoacid:acceptor oxidoreductase, delta subunit, pyruvate/2-ketoisovalerate family	Back alignment and domain information

>PRK09625 porD pyruvate flavodoxin oxidoreductase subunit delta; Reviewed	Back alignment and domain information

>KOG3256\|consensus	Back alignment and domain information

>PRK09623 vorD 2-ketoisovalerate ferredoxin oxidoreductase subunit delta; Reviewed	Back alignment and domain information

>PRK09626 oorD 2-oxoglutarate-acceptor oxidoreductase subunit OorD; Reviewed	Back alignment and domain information

>TIGR00403 ndhI NADH-plastoquinone oxidoreductase subunit I protein	Back alignment and domain information

>TIGR00397 mauM_napG MauM/NapG family ferredoxin-type protein	Back alignment and domain information

>PF12838 Fer4_7: 4Fe-4S dicluster domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters	Back alignment and domain information

>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed	Back alignment and domain information

>TIGR02494 PFLE_PFLC glycyl-radical enzyme activating protein family	Back alignment and domain information

>COG1146 Ferredoxin [Energy production and conversion]	Back alignment and domain information

>PRK12387 formate hydrogenlyase complex iron-sulfur subunit; Provisional	Back alignment and domain information

>CHL00065 psaC photosystem I subunit VII	Back alignment and domain information

>PRK05888 NADH dehydrogenase subunit I; Provisional	Back alignment and domain information

>PRK06273 ferredoxin; Provisional	Back alignment and domain information

>PLN00071 photosystem I subunit VII; Provisional	Back alignment and domain information

>PF13237 Fer4_10: 4Fe-4S dicluster domain; PDB: 2FGO_A	Back alignment and domain information

>COG1149 MinD superfamily P-loop ATPase containing an inserted ferredoxin domain [Energy production and conversion]	Back alignment and domain information

>PRK13208 valS valyl-tRNA synthetase; Reviewed	Back alignment and domain information

>TIGR02060 aprB adenosine phosphosulphate reductase, beta subunit	Back alignment and domain information

>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed	Back alignment and domain information

>COG1145 NapF Ferredoxin [Energy production and conversion]	Back alignment and domain information

>CHL00014 ndhI NADH dehydrogenase subunit I	Back alignment and domain information

>PRK09476 napG quinol dehydrogenase periplasmic component; Provisional	Back alignment and domain information

>TIGR00467 lysS_arch lysyl-tRNA synthetase, archaeal and spirochete	Back alignment and domain information

>PRK10194 ferredoxin-type protein; Provisional	Back alignment and domain information

>PRK09477 napH quinol dehydrogenase membrane component; Provisional	Back alignment and domain information

>TIGR00422 valS valyl-tRNA synthetase	Back alignment and domain information

>TIGR01971 NuoI NADH-quinone oxidoreductase, chain I	Back alignment and domain information

>TIGR03048 PS_I_psaC photosystem I iron-sulfur protein PsaC	Back alignment and domain information

>TIGR02163 napH_ ferredoxin-type protein, NapH/MauN family	Back alignment and domain information

>PRK10194 ferredoxin-type protein; Provisional	Back alignment and domain information

>PRK02651 photosystem I subunit VII; Provisional	Back alignment and domain information

>PRK05729 valS valyl-tRNA synthetase; Reviewed	Back alignment and domain information

>PF13247 Fer4_11: 4Fe-4S dicluster domain; PDB: 2VPY_F 2VPX_B 2VPZ_B 2VPW_F 3IR7_B 1Y5N_B 1R27_D 3EGW_B 1Y5I_B 1Q16_B	Back alignment and domain information

>TIGR00402 napF ferredoxin-type protein NapF	Back alignment and domain information

>PRK07118 ferredoxin; Validated	Back alignment and domain information

>PRK08318 dihydropyrimidine dehydrogenase subunit B; Validated	Back alignment and domain information

>TIGR02700 flavo_MJ0208 archaeoflavoprotein, MJ0208 family	Back alignment and domain information

>COG1140 NarY Nitrate reductase beta subunit [Energy production and conversion]	Back alignment and domain information

>TIGR01660 narH nitrate reductase, beta subunit	Back alignment and domain information

>COG4656 RnfC Predicted NADH:ubiquinone oxidoreductase, subunit RnfC [Energy production and conversion]	Back alignment and domain information

>PRK00783 DNA-directed RNA polymerase subunit D; Provisional	Back alignment and domain information

>PRK14028 pyruvate ferredoxin oxidoreductase subunit gamma/delta; Provisional	Back alignment and domain information

>COG1142 HycB Fe-S-cluster-containing hydrogenase components 2 [Energy production and conversion]	Back alignment and domain information

>cd07030 RNAP_D D subunit of Archaeal RNA polymerase	Back alignment and domain information

>TIGR03478 DMSO_red_II_bet DMSO reductase family type II enzyme, iron-sulfur subunit	Back alignment and domain information

>TIGR02512 Fe_only_hydrog hydrogenases, Fe-only	Back alignment and domain information

>COG2768 Uncharacterized Fe-S center protein [General function prediction only]	Back alignment and domain information

>TIGR03224 benzo_boxA benzoyl-CoA oxygenase/reductase, BoxA protein	Back alignment and domain information

>TIGR02912 sulfite_red_C sulfite reductase, subunit C	Back alignment and domain information

>TIGR03294 FrhG coenzyme F420 hydrogenase, subunit gamma	Back alignment and domain information

>TIGR00397 mauM_napG MauM/NapG family ferredoxin-type protein	Back alignment and domain information

>PF12837 Fer4_6: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters	Back alignment and domain information

>TIGR03287 methan_mark_16 putative methanogenesis marker 16 metalloprotein	Back alignment and domain information

>TIGR02176 pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxidoreductase, homodimeric	Back alignment and domain information

>TIGR03149 cyt_nit_nrfC cytochrome c nitrite reductase, Fe-S protein	Back alignment and domain information

>COG2221 DsrA Dissimilatory sulfite reductase (desulfoviridin), alpha and beta subunits [Energy production and conversion]	Back alignment and domain information

>TIGR01582 FDH-beta formate dehydrogenase, beta subunit, Fe-S containing	Back alignment and domain information

>PRK14993 tetrathionate reductase subunit B; Provisional	Back alignment and domain information

>PRK13984 putative oxidoreductase; Provisional	Back alignment and domain information

>PRK09476 napG quinol dehydrogenase periplasmic component; Provisional	Back alignment and domain information

>COG0437 HybA Fe-S-cluster-containing hydrogenase components 1 [Energy production and conversion]	Back alignment and domain information

>PRK15449 ferredoxin-like protein FixX; Provisional	Back alignment and domain information

>PF01921 tRNA-synt_1f: tRNA synthetases class I (K); InterPro: IPR002904 The aminoacyl-tRNA synthetases (6	Back alignment and domain information

>cd00806 TrpRS_core catalytic core domain of tryptophanyl-tRNA synthetase	Back alignment and domain information

>PRK09898 hypothetical protein; Provisional	Back alignment and domain information

>PRK10330 formate dehydrogenase-H ferredoxin subunit; Provisional	Back alignment and domain information

>TIGR00396 leuS_bact leucyl-tRNA synthetase, eubacterial and mitochondrial family	Back alignment and domain information

>PRK13795 hypothetical protein; Provisional	Back alignment and domain information

>TIGR02745 ccoG_rdxA_fixG cytochrome c oxidase accessory protein FixG	Back alignment and domain information

>PRK00390 leuS leucyl-tRNA synthetase; Validated	Back alignment and domain information

>TIGR02951 DMSO_dmsB DMSO reductase, iron-sulfur subunit	Back alignment and domain information

>PRK09326 F420H2 dehydrogenase subunit F; Provisional	Back alignment and domain information

>PRK10882 hydrogenase 2 protein HybA; Provisional	Back alignment and domain information

>PF13484 Fer4_16: 4Fe-4S double cluster binding domain	Back alignment and domain information

>PF00037 Fer4: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters	Back alignment and domain information

>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit	Back alignment and domain information

>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional	Back alignment and domain information

>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed	Back alignment and domain information

>PLN02563 aminoacyl-tRNA ligase	Back alignment and domain information

>PF12837 Fer4_6: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters	Back alignment and domain information

>COG4231 Indolepyruvate ferredoxin oxidoreductase, alpha and beta subunits [Energy production and conversion]	Back alignment and domain information

>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only]	Back alignment and domain information

>TIGR02066 dsrB sulfite reductase, dissimilatory-type beta subunit	Back alignment and domain information

>PF00037 Fer4: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters	Back alignment and domain information

>PRK09853 putative selenate reductase subunit YgfK; Provisional	Back alignment and domain information

>COG1384 LysS Lysyl-tRNA synthetase (class I) [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>TIGR00392 ileS isoleucyl-tRNA synthetase	Back alignment and domain information

>TIGR03336 IOR_alpha indolepyruvate ferredoxin oxidoreductase, alpha subunit	Back alignment and domain information

>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion]	Back alignment and domain information

>COG0495 LeuS Leucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PTZ00419 valyl-tRNA synthetase-like protein; Provisional	Back alignment and domain information

>PRK05743 ileS isoleucyl-tRNA synthetase; Reviewed	Back alignment and domain information

>COG1143 NuoI Formate hydrogenlyase subunit 6/NADH:ubiquinone oxidoreductase 23 kD subunit (chain I) [Energy production and conversion]	Back alignment and domain information

>PRK14900 valS valyl-tRNA synthetase; Provisional	Back alignment and domain information

>PLN02943 aminoacyl-tRNA ligase	Back alignment and domain information

>PF13183 Fer4_8: 4Fe-4S dicluster domain; PDB: 2BS4_B 1E7P_B 2BS3_B 1QLB_B 2BS2_B 3P4Q_N 1KFY_N 3CIR_N 3P4R_B 2B76_N	Back alignment and domain information

>PF04060 FeS: Putative Fe-S cluster; InterPro: IPR007202 These proteins contain a domain with four conserved cysteines that probably form an Fe-S redox cluster	Back alignment and domain information

>PRK13409 putative ATPase RIL; Provisional	Back alignment and domain information

>PF14697 Fer4_21: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_C 2O01_C 2WSC_C 3LW5_C 1H7X_C 1H7W_A 1GT8_A 1GTE_B 1GTH_B	Back alignment and domain information

>PF12797 Fer4_2: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters	Back alignment and domain information

>PRK06039 ileS isoleucyl-tRNA synthetase; Reviewed	Back alignment and domain information

>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed	Back alignment and domain information

>PTZ00427 isoleucine-tRNA ligase, putative; Provisional	Back alignment and domain information

>TIGR01945 rnfC electron transport complex, RnfABCDGE type, C subunit	Back alignment and domain information

>PLN02381 valyl-tRNA synthetase	Back alignment and domain information

>PF00133 tRNA-synt_1: tRNA synthetases class I (I, L, M and V); InterPro: IPR002300 The aminoacyl-tRNA synthetases (6	Back alignment and domain information

>PLN02843 isoleucyl-tRNA synthetase	Back alignment and domain information

>PLN02882 aminoacyl-tRNA ligase	Back alignment and domain information

>KOG0435\|consensus	Back alignment and domain information

>TIGR00395 leuS_arch leucyl-tRNA synthetase, archaeal and cytosolic family	Back alignment and domain information

>PRK13984 putative oxidoreductase; Provisional	Back alignment and domain information

>COG0525 ValS Valyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>COG2440 FixX Ferredoxin-like protein [Energy production and conversion]	Back alignment and domain information

>PRK13804 ileS isoleucyl-tRNA synthetase; Provisional	Back alignment and domain information

>PF12798 Fer4_3: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters	Back alignment and domain information

>PRK00941 acetyl-CoA decarbonylase/synthase complex subunit alpha; Validated	Back alignment and domain information

>PRK08222 hydrogenase 4 subunit H; Validated	Back alignment and domain information

>PRK12387 formate hydrogenlyase complex iron-sulfur subunit; Provisional	Back alignment and domain information

>TIGR00314 cdhA CO dehydrogenase/acetyl-CoA synthase complex, epsilon subunit	Back alignment and domain information

>PF13459 Fer4_15: 4Fe-4S single cluster domain	Back alignment and domain information

>TIGR00233 trpS tryptophanyl-tRNA synthetase	Back alignment and domain information

>PF13534 Fer4_17: 4Fe-4S dicluster domain; PDB: 1ZOY_B 3AE9_B 3AED_B 3AEA_B 3AE1_B 3SFD_B 3ABV_B 3AEF_B 3AEB_B 3AE3_B	Back alignment and domain information

>PRK07570 succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Validated	Back alignment and domain information

>COG1141 Fer Ferredoxin [Energy production and conversion]	Back alignment and domain information

>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional	Back alignment and domain information

>cd01916 ACS_1 Acetyl-CoA synthase (ACS), also known as acetyl-CoA decarbonylase, is found in acetogenic and methanogenic organisms and is responsible for the synthesis and breakdown of acetyl-CoA	Back alignment and domain information

>TIGR00276 iron-sulfur cluster binding protein, putative	Back alignment and domain information

>TIGR03290 CoB_CoM_SS_C CoB--CoM heterodisulfide reductase, subunit C	Back alignment and domain information

>PRK12285 tryptophanyl-tRNA synthetase; Reviewed	Back alignment and domain information

>TIGR00384 dhsB succinate dehydrogenase and fumarate reductase iron-sulfur protein	Back alignment and domain information

>PF13370 Fer4_13: 4Fe-4S single cluster domain; PDB: 1FXR_A 1DAX_A 1DFD_A 1WTF_A 1IR0_A 1IQZ_A 1SIZ_A 1SJ1_A 3PNI_B 2Z8Q_A	Back alignment and domain information

>TIGR01936 nqrA NADH:ubiquinone oxidoreductase, Na(+)-translocating, A subunit	Back alignment and domain information

>PF13187 Fer4_9: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_C 2O01_C 2WSC_C 3LW5_C 2VKR_C 1KQG_B 1KQF_B 3GYX_J	Back alignment and domain information

>TIGR02064 dsrA sulfite reductase, dissimilatory-type alpha subunit	Back alignment and domain information

>PF12798 Fer4_3: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters	Back alignment and domain information

>TIGR02060 aprB adenosine phosphosulphate reductase, beta subunit	Back alignment and domain information

>PRK08348 NADH-plastoquinone oxidoreductase subunit; Provisional	Back alignment and domain information

>PRK05352 Na(+)-translocating NADH-quinone reductase subunit A; Provisional	Back alignment and domain information

>PF12838 Fer4_7: 4Fe-4S dicluster domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters	Back alignment and domain information

>TIGR00273 iron-sulfur cluster-binding protein	Back alignment and domain information

>KOG0432\|consensus	Back alignment and domain information

>PRK09625 porD pyruvate flavodoxin oxidoreductase subunit delta; Reviewed	Back alignment and domain information

>TIGR00403 ndhI NADH-plastoquinone oxidoreductase subunit I protein	Back alignment and domain information

>PRK12576 succinate dehydrogenase iron-sulfur subunit; Provisional	Back alignment and domain information

>COG1139 Uncharacterized conserved protein containing a ferredoxin-like domain [Energy production and conversion]	Back alignment and domain information

>TIGR02486 RDH reductive dehalogenase	Back alignment and domain information

>PRK09624 porD pyuvate ferredoxin oxidoreductase subunit delta; Reviewed	Back alignment and domain information

>PLN02959 aminoacyl-tRNA ligase	Back alignment and domain information

>PRK15449 ferredoxin-like protein FixX; Provisional	Back alignment and domain information

>PRK06273 ferredoxin; Provisional	Back alignment and domain information

>PRK13030 2-oxoacid ferredoxin oxidoreductase; Provisional	Back alignment and domain information

>COG1144 Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, delta subunit [Energy production and conversion]	Back alignment and domain information

>PRK09623 vorD 2-ketoisovalerate ferredoxin oxidoreductase subunit delta; Reviewed	Back alignment and domain information

>TIGR00395 leuS_arch leucyl-tRNA synthetase, archaeal and cytosolic family	Back alignment and domain information

>PRK12385 fumarate reductase iron-sulfur subunit; Provisional	Back alignment and domain information

>PF12797 Fer4_2: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters	Back alignment and domain information

>KOG2282\|consensus	Back alignment and domain information

>PF12800 Fer4_4: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters	Back alignment and domain information

>PRK06991 ferredoxin; Provisional	Back alignment and domain information

>TIGR03287 methan_mark_16 putative methanogenesis marker 16 metalloprotein	Back alignment and domain information

>PF13237 Fer4_10: 4Fe-4S dicluster domain; PDB: 2FGO_A	Back alignment and domain information

>PRK04165 acetyl-CoA decarbonylase/synthase complex subunit gamma; Provisional	Back alignment and domain information

>TIGR02066 dsrB sulfite reductase, dissimilatory-type beta subunit	Back alignment and domain information

>PRK09193 indolepyruvate ferredoxin oxidoreductase; Validated	Back alignment and domain information

>PRK13029 2-oxoacid ferredoxin oxidoreductase; Provisional	Back alignment and domain information

>TIGR03224 benzo_boxA benzoyl-CoA oxygenase/reductase, BoxA protein	Back alignment and domain information

>PRK05888 NADH dehydrogenase subunit I; Provisional	Back alignment and domain information

>TIGR01944 rnfB electron transport complex, RnfABCDGE type, B subunit	Back alignment and domain information

>PRK08640 sdhB succinate dehydrogenase iron-sulfur subunit; Reviewed	Back alignment and domain information

>PRK09626 oorD 2-oxoglutarate-acceptor oxidoreductase subunit OorD; Reviewed	Back alignment and domain information

>PRK11168 glpC sn-glycerol-3-phosphate dehydrogenase subunit C; Provisional	Back alignment and domain information

>PRK05113 electron transport complex protein RnfB; Provisional	Back alignment and domain information

>TIGR02179 PorD_KorD 2-oxoacid:acceptor oxidoreductase, delta subunit, pyruvate/2-ketoisovalerate family	Back alignment and domain information

>TIGR03379 glycerol3P_GlpC glycerol-3-phosphate dehydrogenase, anaerobic, C subunit	Back alignment and domain information

>PRK06214 sulfite reductase; Provisional	Back alignment and domain information

>CHL00014 ndhI NADH dehydrogenase subunit I	Back alignment and domain information

>KOG3256\|consensus	Back alignment and domain information

>COG1145 NapF Ferredoxin [Energy production and conversion]	Back alignment and domain information

>COG1600 Uncharacterized Fe-S protein [Energy production and conversion]	Back alignment and domain information

>PRK15055 anaerobic sulfite reductase subunit A; Provisional	Back alignment and domain information

>PRK05950 sdhB succinate dehydrogenase iron-sulfur subunit; Reviewed	Back alignment and domain information

>COG1035 FrhB Coenzyme F420-reducing hydrogenase, beta subunit [Energy production and conversion]	Back alignment and domain information

>COG1245 Predicted ATPase, RNase L inhibitor (RLI) homolog [General function prediction only]	Back alignment and domain information

>CHL00065 psaC photosystem I subunit VII	Back alignment and domain information

>PRK08764 ferredoxin; Provisional	Back alignment and domain information

>TIGR02910 sulfite_red_A sulfite reductase, subunit A	Back alignment and domain information

>TIGR01971 NuoI NADH-quinone oxidoreductase, chain I	Back alignment and domain information

>TIGR00402 napF ferredoxin-type protein NapF	Back alignment and domain information

>PRK12386 fumarate reductase iron-sulfur subunit; Provisional	Back alignment and domain information

>KOG0063\|consensus	Back alignment and domain information

>PF12800 Fer4_4: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters	Back alignment and domain information

>COG1152 CdhA CO dehydrogenase/acetyl-CoA synthase alpha subunit [Energy production and conversion]	Back alignment and domain information

>PLN00071 photosystem I subunit VII; Provisional	Back alignment and domain information

>COG2768 Uncharacterized Fe-S center protein [General function prediction only]	Back alignment and domain information

>PRK12577 succinate dehydrogenase iron-sulfur subunit; Provisional	Back alignment and domain information

>PRK12300 leuS leucyl-tRNA synthetase; Reviewed	Back alignment and domain information

>COG3383 Uncharacterized anaerobic dehydrogenase [General function prediction only]	Back alignment and domain information

>KOG0063\|consensus	Back alignment and domain information

>COG0180 TrpS Tryptophanyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>cd00805 TyrRS_core catalytic core domain of tyrosinyl-tRNA synthetase	Back alignment and domain information

>TIGR02163 napH_ ferredoxin-type protein, NapH/MauN family	Back alignment and domain information

>PRK13552 frdB fumarate reductase iron-sulfur subunit; Provisional	Back alignment and domain information

>TIGR02494 PFLE_PFLC glycyl-radical enzyme activating protein family	Back alignment and domain information

>PRK12575 succinate dehydrogenase iron-sulfur subunit; Provisional	Back alignment and domain information

>TIGR03048 PS_I_psaC photosystem I iron-sulfur protein PsaC	Back alignment and domain information

>PRK14028 pyruvate ferredoxin oxidoreductase subunit gamma/delta; Provisional	Back alignment and domain information

>TIGR02745 ccoG_rdxA_fixG cytochrome c oxidase accessory protein FixG	Back alignment and domain information

>COG0060 IleS Isoleucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK02651 photosystem I subunit VII; Provisional	Back alignment and domain information

>TIGR02912 sulfite_red_C sulfite reductase, subunit C	Back alignment and domain information

>COG0348 NapH Polyferredoxin [Energy production and conversion]	Back alignment and domain information

>PRK11274 glcF glycolate oxidase iron-sulfur subunit; Provisional	Back alignment and domain information

>COG1149 MinD superfamily P-loop ATPase containing an inserted ferredoxin domain [Energy production and conversion]	Back alignment and domain information

>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional	Back alignment and domain information

>TIGR02936 fdxN_nitrog ferredoxin III, nif-specific	Back alignment and domain information

>COG0479 FrdB Succinate dehydrogenase/fumarate reductase, Fe-S protein subunit [Energy production and conversion]	Back alignment and domain information

>PRK06259 succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Provisional	Back alignment and domain information

>PRK09477 napH quinol dehydrogenase membrane component; Provisional	Back alignment and domain information

>PRK08318 dihydropyrimidine dehydrogenase subunit B; Validated	Back alignment and domain information

>PRK08560 tyrosyl-tRNA synthetase; Validated	Back alignment and domain information

>PRK13409 putative ATPase RIL; Provisional	Back alignment and domain information

>COG2878 Predicted NADH:ubiquinone oxidoreductase, subunit RnfB [Energy production and conversion]	Back alignment and domain information

>COG1146 Ferredoxin [Energy production and conversion]	Back alignment and domain information

>TIGR02176 pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxidoreductase, homodimeric	Back alignment and domain information

>PF13484 Fer4_16: 4Fe-4S double cluster binding domain	Back alignment and domain information

>PLN00129 succinate dehydrogenase [ubiquinone] iron-sulfur subunit	Back alignment and domain information

>COG1453 Predicted oxidoreductases of the aldo/keto reductase family [General function prediction only]	Back alignment and domain information

>TIGR02484 CitB CitB domain protein	Back alignment and domain information

>TIGR02700 flavo_MJ0208 archaeoflavoprotein, MJ0208 family	Back alignment and domain information

>PRK09853 putative selenate reductase subunit YgfK; Provisional	Back alignment and domain information

>PRK13795 hypothetical protein; Provisional	Back alignment and domain information

>COG2221 DsrA Dissimilatory sulfite reductase (desulfoviridin), alpha and beta subunits [Energy production and conversion]	Back alignment and domain information

>PRK08493 NADH dehydrogenase subunit G; Validated	Back alignment and domain information

>PRK15033 tricarballylate utilization protein B; Provisional	Back alignment and domain information

>COG4231 Indolepyruvate ferredoxin oxidoreductase, alpha and beta subunits [Energy production and conversion]	Back alignment and domain information

>PRK12300 leuS leucyl-tRNA synthetase; Reviewed	Back alignment and domain information

>COG0247 GlpC Fe-S oxidoreductase [Energy production and conversion]	Back alignment and domain information

>COG1140 NarY Nitrate reductase beta subunit [Energy production and conversion]	Back alignment and domain information

>PF10588 NADH-G_4Fe-4S_3: NADH-ubiquinone oxidoreductase-G iron-sulfur binding region; InterPro: IPR019574 NADH:ubiquinone oxidoreductase (complex I) (1	Back alignment and domain information

>TIGR02512 Fe_only_hydrog hydrogenases, Fe-only	Back alignment and domain information

>PRK12556 tryptophanyl-tRNA synthetase; Provisional	Back alignment and domain information

>PF13746 Fer4_18: 4Fe-4S dicluster domain	Back alignment and domain information

>COG1941 FrhG Coenzyme F420-reducing hydrogenase, gamma subunit [Energy production and conversion]	Back alignment and domain information

>PF13746 Fer4_18: 4Fe-4S dicluster domain	Back alignment and domain information

>TIGR00392 ileS isoleucyl-tRNA synthetase	Back alignment and domain information

>PRK05743 ileS isoleucyl-tRNA synthetase; Reviewed	Back alignment and domain information

>cd07030 RNAP_D D subunit of Archaeal RNA polymerase	Back alignment and domain information

>COG1150 HdrC Heterodisulfide reductase, subunit C [Energy production and conversion]	Back alignment and domain information

>PRK06039 ileS isoleucyl-tRNA synthetase; Reviewed	Back alignment and domain information

>PRK13354 tyrosyl-tRNA synthetase; Provisional	Back alignment and domain information

>COG0495 LeuS Leucyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>TIGR03336 IOR_alpha indolepyruvate ferredoxin oxidoreductase, alpha subunit	Back alignment and domain information

>PRK12282 tryptophanyl-tRNA synthetase II; Reviewed	Back alignment and domain information

>PLN02486 aminoacyl-tRNA ligase	Back alignment and domain information

>PRK00783 DNA-directed RNA polymerase subunit D; Provisional	Back alignment and domain information

>PRK14900 valS valyl-tRNA synthetase; Provisional	Back alignment and domain information

>PLN02886 aminoacyl-tRNA ligase	Back alignment and domain information

>TIGR03294 FrhG coenzyme F420 hydrogenase, subunit gamma	Back alignment and domain information

>PLN02959 aminoacyl-tRNA ligase	Back alignment and domain information

>COG0008 GlnS Glutamyl- and glutaminyl-tRNA synthetases [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PRK12283 tryptophanyl-tRNA synthetase; Reviewed	Back alignment and domain information

>cd00395 Tyr_Trp_RS_core catalytic core domain of tyrosinyl-tRNA and tryptophanyl-tRNA synthetase	Back alignment and domain information

>PRK00927 tryptophanyl-tRNA synthetase; Reviewed	Back alignment and domain information

>PLN02943 aminoacyl-tRNA ligase	Back alignment and domain information

>PRK14494 putative molybdopterin-guanine dinucleotide biosynthesis protein MobB/FeS domain-containing protein protein; Provisional	Back alignment and domain information

>PRK12284 tryptophanyl-tRNA synthetase; Reviewed	Back alignment and domain information

>COG1456 CdhE CO dehydrogenase/acetyl-CoA synthase gamma subunit (corrinoid Fe-S protein) [Energy production and conversion]	Back alignment and domain information

>PRK05035 electron transport complex protein RnfC; Provisional	Back alignment and domain information

>cd07032 RNAP_I_II_AC40 AC40 subunit of Eukaryotic RNA polymerase (RNAP) I and RNAP III	Back alignment and domain information

>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit	Back alignment and domain information

>PRK00390 leuS leucyl-tRNA synthetase; Validated	Back alignment and domain information

>PRK09326 F420H2 dehydrogenase subunit F; Provisional	Back alignment and domain information

>TIGR00314 cdhA CO dehydrogenase/acetyl-CoA synthase complex, epsilon subunit	Back alignment and domain information

>PLN02882 aminoacyl-tRNA ligase	Back alignment and domain information

>COG0525 ValS Valyl-tRNA synthetase [Translation, ribosomal structure and biogenesis]	Back alignment and domain information

>PLN02843 isoleucyl-tRNA synthetase	Back alignment and domain information

>COG1453 Predicted oxidoreductases of the aldo/keto reductase family [General function prediction only]	Back alignment and domain information

>PF00133 tRNA-synt_1: tRNA synthetases class I (I, L, M and V); InterPro: IPR002300 The aminoacyl-tRNA synthetases (6	Back alignment and domain information

>TIGR01973 NuoG NADH-quinone oxidoreductase, chain G	Back alignment and domain information

>PF00579 tRNA-synt_1b: tRNA synthetases class I (W and Y); InterPro: IPR002305 The aminoacyl-tRNA synthetases (6	Back alignment and domain information

>TIGR00384 dhsB succinate dehydrogenase and fumarate reductase iron-sulfur protein	Back alignment and domain information

>PRK13804 ileS isoleucyl-tRNA synthetase; Provisional	Back alignment and domain information

>TIGR01945 rnfC electron transport complex, RnfABCDGE type, C subunit	Back alignment and domain information

>COG4871 Uncharacterized protein conserved in archaea [Function unknown]	Back alignment and domain information

>cd02156 nt_trans nucleotidyl transferase superfamily	Back alignment and domain information

>PF06902 Fer4_19: Divergent 4Fe-4S mono-cluster; InterPro: IPR010693 This entry represents bacterial ferredoxins such Ferredoxin-1, -2 and -soy from Streptomyces griseolus and Ferredoxin fas2 from Rhodococcus fascians, plus several bacterial hypothetical proteins that contain three highly conserved cysteine residues	Back alignment and domain information

>KOG0433\|consensus	Back alignment and domain information

>PTZ00427 isoleucine-tRNA ligase, putative; Provisional	Back alignment and domain information

>TIGR00396 leuS_bact leucyl-tRNA synthetase, eubacterial and mitochondrial family	Back alignment and domain information

>PRK12576 succinate dehydrogenase iron-sulfur subunit; Provisional	Back alignment and domain information

>PRK00941 acetyl-CoA decarbonylase/synthase complex subunit alpha; Validated	Back alignment and domain information

>cd01916 ACS_1 Acetyl-CoA synthase (ACS), also known as acetyl-CoA decarbonylase, is found in acetogenic and methanogenic organisms and is responsible for the synthesis and breakdown of acetyl-CoA	Back alignment and domain information

>TIGR02064 dsrA sulfite reductase, dissimilatory-type alpha subunit	Back alignment and domain information

>PRK12575 succinate dehydrogenase iron-sulfur subunit; Provisional	Back alignment and domain information

>TIGR00273 iron-sulfur cluster-binding protein	Back alignment and domain information

>PRK07569 bidirectional hydrogenase complex protein HoxU; Validated	Back alignment and domain information

>TIGR03290 CoB_CoM_SS_C CoB--CoM heterodisulfide reductase, subunit C	Back alignment and domain information

>TIGR02486 RDH reductive dehalogenase	Back alignment and domain information

>PTZ00348 tyrosyl-tRNA synthetase; Provisional	Back alignment and domain information

>PTZ00126 tyrosyl-tRNA synthetase; Provisional	Back alignment and domain information

>COG1152 CdhA CO dehydrogenase/acetyl-CoA synthase alpha subunit [Energy production and conversion]	Back alignment and domain information

>PRK09129 NADH dehydrogenase subunit G; Validated	Back alignment and domain information

>PF13183 Fer4_8: 4Fe-4S dicluster domain; PDB: 2BS4_B 1E7P_B 2BS3_B 1QLB_B 2BS2_B 3P4Q_N 1KFY_N 3CIR_N 3P4R_B 2B76_N	Back alignment and domain information

>PLN02563 aminoacyl-tRNA ligase	Back alignment and domain information

>PRK07570 succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Validated	Back alignment and domain information

>PF13459 Fer4_15: 4Fe-4S single cluster domain	Back alignment and domain information

>COG2440 FixX Ferredoxin-like protein [Energy production and conversion]	Back alignment and domain information

>PRK05950 sdhB succinate dehydrogenase iron-sulfur subunit; Reviewed	Back alignment and domain information

>TIGR00276 iron-sulfur cluster binding protein, putative	Back alignment and domain information

>PRK07860 NADH dehydrogenase subunit G; Validated	Back alignment and domain information

>PRK09130 NADH dehydrogenase subunit G; Validated	Back alignment and domain information

>PRK12577 succinate dehydrogenase iron-sulfur subunit; Provisional	Back alignment and domain information

>COG1150 HdrC Heterodisulfide reductase, subunit C [Energy production and conversion]	Back alignment and domain information

>PRK12385 fumarate reductase iron-sulfur subunit; Provisional	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

ID	Alignment Graph	Length	Definition	E-value
Query		736
1euq_A		548	Crystal Structure Of Glutaminyl-Trna Synthetase Com		1e-133
1gsg_P		553	Structure Of E.Coli Glutaminyl-Trna Synthetase Comp		1e-133
1o0b_A		554	Crystal Structure Of L-Glutamine And Ampcpp Bound T		1e-133
1nyl_A		539	Unliganded Glutaminyl-Trna Synthetase Length = 539		1e-133
1qru_A		553	Glutaminyl-Trna Synthetase Mutant I129t Complexed W		1e-133
1qrs_A		553	Glutaminyl-Trna Synthetase Mutant D235n Complexed W		1e-132
1qrt_A		553	Glutaminyl-Trna Synthetase Mutant D235g Complexed W		1e-132
2rd2_A		556	Glutaminyl-Trna Synthetase Mutant C229r With Bound		1e-132
2hz7_A		851	Crystal Structure Of The Glutaminyl-Trna Synthetase		1e-120
3aii_A		553	Archaeal Non-Discriminating Glutamyl-Trna Synthetas		3e-37
2o5r_A		481	Crystal Structure Of Glutamyl-Trna Synthetase 1 (Ec		9e-16
2cfo_A		492	Non-discriminating Glutamyl-trna Synthetase From Th		6e-11
4g6z_A		490	Crystal Structure Of A Glutamyl-Trna Synthetase Glu		1e-10
3al0_C		592	Crystal Structure Of The Glutamine Transamidosome F		3e-10
3akz_B		487	Crystal Structure Of Thermotoga Maritima Nondiscrim		3e-10
3afh_A		488	Crystal Structure Of Thermotoga Maritima Nondiscrim		4e-10
3pnv_A		505	V369m Mutant Of Glutamyl-Trna Synthetase From Mycob		1e-09
2ja2_A		498	Mycobacterium Tuberculosis Glutamyl-Trna Synthetase		1e-09
3pny_A		505	Structure Of Glutamyl-Trna Synthetase From Mycobact		1e-09
1g59_A		468	Glutamyl-Trna Synthetase Complexed With Trna(Glu).		2e-09
1j09_A		468	Crystal Structure Of Thermus Thermophilus Glutamyl-		5e-09
4gri_A		512	Crystal Structure Of A Glutamyl-Trna Synthetase Glu		3e-07
1hfe_L		421	1.6 A Resolution Structure Of The Fe-Only Hydrogena		3e-05
1e08_A		371	Structural Model Of The [fe]-HydrogenaseCYTOCHROME		4e-05
3bk7_A		607	Structure Of The Complete Abce1RNAASE-L Inhibitor P		3e-04
3j15_B		593	Model Of Ribosome-Bound Archaeal Pelota And Abce1 L		3e-04
1nzj_A		298	Crystal Structure And Activity Studies Of Escherich		4e-04

>pdb|1EUQ|A Chain A, Crystal Structure Of Glutaminyl-Trna Synthetase Complexed With A Trna- Gln Mutant And An Active-Site Inhibitor Length = 548