Psyllid ID: psy9448

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580---
MALHQVTGLNTMMVVSVMFLVCIFYTTIVDVYKYVVNPLIDEVLSGYNCTVFAYGQTGTGKTFTMEGEKSNDPSISWQDDPLSGIVPRAMNHLFDELRLLGDAEFTVRVSFLEIYNEELIDLLSPTDDITKLRLFEDSARKGSVIIQGLEEKAVHNKDEVYKILEKGSQKRQTAATLMNAHSSRSHTIFTITIHIKDNSLDGEELLRTGKLNLVDLAGSENIGRSGAQDKRAREAGNINQSLLTLGRCITALVEKTPHIPYRESKLTRLLQDSLGGRTKTSIIATVSPAQLNMEETLSTLDYAHRAKNITNRPEINQKMSKKALLRVTSINMEETLSTLDYAHRAKNITNRPEINQKMPLNSVERAAKSCSIVDCSSSREITIKERVNDKISKTFGFDRVFSQESKQVDVYKYVVNPLIDEVLSGYNCTVFAYGQTGTGKTFTMEGEKSNDPSISWQDDPLSGIVPRAMNHLFDELRLLGDAEFTVRVSFLEIYNEELIDLLSPTDDITKLRHTSEYTEEIEKLRRDLQAAREKNGVFLAAENYDQMVNELYAEVTSVEKKSSSPSAAEDQPPTKHLILRARL
cEEEEccccccccccEEEEEEccccccHHHHHHHHHHHHHHHHHccccEEEEEcccccccccccccccccccccccccccccccccHHHHHHHHHHHHcccccEEEEEEEEEEEEcccccccccccccccccEEEEcccccccEEEccccEEEEccHHHHHHHHHHHcccccHHHccccccccccEEEEEEEEEEEEcccccccEEEEEccccEEcccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccHHHHHccccccccEEEEEEEcccccccHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccHHHHccccccEEcccccccHHHHHccccccccccccccccccccHHHHHHHHHHHHHHHHHHccccccEEEccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccEEEEEEHHHHHHHHHHcccccccccccEEEcccccEEEcccEEEEHHccccccEEEccHHHHHHHHHHHHHHHHHHHcccccHHHHcccccccEEEEEcc
cEEEEEcccccccccccEEEccHHcccHHHHHHHHcHHHHHHHHccccEEEEEEccccccHHHHHcEcccccccccccccccccccHHHHHHHHHHHHHccccEEEEEEEEEEEEccEEEEccccccccccEEEEEcccccccEEEcccccEEcccHHHHHHHHHHHHHHHHHHHHHccccHHHcEEEEEEEEEEEEcccccccEEEEEEEEEEEccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccHHHcHHHHHHHHccccccEEEEEEEEccEHHHHHHHHHHHHHHHcccccEEEEccEEEccccccHHHHHHHHHHHHHHHcccccccccccEEEEEEEccccHHHHHccccEEEEEccccEEEEccccccccccEEEccEEEcccccHHHHHHHHcHHHHHHHcccccEEEEEEccccccHHHHHcEcccccccccccccccccccHHHHHHHHHHHHHccccEEEEEEEEEEEEccEEEEcccccccccEEEEcccccEEEEcccEEEEccHHHHHHHHHHccHHHHHHHHHHHHHcHccccEEEHHcccccccccEEEEEEc
malhqvtgLNTMMVVSVMFLVCIFYTTIVDVYKYVVNPLIDEvlsgynctvfaygqtgtgktftmegeksndpsiswqddplsgivpRAMNHLFDELRLLGDAEFTVRVSFLEIYNEElidllsptdditklrlfedsarkGSVIIQGleekavhnkDEVYKILEKGSQKRQTAATLMnahssrshtIFTITIHikdnsldgeeLLRTGKlnlvdlagsenigrsgaqdkRAREAGNINQSLLTLGRCITALvektphipyresKLTRLLQDslggrtktsiiatvspaqlnmeetLSTLDYAHRaknitnrpeINQKMSKKALLRVTSINMEETLSTLDYAHRaknitnrpeinqkmplnsVERAAKscsivdcsssreiTIKERVNDkisktfgfdrvfsqeskqvdVYKYVVNPLIDEvlsgynctvfaygqtgtgktftmegeksndpsiswqddplsgivpRAMNHLFDELRLLGDAEFTVRVSFLEIYNEElidllsptdditklrhtseYTEEIEKLRRDLQAAREKNGVFLAAENYDQMVNELYAEVTSvekkssspsaaedqpptkhliLRARL
MALHQVTGLNTMMVVSVMFLVCIFYTTIVDVYKYVVNPLIDEVLSGYNCTVFAYGQTGTGKTFTMEGEKSNDPSISWQDDPLSGIVPRAMNHLFDELRLLGDAEFTVRVSFLEIYNEelidllsptdDITKLRLFEDSARKGSviiqgleekavhnkdEVYKILEKGSQKRQTAATLmnahssrshtIFTITIHIKDNSLDGEELLRTGKLnlvdlagsenigrsgaqdkrareaGNINQSLLTLGRCITALVektphipyreskLTRLLQDSLGGRTKTsiiatvspaqlnmEETLSTLDYAHRAKnitnrpeinqkmSKKALLRVTSINMEETLSTLDYAHRAKNitnrpeinqkmplNSVERAAKScsivdcsssreitikervndkisktfgfdrvfsqeskqvdvYKYVVNPLIDEVLSGYNCTVFAYGQTGTGKTFTMEGEKSNDPSISWQDDPLSGIVPRAMNHLFDELRLLGDAEFTVRVSFLEIYNeelidllsptdditklrhtseyteeiEKLRRDLQAAREKNGVFLAAENYDQMVNELYAEVTSVEKkssspsaaedqpptkhlilrarl
MALHQVTGLNTMMVVSVMFLVCIFYTTIVDVYKYVVNPLIDEVLSGYNCTVFAYGQTGTGKTFTMEGEKSNDPSISWQDDPLSGIVPRAMNHLFDELRLLGDAEFTVRVSFLEIYNEELIDLLSPTDDITKLRLFEDSARKGSVIIQGLEEKAVHNKDEVYKILEKGSQKRQTAATLMNAHSSRSHTIFTITIHIKDNSLDGEELLRTGKLNLVDLAGSENIGRSGAQDKRAREAGNINQSLLTLGRCITALVEKTPHIPYRESKLTRLLQDSLGGRTKTSIIATVSPAQLNMEETLSTLDYAHRAKNITNRPEINQKMSKKALLRVTSINMEETLSTLDYAHRAKNITNRPEINQKMPLNSVERAAKSCSIVDCSSSREITIKERVNDKISKTFGFDRVFSQESKQVDVYKYVVNPLIDEVLSGYNCTVFAYGQTGTGKTFTMEGEKSNDPSISWQDDPLSGIVPRAMNHLFDELRLLGDAEFTVRVSFLEIYNEELIDLLSPTDDITKLRHTSEYTEEIEKLRRDLQAAREKNGVFLAAENYDQMVNELYAEVTSVEKKSSSPSAAEDQPPTKHLILRARL
*****VTGLNTMMVVSVMFLVCIFYTTIVDVYKYVVNPLIDEVLSGYNCTVFAYGQTGTGKTF*****************PLSGIVPRAMNHLFDELRLLGDAEFTVRVSFLEIYNEELIDLLSPTDDITKLRLFEDSARKGSVIIQGLEEKAVHNKDEVYKIL*********************HTIFTITIHIKDNSLDGEELLRTGKLNLVDLA********************INQSLLTLGRCITALVEKTPHIPYRESKLTRLLQDSLGGRTKTSIIATVSP********LSTLDYA********************LLRVTSINMEETLSTLDYAH**************************CSIVDCSSSREITIKERVNDKISKTFGFDRVFSQESKQVDVYKYVVNPLIDEVLSGYNCTVFAYGQTGTGKTF*****************PLSGIVPRAMNHLFDELRLLGDAEFTVRVSFLEIYNEELIDLLSPTDDITKLRHTSEYTE*I*********AREKNGVFLAAENYDQMVNELYAE*****************************
*AL***********VSVMFLVCIFYTTIVDVYKYVVNPLIDEVLSGYNCTVFAYGQTGTGKTFTMEGEKSNDP***W*DDPLSGIVPRAMNHLFDELRLLGDAEFTVRVSFLEIYNEELIDLLSPTDDITKLRLFEDSARKGSVIIQGLEEKAVHNKDEVYKILEKGSQKRQTAATLMNAHSSRSHTIFTITIHI**********LRTGKLNLVDLAGSENIG*****DKRAREAGNINQSLLTLGRCITALVEKTPHIPYRESKLTRLLQDSLGGRTKTSIIATVSPAQLNMEETLSTLDYAHRAKNITNRPEINQKMSKKALLRVTSINMEETLSTLDYAHRAKNITNRPEINQKMPLNSVERAAKSCSIVDCSSSREITIKERVNDKISKTFGFDRVFSQESKQVDVYKYVVNPLIDEVLSGYNCTVFAYGQTGTGKTFTMEGE************PLSGIVPRAMNHLFDELRLLGDAEFTVRVSFLEIYNEELIDLLSP************************************************************************LILRARL
MALHQVTGLNTMMVVSVMFLVCIFYTTIVDVYKYVVNPLIDEVLSGYNCTVFAYGQTGTGKTFT***********SWQDDPLSGIVPRAMNHLFDELRLLGDAEFTVRVSFLEIYNEELIDLLSPTDDITKLRLFEDSARKGSVIIQGLEEKAVHNKDEVYKILEKGSQKRQTAATLMNAHSSRSHTIFTITIHIKDNSLDGEELLRTGKLNLVDLAGSENIGR*********EAGNINQSLLTLGRCITALVEKTPHIPYRESKLTRLLQDSLGGRTKTSIIATVSPAQLNMEETLSTLDYAHRAKNITNRPEINQKMSKKALLRVTSINMEETLSTLDYAHRAKNITNRPEINQKMPLNSVERAAKSCSIVDCSSSREITIKERVNDKISKTFGFDRVFSQESKQVDVYKYVVNPLIDEVLSGYNCTVFAYGQTGTGKTFT***********SWQDDPLSGIVPRAMNHLFDELRLLGDAEFTVRVSFLEIYNEELIDLLSPTDDITKLRHTSEYTEEIEKLRRDLQAAREKNGVFLAAENYDQMVNELYAE******************PTKHLILRARL
MALHQVTGLNTMMVVSVMFLVCIFYTTIVDVYKYVVNPLIDEVLSGYNCTVFAYGQTGTGKTFTMEGEKSNDPSISWQDDPLSGIVPRAMNHLFDELRLLGDAEFTVRVSFLEIYNEELIDLLSPTDDITKLRLFEDSARKGSVIIQGLEEKAVHNKDEVYKILEKGSQKRQTAATLMNAHSSRSHTIFTITIHIKDNSLDGEELLRTGKLNLVDLAG**************R**GNINQSLLTLGRCITALVEKTPHIPYRESKLTRLLQDSLGGRTKTSIIATVSPAQLNMEETLSTLDYAHRAKNITNRPEINQKMSKKALLRVTSINMEETLSTL********ITNRPEINQKMPLNSVERAAKSCSIVDCSSSREITIKERVNDKISKTFGFDRVFSQESKQVDVYKYVVNPLIDEVLSGYNCTVFAYGQTGTGKTFTMEGEKSNDPSISWQDDPLSGIVPRAMNHLFDELRLLGDAEFTVRVSFLEIYNEELIDLLSPTDDITKLRHTSEYTEEIEKLRRDLQAAREKNGVFLAAENYDQMVNELYAEVTSVEKKSSSPSAAEDQPPTKHLILRARL
iiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MALHQVTGLNTMMVVSVMFLVCIFYTTIVDVYKYVVNPLIDEVLSGYNCTVFAYGQTGTGKTFTMEGEKSNDPSISWQDDPLSGIVPRAMNHLFDELRLLGDAEFTVRVSFLEIYNEELIDLLSPTDDITKLRLFEDSARKGSVIIQGLEEKAVHNKDEVYKILEKGSQKRQTAATLMNAHSSRSHTIFTITIHIKDNSLDGEELLRTGKLNLVDLAGSENIGRSGAQDKRAREAGNINQSLLTLGRCITALVEKTPHIPYRESKLTRLLQDSLGGRTKTSIIATVSPAQLNMEETLSTLDYAHRAKNITNRPEINQKMSKKALLRVTSINMEETLSTLDYAHRAKNITNRPEINQKMPLNSVERAAKSCSIVDCSSSREITIKERVNDKISKTFGFDRVFSQESKQVDVYKYVVNPLIDEVLSGYNCTVFAYGQTGTGKTFTMEGEKSNDPSISWQDDPLSGIVPRAMNHLFDELRLLGDAEFTVRVSFLEIYNEELIDLLSPTDDITKLRHxxxxxxxxxxxxxxxxxxxxxNGVFLAxxxxxxxxxxxxxxxxxxxxxSSSPSAAEDQPPTKHLILRARL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query583 2.2.26 [Sep-21-2011]
Q91783 1067 Kinesin-like protein KIF1 N/A N/A 0.509 0.278 0.705 1e-129
Q6P9P6 1052 Kinesin-like protein KIF1 yes N/A 0.514 0.285 0.705 1e-129
P52732 1056 Kinesin-like protein KIF1 yes N/A 0.514 0.284 0.701 1e-128
P28025 1067 Kinesin-like protein KIF1 N/A N/A 0.509 0.278 0.698 1e-127
B2GU58 1067 Kinesin-like protein KIF1 yes N/A 0.509 0.278 0.698 1e-127
P46863 1066 Bipolar kinesin KRP-130 O yes N/A 0.506 0.276 0.674 1e-120
P46874378 Kinesin-like protein KLP2 N/A N/A 0.473 0.730 0.650 1e-106
P82266 1009 Probable 125 kDa kinesin- no N/A 0.545 0.315 0.571 1e-101
O23826 1006 125 kDa kinesin-related p N/A N/A 0.538 0.312 0.581 1e-101
P17120 1184 Kinesin-like protein bimC yes N/A 0.533 0.262 0.570 3e-94
>sp|Q91783|KI11A_XENLA Kinesin-like protein KIF11-A OS=Xenopus laevis GN=kif11-a PE=1 SV=1 Back     alignment and function desciption
 Score =  462 bits (1190), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 211/299 (70%), Positives = 266/299 (88%), Gaps = 2/299 (0%)

Query: 29  VDVYKYVVNPLIDEVLSGYNCTVFAYGQTGTGKTFTMEGEKSNDPSISWQDDPLSGIVPR 88
           +DVY+ VV P++DEV+ GYNCT+FAYGQTGTGKTFTMEGE+S+D   +W+ DPL+GI+PR
Sbjct: 79  IDVYRSVVCPILDEVIMGYNCTIFAYGQTGTGKTFTMEGERSSDEEFTWEQDPLAGIIPR 138

Query: 89  AMNHLFDELRLLGDAEFTVRVSFLEIYNEELIDLLSPTDDI-TKLRLFEDSARKGSVIIQ 147
            ++ +F++L  +G  EF+V+VS LEIYNEEL DLLSP+ D+  +L++F+D   K  VII+
Sbjct: 139 TLHQIFEKLSEIG-TEFSVKVSLLEIYNEELFDLLSPSPDVGERLQMFDDPRNKRGVIIK 197

Query: 148 GLEEKAVHNKDEVYKILEKGSQKRQTAATLMNAHSSRSHTIFTITIHIKDNSLDGEELLR 207
           GLEE +VHNKDEVY+ILE+G+ KR+TA+TLMNA+SSRSH++F++TIH+K+ ++DGEEL++
Sbjct: 198 GLEEISVHNKDEVYQILERGAAKRKTASTLMNAYSSRSHSVFSVTIHMKETTIDGEELVK 257

Query: 208 TGKLNLVDLAGSENIGRSGAQDKRAREAGNINQSLLTLGRCITALVEKTPHIPYRESKLT 267
            GKLNLVDLAGSENIGRSGA DKRAREAGNINQSLLTLGR ITALVE+ PHIPYRESKLT
Sbjct: 258 IGKLNLVDLAGSENIGRSGAVDKRAREAGNINQSLLTLGRVITALVERAPHIPYRESKLT 317

Query: 268 RLLQDSLGGRTKTSIIATVSPAQLNMEETLSTLDYAHRAKNITNRPEINQKMSKKALLR 326
           R+LQDSLGGRTKTSIIATVSPA +N+EET+STLDYA RAKNI N+PE+NQK++KKAL++
Sbjct: 318 RILQDSLGGRTKTSIIATVSPASINLEETMSTLDYASRAKNIMNKPEVNQKLTKKALIK 376
Plus end-directed motor protein required for establishing a bipolar spindle. Associates with both interphase and spindle microtubules. May be involved in nuclear divisions taking place during the development of unfertilized eggs.
Xenopus laevis (taxid: 8355)
>sp|Q6P9P6|KIF11_MOUSE Kinesin-like protein KIF11 OS=Mus musculus GN=Kif11 PE=2 SV=1 Back     alignment and function description
>sp|P52732|KIF11_HUMAN Kinesin-like protein KIF11 OS=Homo sapiens GN=KIF11 PE=1 SV=2 Back     alignment and function description
>sp|P28025|KI11B_XENLA Kinesin-like protein KIF11-B OS=Xenopus laevis GN=kif11-b PE=1 SV=2 Back     alignment and function description
>sp|B2GU58|KIF11_XENTR Kinesin-like protein KIF11 OS=Xenopus tropicalis GN=kif11 PE=2 SV=1 Back     alignment and function description
>sp|P46863|KL61_DROME Bipolar kinesin KRP-130 OS=Drosophila melanogaster GN=Klp61F PE=1 SV=2 Back     alignment and function description
>sp|P46874|KLP2_BOMMO Kinesin-like protein KLP2 (Fragment) OS=Bombyx mori PE=2 SV=1 Back     alignment and function description
>sp|P82266|K125_ARATH Probable 125 kDa kinesin-related protein OS=Arabidopsis thaliana GN=At2g36200 PE=2 SV=2 Back     alignment and function description
>sp|O23826|K125_TOBAC 125 kDa kinesin-related protein OS=Nicotiana tabacum GN=TKRP125 PE=1 SV=1 Back     alignment and function description
>sp|P17120|BIMC_EMENI Kinesin-like protein bimC OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=bimC PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query583
307206939520 Bipolar kinesin KRP-130 [Harpegnathos sa 0.509 0.571 0.818 1e-146
322788647 882 hypothetical protein SINV_02777 [Solenop 0.509 0.336 0.815 1e-145
332020097 992 Bipolar kinesin KRP-130 [Acromyrmex echi 0.509 0.299 0.822 1e-145
345490722 1103 PREDICTED: kinesin-like protein KIF11 [N 0.509 0.269 0.791 1e-143
12055369 1081 kinesin-like boursin [Paracentrotus livi 0.547 0.295 0.739 1e-141
47550973 1081 KRP170 [Strongylocentrotus purpuratus] g 0.542 0.292 0.743 1e-140
321465396 859 hypothetical protein DAPPUDRAFT_55076 [D 0.509 0.345 0.781 1e-138
383864893 991 PREDICTED: bipolar kinesin KRP-130-like 0.509 0.299 0.765 1e-137
328791698 987 PREDICTED: bipolar kinesin KRP-130 [Apis 0.509 0.300 0.755 1e-137
380028716681 PREDICTED: bipolar kinesin KRP-130-like 0.509 0.436 0.755 1e-136
>gi|307206939|gb|EFN84783.1| Bipolar kinesin KRP-130 [Harpegnathos saltator] Back     alignment and taxonomy information
 Score =  523 bits (1348), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 244/298 (81%), Positives = 277/298 (92%), Gaps = 1/298 (0%)

Query: 29  VDVYKYVVNPLIDEVLSGYNCTVFAYGQTGTGKTFTMEGEKSNDPSISWQDDPLSGIVPR 88
           +DVY  VVNPL++EVL+GYNCTVFAYGQTGTGKTFTMEG  SNDP++ WQ D  +GI+PR
Sbjct: 72  IDVYNAVVNPLLEEVLAGYNCTVFAYGQTGTGKTFTMEG-VSNDPTLHWQSDTSAGIIPR 130

Query: 89  AMNHLFDELRLLGDAEFTVRVSFLEIYNEELIDLLSPTDDITKLRLFEDSARKGSVIIQG 148
           A++HLFDELRLL   EFTVRVSFLE+YNEEL DLLSP+DD +K+RL+ED+ RKGSVII G
Sbjct: 131 ALSHLFDELRLLEVQEFTVRVSFLELYNEELFDLLSPSDDASKIRLYEDATRKGSVIIHG 190

Query: 149 LEEKAVHNKDEVYKILEKGSQKRQTAATLMNAHSSRSHTIFTITIHIKDNSLDGEELLRT 208
           LEE  VHNK+EVYKILEKGS++RQTAATLMNAHSSRSHT+F+ITIHIK+N++DGEELL+T
Sbjct: 191 LEEVTVHNKNEVYKILEKGSERRQTAATLMNAHSSRSHTVFSITIHIKENNMDGEELLKT 250

Query: 209 GKLNLVDLAGSENIGRSGAQDKRAREAGNINQSLLTLGRCITALVEKTPHIPYRESKLTR 268
           GKLNLVDLAGSEN+GRSGA D+RAREAGNINQSLLTLGR ITALVE+ PHIPYRESKLTR
Sbjct: 251 GKLNLVDLAGSENVGRSGAVDRRAREAGNINQSLLTLGRVITALVERAPHIPYRESKLTR 310

Query: 269 LLQDSLGGRTKTSIIATVSPAQLNMEETLSTLDYAHRAKNITNRPEINQKMSKKALLR 326
           LLQ+SLGGRTKTSIIATVSPA +N+EETLSTLDYAHRAKNITNRPEINQK+SKKALL+
Sbjct: 311 LLQESLGGRTKTSIIATVSPASINLEETLSTLDYAHRAKNITNRPEINQKLSKKALLK 368

Source: Harpegnathos saltator

Species: Harpegnathos saltator

Genus: Harpegnathos

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|322788647|gb|EFZ14248.1| hypothetical protein SINV_02777 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|332020097|gb|EGI60543.1| Bipolar kinesin KRP-130 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|345490722|ref|XP_001600745.2| PREDICTED: kinesin-like protein KIF11 [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|12055369|emb|CAC20783.1| kinesin-like boursin [Paracentrotus lividus] Back     alignment and taxonomy information
>gi|47550973|ref|NP_999660.1| KRP170 [Strongylocentrotus purpuratus] gi|10567777|gb|AAG18583.1|AF292395_1 KRP170 [Strongylocentrotus purpuratus] Back     alignment and taxonomy information
>gi|321465396|gb|EFX76397.1| hypothetical protein DAPPUDRAFT_55076 [Daphnia pulex] Back     alignment and taxonomy information
>gi|383864893|ref|XP_003707912.1| PREDICTED: bipolar kinesin KRP-130-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|328791698|ref|XP_623508.3| PREDICTED: bipolar kinesin KRP-130 [Apis mellifera] Back     alignment and taxonomy information
>gi|380028716|ref|XP_003698036.1| PREDICTED: bipolar kinesin KRP-130-like [Apis florea] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query583
UNIPROTKB|Q91783 1067 kif11-a "Kinesin-like protein 0.543 0.297 0.678 4.3e-128
UNIPROTKB|E1BF29 1055 KIF11 "Uncharacterized protein 0.548 0.303 0.678 3e-127
UNIPROTKB|P52732 1056 KIF11 "Kinesin-like protein KI 0.548 0.303 0.674 4.9e-127
UNIPROTKB|E2QXT6 1052 KIF11 "Uncharacterized protein 0.548 0.304 0.671 8e-127
UNIPROTKB|F1SC89 1059 KIF11 "Uncharacterized protein 0.548 0.302 0.671 1.7e-126
UNIPROTKB|F1MAB8 1056 Kif11 "Protein Kif11" [Rattus 0.548 0.303 0.681 2.7e-126
UNIPROTKB|F1NXA1 1067 KIF11 "Uncharacterized protein 0.543 0.297 0.671 5.7e-124
ZFIN|ZDB-GENE-020426-1 1062 kif11 "kinesin family member 1 0.509 0.279 0.685 7.4e-122
FB|FBgn0004378 1066 Klp61F "Kinesin-like protein a 0.540 0.295 0.645 4e-121
UNIPROTKB|P28025 1067 kif11-b "Kinesin-like protein 0.543 0.297 0.671 6e-116
UNIPROTKB|Q91783 kif11-a "Kinesin-like protein KIF11-A" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
 Score = 1138 (405.7 bits), Expect = 4.3e-128, Sum P(2) = 4.3e-128
 Identities = 217/320 (67%), Positives = 274/320 (85%)

Query:    29 VDVYKYVVNPLIDEVLSGYNCTVFAYGQTGTGKTFTMEGEKSNDPSISWQDDPLSGIVPR 88
             +DVY+ VV P++DEV+ GYNCT+FAYGQTGTGKTFTMEGE+S+D   +W+ DPL+GI+PR
Sbjct:    79 IDVYRSVVCPILDEVIMGYNCTIFAYGQTGTGKTFTMEGERSSDEEFTWEQDPLAGIIPR 138

Query:    89 AMNHLFDELRLLGDAEFTVRVSFLEIYNEELIDLLSPTDDI-TKLRLFEDSARKGSVIIQ 147
              ++ +F++L  +G  EF+V+VS LEIYNEEL DLLSP+ D+  +L++F+D   K  VII+
Sbjct:   139 TLHQIFEKLSEIG-TEFSVKVSLLEIYNEELFDLLSPSPDVGERLQMFDDPRNKRGVIIK 197

Query:   148 GLEEKAVHNKDEVYKILEKGSQKRQTAATLMNAHSSRSHTIFTITIHIKDNSLDGEELLR 207
             GLEE +VHNKDEVY+ILE+G+ KR+TA+TLMNA+SSRSH++F++TIH+K+ ++DGEEL++
Sbjct:   198 GLEEISVHNKDEVYQILERGAAKRKTASTLMNAYSSRSHSVFSVTIHMKETTIDGEELVK 257

Query:   208 TGKLNLVDLAGSENIGRSGAQDKRAREAGNINQSLLTLGRCITALVEKTPHIPYRESKLT 267
              GKLNLVDLAGSENIGRSGA DKRAREAGNINQSLLTLGR ITALVE+ PHIPYRESKLT
Sbjct:   258 IGKLNLVDLAGSENIGRSGAVDKRAREAGNINQSLLTLGRVITALVERAPHIPYRESKLT 317

Query:   268 RLLQDSLGGRTKTSIIATVSPAQLNMEETLSTLDYAHRAKNITNRPEINQKMSKKALLRV 327
             R+LQDSLGGRTKTSIIATVSPA +N+EET+STLDYA RAKNI N+PE+NQK++KKAL++ 
Sbjct:   318 RILQDSLGGRTKTSIIATVSPASINLEETMSTLDYASRAKNIMNKPEVNQKLTKKALIKE 377

Query:   328 TSINMEETLSTLDYAHRAKN 347
              +  +E     L  A R KN
Sbjct:   378 YTEEIERLKRELATA-REKN 396
GO:0000922 "spindle pole" evidence=IDA
GO:0003777 "microtubule motor activity" evidence=IMP
GO:0005737 "cytoplasm" evidence=IDA
GO:0005876 "spindle microtubule" evidence=IDA
GO:0008017 "microtubule binding" evidence=IDA
UNIPROTKB|E1BF29 KIF11 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|P52732 KIF11 "Kinesin-like protein KIF11" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|E2QXT6 KIF11 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1SC89 KIF11 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|F1MAB8 Kif11 "Protein Kif11" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1NXA1 KIF11 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-020426-1 kif11 "kinesin family member 11" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0004378 Klp61F "Kinesin-like protein at 61F" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|P28025 kif11-b "Kinesin-like protein KIF11-B" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q6P9P6KIF11_MOUSENo assigned EC number0.70520.51450.2851yesN/A
Q6RZZ9KIF13_DICDINo assigned EC number0.52140.49220.2268yesN/A
B2GU58KIF11_XENTRNo assigned EC number0.69890.50940.2783yesN/A
P46863KL61_DROMENo assigned EC number0.67440.50600.2767yesN/A
P24339CUT7_SCHPONo assigned EC number0.52270.53510.2875yesN/A
P52732KIF11_HUMANNo assigned EC number0.70190.51450.2840yesN/A
Q8J1G4KIP1_ASHGONo assigned EC number0.51540.49740.2568yesN/A
P28742KIP1_YEASTNo assigned EC number0.51920.50600.2655yesN/A
P17120BIMC_EMENINo assigned EC number0.57000.53340.2626yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query583
cd01364352 cd01364, KISc_BimC_Eg5, Kinesin motor domain, BimC 0.0
pfam00225326 pfam00225, Kinesin, Kinesin motor domain 1e-133
smart00129335 smart00129, KISc, Kinesin motor, catalytic domain 1e-132
cd00106328 cd00106, KISc, Kinesin motor domain 1e-120
cd01371333 cd01371, KISc_KIF3, Kinesin motor domain, kinesins 1e-110
cd01372341 cd01372, KISc_KIF4, Kinesin motor domain, KIF4-lik 1e-108
cd01366329 cd01366, KISc_C_terminal, Kinesin motor domain, KI 1e-101
cd01374321 cd01374, KISc_CENP_E, Kinesin motor domain, CENP-E 1e-97
cd01369325 cd01369, KISc_KHC_KIF5, Kinesin motor domain, kine 2e-97
cd01370338 cd01370, KISc_KIP3_like, Kinesin motor domain, KIP 8e-92
COG5059568 COG5059, KIP1, Kinesin-like protein [Cytoskeleton] 3e-89
cd01365356 cd01365, KISc_KIF1A_KIF1B, Kinesin motor domain, K 7e-89
cd01373337 cd01373, KISc_KLP2_like, Kinesin motor domain, KLP 1e-80
cd01367322 cd01367, KISc_KIF2_like, Kinesin motor domain, KIF 4e-79
cd01375334 cd01375, KISc_KIF9_like, Kinesin motor domain, KIF 9e-75
cd01376319 cd01376, KISc_KID_like, Kinesin motor domain, KIF2 8e-68
cd01368345 cd01368, KISc_KIF23_like, Kinesin motor domain, KI 3e-67
PLN03188 1320 PLN03188, PLN03188, kinesin-12 family protein; Pro 2e-65
cd01364 352 cd01364, KISc_BimC_Eg5, Kinesin motor domain, BimC 6e-63
cd01363186 cd01363, Motor_domain, Myosin and Kinesin motor do 3e-51
smart00129 335 smart00129, KISc, Kinesin motor, catalytic domain 5e-48
pfam00225 326 pfam00225, Kinesin, Kinesin motor domain 2e-47
cd00106 328 cd00106, KISc, Kinesin motor domain 2e-42
cd01371 333 cd01371, KISc_KIF3, Kinesin motor domain, kinesins 8e-40
cd01366 329 cd01366, KISc_C_terminal, Kinesin motor domain, KI 5e-38
cd01369325 cd01369, KISc_KHC_KIF5, Kinesin motor domain, kine 9e-38
cd01372 341 cd01372, KISc_KIF4, Kinesin motor domain, KIF4-lik 3e-37
cd01374 321 cd01374, KISc_CENP_E, Kinesin motor domain, CENP-E 1e-34
cd01370 338 cd01370, KISc_KIP3_like, Kinesin motor domain, KIP 1e-31
COG5059 568 COG5059, KIP1, Kinesin-like protein [Cytoskeleton] 4e-30
cd01375 334 cd01375, KISc_KIF9_like, Kinesin motor domain, KIF 2e-29
cd01367322 cd01367, KISc_KIF2_like, Kinesin motor domain, KIF 9e-28
cd01373 337 cd01373, KISc_KLP2_like, Kinesin motor domain, KLP 3e-26
cd01365 356 cd01365, KISc_KIF1A_KIF1B, Kinesin motor domain, K 6e-26
cd01376319 cd01376, KISc_KID_like, Kinesin motor domain, KIF2 2e-20
cd01368 345 cd01368, KISc_KIF23_like, Kinesin motor domain, KI 2e-20
PLN03188 1320 PLN03188, PLN03188, kinesin-12 family protein; Pro 2e-20
cd01363186 cd01363, Motor_domain, Myosin and Kinesin motor do 4e-13
cd01363186 cd01363, Motor_domain, Myosin and Kinesin motor do 2e-12
cd11492522 cd11492, SLC5sbd_NIS-SMVT, Na(+)/iodide (NIS) and 6e-06
COG5059568 COG5059, KIP1, Kinesin-like protein [Cytoskeleton] 3e-04
>gnl|CDD|238660 cd01364, KISc_BimC_Eg5, Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division Back     alignment and domain information 
 Score =  541 bits (1396), Expect = 0.0
 Identities = 201/290 (69%), Positives = 249/290 (85%), Gaps = 2/290 (0%)

Query: 30  DVYKYVVNPLIDEVLSGYNCTVFAYGQTGTGKTFTMEGEKSNDPSISWQDDPLSGIVPRA 89
           +VY  VV+P++DEVL GYNCT+FAYGQTGTGKT+TMEG+++++   +W+  P +GI+PRA
Sbjct: 64  EVYSQVVSPILDEVLMGYNCTIFAYGQTGTGKTYTMEGDRTDNKGSTWELSPHAGIIPRA 123

Query: 90  MNHLFDELRLLGDAEFTVRVSFLEIYNEELIDLLSPTDDITK-LRLFEDSARKGSVIIQG 148
           +  LF++L      E++V+VS+LE+YNEEL DLLS   D+ K LR+F+D+  KG V+IQG
Sbjct: 124 LYQLFEKLESQN-TEYSVKVSYLELYNEELFDLLSSESDLNKPLRIFDDTNNKGGVVIQG 182

Query: 149 LEEKAVHNKDEVYKILEKGSQKRQTAATLMNAHSSRSHTIFTITIHIKDNSLDGEELLRT 208
           LEE  V+N +E  K+LEKGS KR+TAATLMN  SSRSH+IF+ITIHIK+ ++ GEEL++ 
Sbjct: 183 LEEITVNNANEGLKLLEKGSAKRKTAATLMNDQSSRSHSIFSITIHIKETTISGEELVKI 242

Query: 209 GKLNLVDLAGSENIGRSGAQDKRAREAGNINQSLLTLGRCITALVEKTPHIPYRESKLTR 268
           GKLNLVDLAGSENIGRSGA++KRAREAGNINQSLLTLGR I ALVEK+PHIPYRESKLTR
Sbjct: 243 GKLNLVDLAGSENIGRSGAENKRAREAGNINQSLLTLGRVINALVEKSPHIPYRESKLTR 302

Query: 269 LLQDSLGGRTKTSIIATVSPAQLNMEETLSTLDYAHRAKNITNRPEINQK 318
           LLQDSLGGRTKTSIIAT+SPA +N+EETLSTL+YAHRAKNI N+PE+NQK
Sbjct: 303 LLQDSLGGRTKTSIIATISPASINLEETLSTLEYAHRAKNIKNKPEVNQK 352

This catalytic (head) domain has ATPase activity and belongs to the larger group of P-loop NTPases. Kinesins are microtubule-dependent molecular motors that play important roles in intracellular transport and in cell division. In most kinesins, the motor domain is found at the N-terminus (N-type), N-type kinesins are (+) end-directed motors, i.e. they transport cargo towards the (+) end of the microtubule. Kinesin motor domains hydrolyze ATP at a rate of about 80 per second, and move along the microtubule at a speed of about 6400 Angstroms per second. To achieve that, kinesin head groups work in pairs. Upon replacing ADP with ATP, a kinesin motor domain increases its affinity for microtubule binding and locks in place. Also, the neck linker binds to the motor domain, which repositions the other head domain through the coiled-coil domain close to a second tubulin dimer, about 80 Angstroms along the microtubule. Meanwhile, ATP hydrolysis takes place, and when the second head domain binds to the microtubule, the first domain again replaces ADP with ATP, triggering a conformational change that pulls the first domain forward. Length = 352
>gnl|CDD|215803 pfam00225, Kinesin, Kinesin motor domain Back     alignment and domain information
>gnl|CDD|214526 smart00129, KISc, Kinesin motor, catalytic domain Back     alignment and domain information
>gnl|CDD|238054 cd00106, KISc, Kinesin motor domain Back     alignment and domain information
>gnl|CDD|238667 cd01371, KISc_KIF3, Kinesin motor domain, kinesins II or KIF3_like proteins Back     alignment and domain information
>gnl|CDD|238668 cd01372, KISc_KIF4, Kinesin motor domain, KIF4-like subfamily Back     alignment and domain information
>gnl|CDD|238662 cd01366, KISc_C_terminal, Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins Back     alignment and domain information
>gnl|CDD|238670 cd01374, KISc_CENP_E, Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis Back     alignment and domain information
>gnl|CDD|238665 cd01369, KISc_KHC_KIF5, Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup Back     alignment and domain information
>gnl|CDD|238666 cd01370, KISc_KIP3_like, Kinesin motor domain, KIP3-like subgroup Back     alignment and domain information
>gnl|CDD|227392 COG5059, KIP1, Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>gnl|CDD|238661 cd01365, KISc_KIF1A_KIF1B, Kinesin motor domain, KIF1_like proteins Back     alignment and domain information
>gnl|CDD|238669 cd01373, KISc_KLP2_like, Kinesin motor domain, KLP2-like subgroup Back     alignment and domain information
>gnl|CDD|238663 cd01367, KISc_KIF2_like, Kinesin motor domain, KIF2-like group Back     alignment and domain information
>gnl|CDD|238671 cd01375, KISc_KIF9_like, Kinesin motor domain, KIF9-like subgroup; might play a role in cell shape remodeling Back     alignment and domain information
>gnl|CDD|238672 cd01376, KISc_KID_like, Kinesin motor domain, KIF22/Kid-like subgroup Back     alignment and domain information
>gnl|CDD|238664 cd01368, KISc_KIF23_like, Kinesin motor domain, KIF23-like subgroup Back     alignment and domain information
>gnl|CDD|215621 PLN03188, PLN03188, kinesin-12 family protein; Provisional Back     alignment and domain information
>gnl|CDD|238660 cd01364, KISc_BimC_Eg5, Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division Back     alignment and domain information
>gnl|CDD|238659 cd01363, Motor_domain, Myosin and Kinesin motor domain Back     alignment and domain information
>gnl|CDD|214526 smart00129, KISc, Kinesin motor, catalytic domain Back     alignment and domain information
>gnl|CDD|215803 pfam00225, Kinesin, Kinesin motor domain Back     alignment and domain information
>gnl|CDD|238054 cd00106, KISc, Kinesin motor domain Back     alignment and domain information
>gnl|CDD|238667 cd01371, KISc_KIF3, Kinesin motor domain, kinesins II or KIF3_like proteins Back     alignment and domain information
>gnl|CDD|238662 cd01366, KISc_C_terminal, Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins Back     alignment and domain information
>gnl|CDD|238665 cd01369, KISc_KHC_KIF5, Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup Back     alignment and domain information
>gnl|CDD|238668 cd01372, KISc_KIF4, Kinesin motor domain, KIF4-like subfamily Back     alignment and domain information
>gnl|CDD|238670 cd01374, KISc_CENP_E, Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis Back     alignment and domain information
>gnl|CDD|238666 cd01370, KISc_KIP3_like, Kinesin motor domain, KIP3-like subgroup Back     alignment and domain information
>gnl|CDD|227392 COG5059, KIP1, Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>gnl|CDD|238671 cd01375, KISc_KIF9_like, Kinesin motor domain, KIF9-like subgroup; might play a role in cell shape remodeling Back     alignment and domain information
>gnl|CDD|238663 cd01367, KISc_KIF2_like, Kinesin motor domain, KIF2-like group Back     alignment and domain information
>gnl|CDD|238669 cd01373, KISc_KLP2_like, Kinesin motor domain, KLP2-like subgroup Back     alignment and domain information
>gnl|CDD|238661 cd01365, KISc_KIF1A_KIF1B, Kinesin motor domain, KIF1_like proteins Back     alignment and domain information
>gnl|CDD|238672 cd01376, KISc_KID_like, Kinesin motor domain, KIF22/Kid-like subgroup Back     alignment and domain information
>gnl|CDD|238664 cd01368, KISc_KIF23_like, Kinesin motor domain, KIF23-like subgroup Back     alignment and domain information
>gnl|CDD|215621 PLN03188, PLN03188, kinesin-12 family protein; Provisional Back     alignment and domain information
>gnl|CDD|238659 cd01363, Motor_domain, Myosin and Kinesin motor domain Back     alignment and domain information
>gnl|CDD|238659 cd01363, Motor_domain, Myosin and Kinesin motor domain Back     alignment and domain information
>gnl|CDD|212061 cd11492, SLC5sbd_NIS-SMVT, Na(+)/iodide (NIS) and Na(+)/multivitamin (SMVT) cotransporters, and related proteins; solute binding domain Back     alignment and domain information
>gnl|CDD|227392 COG5059, KIP1, Kinesin-like protein [Cytoskeleton] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 583
KOG0243|consensus 1041 100.0
KOG4280|consensus574 100.0
KOG0245|consensus 1221 100.0
KOG0240|consensus607 100.0
KOG0242|consensus675 100.0
PLN03188 1320 kinesin-12 family protein; Provisional 100.0
cd01373337 KISc_KLP2_like Kinesin motor domain, KLP2-like sub 100.0
cd01370338 KISc_KIP3_like Kinesin motor domain, KIP3-like sub 100.0
cd01364352 KISc_BimC_Eg5 Kinesin motor domain, BimC/Eg5 spind 100.0
cd01368345 KISc_KIF23_like Kinesin motor domain, KIF23-like s 100.0
KOG0241|consensus 1714 100.0
cd01365356 KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like p 100.0
cd01371333 KISc_KIF3 Kinesin motor domain, kinesins II or KIF 100.0
cd01367322 KISc_KIF2_like Kinesin motor domain, KIF2-like gro 100.0
cd01375334 KISc_KIF9_like Kinesin motor domain, KIF9-like sub 100.0
cd01376319 KISc_KID_like Kinesin motor domain, KIF22/Kid-like 100.0
cd01374321 KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like 100.0
cd01372341 KISc_KIF4 Kinesin motor domain, KIF4-like subfamil 100.0
cd01369325 KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy 100.0
cd01366329 KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/ 100.0
KOG0239|consensus670 100.0
PF00225335 Kinesin: Kinesin motor domain; InterPro: IPR001752 100.0
smart00129335 KISc Kinesin motor, catalytic domain. ATPase. Micr 100.0
cd00106328 KISc Kinesin motor domain. This catalytic (head) d 100.0
KOG0244|consensus 913 100.0
KOG0246|consensus676 100.0
KOG0247|consensus809 100.0
COG5059568 KIP1 Kinesin-like protein [Cytoskeleton] 100.0
cd01363186 Motor_domain Myosin and Kinesin motor domain. Thes 100.0
KOG0243|consensus 1041 100.0
KOG0245|consensus 1221 100.0
cd01370 338 KISc_KIP3_like Kinesin motor domain, KIP3-like sub 100.0
KOG4280|consensus 574 100.0
KOG0240|consensus 607 100.0
cd01373 337 KISc_KLP2_like Kinesin motor domain, KLP2-like sub 100.0
KOG0242|consensus 675 100.0
cd01368 345 KISc_KIF23_like Kinesin motor domain, KIF23-like s 100.0
cd01367 322 KISc_KIF2_like Kinesin motor domain, KIF2-like gro 100.0
cd01365 356 KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like p 100.0
PLN03188 1320 kinesin-12 family protein; Provisional 100.0
cd01364 352 KISc_BimC_Eg5 Kinesin motor domain, BimC/Eg5 spind 100.0
cd01376 319 KISc_KID_like Kinesin motor domain, KIF22/Kid-like 100.0
cd01369 325 KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy 100.0
cd01374 321 KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like 100.0
cd01371 333 KISc_KIF3 Kinesin motor domain, kinesins II or KIF 100.0
KOG0246|consensus 676 100.0
KOG0239|consensus 670 100.0
cd01375 334 KISc_KIF9_like Kinesin motor domain, KIF9-like sub 100.0
cd01372 341 KISc_KIF4 Kinesin motor domain, KIF4-like subfamil 100.0
KOG0241|consensus 1714 100.0
cd01366 329 KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/ 100.0
KOG0247|consensus 809 100.0
PF00225 335 Kinesin: Kinesin motor domain; InterPro: IPR001752 100.0
smart00129 335 KISc Kinesin motor, catalytic domain. ATPase. Micr 100.0
cd00106 328 KISc Kinesin motor domain. This catalytic (head) d 100.0
COG5059 568 KIP1 Kinesin-like protein [Cytoskeleton] 99.95
KOG0244|consensus 913 99.95
cd01363186 Motor_domain Myosin and Kinesin motor domain. Thes 99.73
COG0556663 UvrB Helicase subunit of the DNA excision repair c 93.56
COG0556 663 UvrB Helicase subunit of the DNA excision repair c 93.48
COG2805353 PilT Tfp pilus assembly protein, pilus retraction 92.47
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 89.55
COG2804500 PulE Type II secretory pathway, ATPase PulE/Tfp pi 87.97
PRK06893229 DNA replication initiation factor; Validated 87.12
COG2805353 PilT Tfp pilus assembly protein, pilus retraction 86.99
PF00308219 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013 84.43
PRK06893229 DNA replication initiation factor; Validated 83.02
PF1324576 AAA_19: Part of AAA domain 82.89
PRK06620214 hypothetical protein; Validated 82.63
COG1474366 CDC6 Cdc6-related protein, AAA superfamily ATPase 82.05
cd00009151 AAA The AAA+ (ATPases Associated with a wide varie 81.34
PF04851184 ResIII: Type III restriction enzyme, res subunit; 80.76
>KOG0243|consensus Back     alignment and domain information 
Probab=100.00  E-value=8.1e-89  Score=753.69  Aligned_cols=340  Identities=61%  Similarity=0.864  Sum_probs=323.8

Q ss_pred             eeeeeeehhhcccCCceEEEeehhhhhhHHHHhcccceeEEEeeccCCCceEEeecccCCCCCCCcccCCCCccchhhhh
Q psy9448          12 MMVVSVMFLVCIFYTTIVDVYKYVVNPLIDEVLSGYNCTVFAYGQTGTGKTFTMEGEKSNDPSISWQDDPLSGIVPRAMN   91 (583)
Q Consensus        12 ~~~~~~~D~Vf~~~~tq~~vy~~~~~plv~~~l~G~n~~i~ayGqtgSGKT~Tm~G~~~~~~~~~~~~~~~~Giipr~~~   91 (583)
                      ..-.|.||+||+|.+.|++||+.++.|+|+.|+.|||||||||||||+||||||+|.....   .|..++..|||||++.
T Consensus        93 ~~k~ftFDkVFGpes~Q~d~Y~~~v~p~i~eVl~GyNCTIFAYGQTGTGKTyTMeG~~~~~---~g~l~~~aGIIPRal~  169 (1041)
T KOG0243|consen   93 IDKTFTFDKVFGPESQQEDLYDQAVSPIIKEVLEGYNCTIFAYGQTGTGKTYTMEGGERKK---NGELPSEAGIIPRALR  169 (1041)
T ss_pred             ccceeecceeeCcchhHHHHHHHHHHHHHHHHhccCCceEEEecCCCCCceeeeecCcccc---cCCCCccCCcchHHHH
Confidence            3455779999999999999999999999999999999999999999999999999976532   3566778899999999


Q ss_pred             HHHHHHhhccceeEEEEEeehhhchHHhhhhcCCCCcc-ceEEeeecc---ccccceEEeccceeeecchhHHHHHHHhc
Q psy9448          92 HLFDELRLLGDAEFTVRVSFLEIYNEELIDLLSPTDDI-TKLRLFEDS---ARKGSVIIQGLEEKAVHNKDEVYKILEKG  167 (583)
Q Consensus        92 ~lf~~~~~~~~~~~~v~vS~~EIyne~v~DLL~~~~~~-~~l~i~~~~---~~~~~~~v~~l~~~~v~s~~e~~~ll~~g  167 (583)
                      +||+.+...+ .+|.|+|||+|+|||+++|||++.+.. ..+++.+++   +.+||++|+|+.++.|.++.|++++|++|
T Consensus       170 ~IFd~Le~~~-~EYsvKVSfLELYNEEl~DLLa~~~~~~~~~~~k~~~~~~~~kggV~vkGlEEi~V~~A~ei~klLekG  248 (1041)
T KOG0243|consen  170 QIFDTLEAQG-AEYSVKVSFLELYNEELTDLLASEDTSDKKLRIKDDSTIVDGKGGVIVKGLEEIIVTNADEIYKLLEKG  248 (1041)
T ss_pred             HHHHHHHhcC-CeEEEEEEehhhhhHHHHHhcCCccccccccccccCCcccCCcCcEEEecceeeeecchhHHHHHHHhh
Confidence            9999999866 899999999999999999999998765 678888888   78999999999999999999999999999


Q ss_pred             chhhhhHHHHhhhcccCceeEEEEEEEeecCCCChhhHhhccCceeeeccCCcccCccchhhhhhhhhcCcchhhhhhhh
Q psy9448         168 SQKRQTAATLMNAHSSRSHTIFTITIHIKDNSLDGEELLRTGKLNLVDLAGSENIGRSGAQDKRAREAGNINQSLLTLGR  247 (583)
Q Consensus       168 ~~~R~~~~t~~n~~SSRSH~i~~i~i~~~~~~~~~~~~~~~s~L~~VDLAGsEr~~~~~~~~~~~~E~~~In~SL~~L~~  247 (583)
                      ...|++++|.||..|||||+||+|+|+.++....++++++.|||+||||||||.++++|+.+.|.+|+..||+||++||+
T Consensus       249 s~kRrtAaTl~N~~SSRSHsIFsItvhike~t~~geelvK~GKLNLVDLAGSENI~RSGA~~~RArEAG~INqSLLTLGR  328 (1041)
T KOG0243|consen  249 SKKRRTAATLMNDQSSRSHSIFSITVHIKENTPEGEELVKIGKLNLVDLAGSENISRSGARNGRAREAGEINQSLLTLGR  328 (1041)
T ss_pred             hhHhHHHHHHhhhhccccceEEEEEEEEecCCCcchhhHhhcccceeeccccccccccccccchhHHhhhhhHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHhhhCCCCCcchhhHhHHhhhhcCCcceeeEEEEeCccccchhhhhhhhhhhhhhccCCCchhhhhhhhHHHHHHH
Q psy9448         248 CITALVEKTPHIPYRESKLTRLLQDSLGGRTKTSIIATVSPAQLNMEETLSTLDYAHRAKNITNRPEINQKMSKKALLRV  327 (583)
Q Consensus       248 vi~aL~~~~~~ipyR~SkLT~lL~d~Lggn~~t~~I~~vsp~~~~~~eTl~TL~fa~r~k~i~n~~~~n~~~~~~~~~~~  327 (583)
                      ||.||.++..|||||+|||||||||+|||.++|+|||||||+..+++||++||.||.|||+|+|+|.+|+.+.++.++++
T Consensus       329 VInALVe~s~HIPYRESKLTRLLQDSLGGkTKT~iIATiSPa~~~lEETlSTLEYA~RAKnIkNKPevNQkl~K~~llKd  408 (1041)
T KOG0243|consen  329 VINALVEHSGHIPYRESKLTRLLQDSLGGKTKTCIIATISPAKHNLEETLSTLEYAHRAKNIKNKPEVNQKLMKKTLLKD  408 (1041)
T ss_pred             HHHHHHccCCCCCchHHHHHHHHHHHhCCCceeEEEEEeCCCcccHHHHHHHHHHHHHhhhccCCCccchHHHHHHHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             HHHHHHHhhhhhhhHhhhccCCCCccccc
Q psy9448         328 TSINMEETLSTLDYAHRAKNITNRPEINQ  356 (583)
Q Consensus       328 ~~~e~~~~l~~~~~~~~~~~~~~~~~~~q  356 (583)
                      |-.||++ ||+++++.|++||.+.++-.+
T Consensus       409 ~~~EIer-LK~dl~AaReKnGvyisee~y  436 (1041)
T KOG0243|consen  409 LYEEIER-LKRDLAAAREKNGVYISEERY  436 (1041)
T ss_pred             HHHHHHH-HHHHHHHhHhhCceEechHHH
Confidence            9999999 999999999999998886544

>KOG4280|consensus Back     alignment and domain information
>KOG0245|consensus Back     alignment and domain information
>KOG0240|consensus Back     alignment and domain information
>KOG0242|consensus Back     alignment and domain information
>PLN03188 kinesin-12 family protein; Provisional Back     alignment and domain information
>cd01373 KISc_KLP2_like Kinesin motor domain, KLP2-like subgroup Back     alignment and domain information
>cd01370 KISc_KIP3_like Kinesin motor domain, KIP3-like subgroup Back     alignment and domain information
>cd01364 KISc_BimC_Eg5 Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division Back     alignment and domain information
>cd01368 KISc_KIF23_like Kinesin motor domain, KIF23-like subgroup Back     alignment and domain information
>KOG0241|consensus Back     alignment and domain information
>cd01365 KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like proteins Back     alignment and domain information
>cd01371 KISc_KIF3 Kinesin motor domain, kinesins II or KIF3_like proteins Back     alignment and domain information
>cd01367 KISc_KIF2_like Kinesin motor domain, KIF2-like group Back     alignment and domain information
>cd01375 KISc_KIF9_like Kinesin motor domain, KIF9-like subgroup; might play a role in cell shape remodeling Back     alignment and domain information
>cd01376 KISc_KID_like Kinesin motor domain, KIF22/Kid-like subgroup Back     alignment and domain information
>cd01374 KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis Back     alignment and domain information
>cd01372 KISc_KIF4 Kinesin motor domain, KIF4-like subfamily Back     alignment and domain information
>cd01369 KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup Back     alignment and domain information
>cd01366 KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins Back     alignment and domain information
>KOG0239|consensus Back     alignment and domain information
>PF00225 Kinesin: Kinesin motor domain; InterPro: IPR001752 Kinesin [, , ] is a microtubule-associated force-producing protein that may play a role in organelle transport Back     alignment and domain information
>smart00129 KISc Kinesin motor, catalytic domain Back     alignment and domain information
>cd00106 KISc Kinesin motor domain Back     alignment and domain information
>KOG0244|consensus Back     alignment and domain information
>KOG0246|consensus Back     alignment and domain information
>KOG0247|consensus Back     alignment and domain information
>COG5059 KIP1 Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>cd01363 Motor_domain Myosin and Kinesin motor domain Back     alignment and domain information
>KOG0243|consensus Back     alignment and domain information
>KOG0245|consensus Back     alignment and domain information
>cd01370 KISc_KIP3_like Kinesin motor domain, KIP3-like subgroup Back     alignment and domain information
>KOG4280|consensus Back     alignment and domain information
>KOG0240|consensus Back     alignment and domain information
>cd01373 KISc_KLP2_like Kinesin motor domain, KLP2-like subgroup Back     alignment and domain information
>KOG0242|consensus Back     alignment and domain information
>cd01368 KISc_KIF23_like Kinesin motor domain, KIF23-like subgroup Back     alignment and domain information
>cd01367 KISc_KIF2_like Kinesin motor domain, KIF2-like group Back     alignment and domain information
>cd01365 KISc_KIF1A_KIF1B Kinesin motor domain, KIF1_like proteins Back     alignment and domain information
>PLN03188 kinesin-12 family protein; Provisional Back     alignment and domain information
>cd01364 KISc_BimC_Eg5 Kinesin motor domain, BimC/Eg5 spindle pole proteins, participate in spindle assembly and chromosome segregation during cell division Back     alignment and domain information
>cd01376 KISc_KID_like Kinesin motor domain, KIF22/Kid-like subgroup Back     alignment and domain information
>cd01369 KISc_KHC_KIF5 Kinesin motor domain, kinesin heavy chain (KHC) or KIF5-like subgroup Back     alignment and domain information
>cd01374 KISc_CENP_E Kinesin motor domain, CENP-E/KIP2-like subgroup, involved in chromosome movement and/or spindle elongation during mitosis Back     alignment and domain information
>cd01371 KISc_KIF3 Kinesin motor domain, kinesins II or KIF3_like proteins Back     alignment and domain information
>KOG0246|consensus Back     alignment and domain information
>KOG0239|consensus Back     alignment and domain information
>cd01375 KISc_KIF9_like Kinesin motor domain, KIF9-like subgroup; might play a role in cell shape remodeling Back     alignment and domain information
>cd01372 KISc_KIF4 Kinesin motor domain, KIF4-like subfamily Back     alignment and domain information
>KOG0241|consensus Back     alignment and domain information
>cd01366 KISc_C_terminal Kinesin motor domain, KIFC2/KIFC3/ncd-like carboxy-terminal kinesins Back     alignment and domain information
>KOG0247|consensus Back     alignment and domain information
>PF00225 Kinesin: Kinesin motor domain; InterPro: IPR001752 Kinesin [, , ] is a microtubule-associated force-producing protein that may play a role in organelle transport Back     alignment and domain information
>smart00129 KISc Kinesin motor, catalytic domain Back     alignment and domain information
>cd00106 KISc Kinesin motor domain Back     alignment and domain information
>COG5059 KIP1 Kinesin-like protein [Cytoskeleton] Back     alignment and domain information
>KOG0244|consensus Back     alignment and domain information
>cd01363 Motor_domain Myosin and Kinesin motor domain Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>COG0556 UvrB Helicase subunit of the DNA excision repair complex [DNA replication, recombination, and repair] Back     alignment and domain information
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>COG2804 PulE Type II secretory pathway, ATPase PulE/Tfp pilus assembly pathway, ATPase PilB [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>COG2805 PilT Tfp pilus assembly protein, pilus retraction ATPase PilT [Cell motility and secretion / Intracellular trafficking and secretion] Back     alignment and domain information
>PF00308 Bac_DnaA: Bacterial dnaA protein; InterPro: IPR013317 This entry represents the central domain of bacterial DnaA proteins [, , ] that play an important role in initiating and regulating chromosomal replication Back     alignment and domain information
>PRK06893 DNA replication initiation factor; Validated Back     alignment and domain information
>PF13245 AAA_19: Part of AAA domain Back     alignment and domain information
>PRK06620 hypothetical protein; Validated Back     alignment and domain information
>COG1474 CDC6 Cdc6-related protein, AAA superfamily ATPase [DNA replication, recombination, and repair / Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd00009 AAA The AAA+ (ATPases Associated with a wide variety of cellular Activities) superfamily represents an ancient group of ATPases belonging to the ASCE (for additional strand, catalytic E) division of the P-loop NTPase fold Back     alignment and domain information
>PF04851 ResIII: Type III restriction enzyme, res subunit; InterPro: IPR006935 This entry represents a domain found in the N terminus of several proteins, including helicases, the R subunit (HsdR) of type I restriction endonucleases (3 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query583
3hqd_A369 Human Kinesin Eg5 Motor Domain In Complex With Ampp 1e-126
3hqd_A 369 Human Kinesin Eg5 Motor Domain In Complex With Ampp 5e-44
1ii6_A368 Crystal Structure Of The Mitotic Kinesin Eg5 In Com 1e-126
1ii6_A 368 Crystal Structure Of The Mitotic Kinesin Eg5 In Com 5e-44
1q0b_A367 Crystal Structure Of The Motor Protein Ksp In Compl 1e-126
1q0b_A 367 Crystal Structure Of The Motor Protein Ksp In Compl 5e-44
4ap0_A370 The Mitotic Kinesin Eg5 In Complex With Mg-Adp And 1e-125
4ap0_A 370 The Mitotic Kinesin Eg5 In Complex With Mg-Adp And 5e-44
1x88_A359 Human Eg5 Motor Domain Bound To Mg-Adp And Monastro 1e-125
1x88_A 359 Human Eg5 Motor Domain Bound To Mg-Adp And Monastro 6e-44
4a28_A368 Eg5-2 Length = 368 1e-125
4a28_A 368 Eg5-2 Length = 368 9e-44
4a1z_A368 Eg5-1 Length = 368 1e-124
4a1z_A 368 Eg5-1 Length = 368 6e-43
4aqv_C373 Model Of Human Kinesin-5 Motor Domain (3hqd) And Ma 1e-124
4aqv_C 373 Model Of Human Kinesin-5 Motor Domain (3hqd) And Ma 1e-41
3zcw_A348 Eg5 - New Allosteric Binding Site Length = 348 1e-122
3zcw_A 348 Eg5 - New Allosteric Binding Site Length = 348 7e-44
2wbe_C373 Kinesin-5-Tubulin Complex With Amppnp Length = 373 1e-119
2wbe_C 373 Kinesin-5-Tubulin Complex With Amppnp Length = 373 9e-49
3b6u_A372 Crystal Structure Of The Motor Domain Of Human Kine 3e-72
3b6u_A 372 Crystal Structure Of The Motor Domain Of Human Kine 3e-25
3b6v_A395 Crystal Structure Of The Motor Domain Of Human Kine 3e-64
3b6v_A 395 Crystal Structure Of The Motor Domain Of Human Kine 2e-27
1goj_A355 Structure Of A Fast Kinesin: Implications For Atpas 4e-64
1goj_A 355 Structure Of A Fast Kinesin: Implications For Atpas 9e-25
2vvg_A350 Crystal Structure Of The G.Intestinalis Kinesin 2 G 4e-63
2vvg_A 350 Crystal Structure Of The G.Intestinalis Kinesin 2 G 5e-20
2y5w_A365 Crystal Structure Of Drosophila Melanogaster Kinesi 2e-57
2y5w_A 365 Crystal Structure Of Drosophila Melanogaster Kinesi 6e-18
1mkj_A349 Human Kinesin Motor Domain With Docked Neck Linker 4e-55
1mkj_A 349 Human Kinesin Motor Domain With Docked Neck Linker 1e-17
1t5c_A349 Crystal Structure Of The Motor Domain Of Human Kine 6e-55
1t5c_A 349 Crystal Structure Of The Motor Domain Of Human Kine 9e-24
4a14_A344 Human Kif7, A Kinesin Involved In Hedgehog Signalli 9e-55
4a14_A 344 Human Kif7, A Kinesin Involved In Hedgehog Signalli 3e-18
4atx_C340 Rigor Kinesin Motor Domain With An Ordered Neck-Lin 1e-54
4atx_C 340 Rigor Kinesin Motor Domain With An Ordered Neck-Lin 5e-17
1bg2_A325 Human Ubiquitous Kinesin Motor Domain Length = 325 4e-54
1bg2_A325 Human Ubiquitous Kinesin Motor Domain Length = 325 2e-17
2h58_A330 Crystal Structure Of The Kifc3 Motor Domain In Comp 5e-54
2h58_A 330 Crystal Structure Of The Kifc3 Motor Domain In Comp 2e-16
2xt3_A344 Human Kif7, A Kinesin Involved In Hedgehog Signalli 8e-53
2xt3_A 344 Human Kif7, A Kinesin Involved In Hedgehog Signalli 3e-18
3gbj_A354 Crystal Structure Of The Motor Domain Of Kinesin Ki 9e-53
3gbj_A 354 Crystal Structure Of The Motor Domain Of Kinesin Ki 8e-14
1sdm_A369 Crystal Structure Of Kinesin-Like Calmodulin Bindin 1e-51
1sdm_A 369 Crystal Structure Of Kinesin-Like Calmodulin Bindin 2e-16
3lre_A355 Crystal Structure Analysis Of Human Kinesin-8 Motor 4e-51
3lre_A 355 Crystal Structure Analysis Of Human Kinesin-8 Motor 2e-15
3h4s_A386 Structure Of The Complex Of A Mitotic Kinesin With 3e-50
3h4s_A 386 Structure Of The Complex Of A Mitotic Kinesin With 1e-16
3bfn_A388 Crystal Structure Of The Motor Domain Of Human Kine 4e-49
3bfn_A 388 Crystal Structure Of The Motor Domain Of Human Kine 6e-14
1ia0_K394 Kif1a Head-Microtubule Complex Structure In Atp-For 2e-48
1ia0_K 394 Kif1a Head-Microtubule Complex Structure In Atp-For 4e-15
1i5s_A367 Crystal Structure Of The Kif1a Motor Domain Complex 2e-48
1i5s_A 367 Crystal Structure Of The Kif1a Motor Domain Complex 4e-15
1i6i_A366 Crystal Structure Of The Kif1a Motor Domain Complex 2e-48
1i6i_A 366 Crystal Structure Of The Kif1a Motor Domain Complex 3e-15
1vfv_A366 Crystal Structure Of The Kif1a Motor Domain Complex 2e-48
1vfv_A 366 Crystal Structure Of The Kif1a Motor Domain Complex 3e-15
3nwn_A359 Crystal Structure Of The Human Kif9 Motor Domain In 9e-47
3nwn_A 359 Crystal Structure Of The Human Kif9 Motor Domain In 3e-16
2owm_A443 Motor Domain Of Neurospora Crassa Kinesin-3 (Nckin3 3e-45
2owm_A 443 Motor Domain Of Neurospora Crassa Kinesin-3 (Nckin3 2e-13
2heh_A387 Crystal Structure Of The Kif2c Motor Domain (Casp T 6e-45
2heh_A387 Crystal Structure Of The Kif2c Motor Domain (Casp T 1e-12
2gry_A420 Crystal Structure Of The Human Kif2 Motor Domain In 3e-44
2gry_A420 Crystal Structure Of The Human Kif2 Motor Domain In 3e-11
4h1g_A715 Structure Of Candida Albicans Kar3 Motor Domain Fus 7e-44
4h1g_A 715 Structure Of Candida Albicans Kar3 Motor Domain Fus 2e-16
1v8j_A410 The Crystal Structure Of The Minimal Functional Dom 3e-43
1v8j_A 410 The Crystal Structure Of The Minimal Functional Dom 6e-12
4gkr_A371 Structure Of The C-Terminal Motor Domain Of Kar3 Fr 4e-43
4gkr_A 371 Structure Of The C-Terminal Motor Domain Of Kar3 Fr 4e-17
3edl_D331 Kinesin13-Microtubule Ring Complex Length = 331 4e-43
3edl_D 331 Kinesin13-Microtubule Ring Complex Length = 331 3e-12
3u06_A412 Crystal Structure Of The Kinesin-14 Ncdg347d Length 3e-42
3u06_A 412 Crystal Structure Of The Kinesin-14 Ncdg347d Length 5e-20
2ncd_A420 Ncd (Non-Claret Disjunctional) Dimer From D. Melano 3e-42
2ncd_A 420 Ncd (Non-Claret Disjunctional) Dimer From D. Melano 6e-20
1cz7_A406 The Crystal Structure Of A Minus-End Directed Micro 3e-42
1cz7_A 406 The Crystal Structure Of A Minus-End Directed Micro 6e-20
3l1c_A383 Kinesin-14 Protein Ncd, T436s Mutant Length = 383 8e-42
3l1c_A383 Kinesin-14 Protein Ncd, T436s Mutant Length = 383 1e-19
1n6m_A409 Rotation Of The StalkNECK AND ONE HEAD IN A NEW CRY 2e-41
1n6m_A 409 Rotation Of The StalkNECK AND ONE HEAD IN A NEW CRY 6e-20
4etp_A403 C-Terminal Motor And Motor Homology Domain Of Kar3v 1e-40
4etp_A 403 C-Terminal Motor And Motor Homology Domain Of Kar3v 1e-18
3kar_A346 The Motor Domain Of Kinesin-Like Protein Kar3, A Sa 2e-40
3kar_A 346 The Motor Domain Of Kinesin-Like Protein Kar3, A Sa 3e-18
1f9t_A358 Crystal Structures Of Kinesin Mutants Reveal A Sign 2e-40
1f9t_A 358 Crystal Structures Of Kinesin Mutants Reveal A Sign 3e-18
2rep_A376 Crystal Structure Of The Motor Domain Of Human Kine 3e-40
2rep_A 376 Crystal Structure Of The Motor Domain Of Human Kine 4e-19
3pxn_A344 Crystal Structure Of The Drosophila Kinesin Family 4e-40
3pxn_A344 Crystal Structure Of The Drosophila Kinesin Family 4e-15
3dc4_A344 Crystal Structure Of The Drosophila Kinesin Family 6e-40
3dc4_A344 Crystal Structure Of The Drosophila Kinesin Family 4e-15
1f9w_A347 Crystal Structures Of Mutants Reveal A Signalling P 8e-40
1f9w_A 347 Crystal Structures Of Mutants Reveal A Signalling P 3e-18
1f9u_A347 Crystal Structures Of Mutants Reveal A Signalling P 9e-40
1f9u_A 347 Crystal Structures Of Mutants Reveal A Signalling P 3e-18
1f9v_A347 Crystal Structures Of Mutants Reveal A Signalling P 1e-39
1f9v_A 347 Crystal Structures Of Mutants Reveal A Signalling P 3e-18
3t0q_A349 Motor Domain Structure Of The Kar3-Like Kinesin Fro 3e-37
3t0q_A 349 Motor Domain Structure Of The Kar3-Like Kinesin Fro 2e-12
1ry6_A360 Crystal Structure Of Internal Kinesin Motor Domain 2e-34
1ry6_A 360 Crystal Structure Of Internal Kinesin Motor Domain 7e-11
2kin_A238 Kinesin (Monomeric) From Rattus Norvegicus Length = 7e-31
2kin_A238 Kinesin (Monomeric) From Rattus Norvegicus Length = 2e-17
2kin_B100 Kinesin (Monomeric) From Rattus Norvegicus Length = 2e-16
3kin_B117 Kinesin (Dimeric) From Rattus Norvegicus Length = 1 7e-16
>pdb|3HQD|A Chain A, Human Kinesin Eg5 Motor Domain In Complex With Amppnp And Mg2+ Length = 369 Back     alignment and structure 
Iteration: 1

 Score =  448 bits (1152), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 208/295 (70%), Positives = 260/295 (88%), Gaps = 2/295 (0%)
Query: 26  TTIVDVYKYVVNPLIDEVLSGYNCTVFAYGQTGTGKTFTMEGEKSNDPSISWQDDPLSGI 85
           T  +DVY+ VV P++DEV+ GYNCT+FAYGQTGTGKTFTMEGE+S +   +W++DPL+GI
Sbjct: 76  TKQIDVYRSVVCPILDEVIMGYNCTIFAYGQTGTGKTFTMEGERSPNEEYTWEEDPLAGI 135
Query: 86  VPRAMNHLFDELRLLGDAEFTVRVSFLEIYNEELIDLLSPTDDIT-KLRLFEDSARKGSV 144
           +PR ++ +F++L   G  EF+V+VS LEIYNEEL DLL+P+ D++ +L++F+D   K  V
Sbjct: 136 IPRTLHQIFEKLTDNG-TEFSVKVSLLEIYNEELFDLLNPSSDVSERLQMFDDPRNKRGV 194
Query: 145 IIQGLEEKAVHNKDEVYKILEKGSQKRQTAATLMNAHSSRSHTIFTITIHIKDNSLDGEE 204
           II+GLEE  VHNKDEVY+ILEKG+ KR TAATLMNA+SSRSH++F++TIH+K+ ++DGEE
Sbjct: 195 IIKGLEEITVHNKDEVYQILEKGAAKRTTAATLMNAYSSRSHSVFSVTIHMKETTIDGEE 254
Query: 205 LLRTGKLNLVDLAGSENIGRSGAQDKRAREAGNINQSLLTLGRCITALVEKTPHIPYRES 264
           L++ GKLNLVDLAGSENIGRSGA DKRAREAGNINQSLLTLGR ITALVE+TPH+PYRES
Sbjct: 255 LVKIGKLNLVDLAGSENIGRSGAVDKRAREAGNINQSLLTLGRVITALVERTPHVPYRES 314
Query: 265 KLTRLLQDSLGGRTKTSIIATVSPAQLNMEETLSTLDYAHRAKNITNRPEINQKM 319
           KLTR+LQDSLGGRT+TSIIAT+SPA LN+EETLSTL+YAHRAKNI N+PE+NQK+
Sbjct: 315 KLTRILQDSLGGRTRTSIIATISPASLNLEETLSTLEYAHRAKNILNKPEVNQKL 369
>pdb|3HQD|A Chain A, Human Kinesin Eg5 Motor Domain In Complex With Amppnp And Mg2+ Length = 369 Back     alignment and structure
>pdb|1II6|A Chain A, Crystal Structure Of The Mitotic Kinesin Eg5 In Complex With Mg-Adp. Length = 368 Back     alignment and structure
>pdb|1II6|A Chain A, Crystal Structure Of The Mitotic Kinesin Eg5 In Complex With Mg-Adp. Length = 368 Back     alignment and structure
>pdb|1Q0B|A Chain A, Crystal Structure Of The Motor Protein Ksp In Complex With Adp And Monastrol Length = 367 Back     alignment and structure
>pdb|1Q0B|A Chain A, Crystal Structure Of The Motor Protein Ksp In Complex With Adp And Monastrol Length = 367 Back     alignment and structure
>pdb|4AP0|A Chain A, The Mitotic Kinesin Eg5 In Complex With Mg-Adp And Ispinesib Length = 370 Back     alignment and structure
>pdb|4AP0|A Chain A, The Mitotic Kinesin Eg5 In Complex With Mg-Adp And Ispinesib Length = 370 Back     alignment and structure
>pdb|1X88|A Chain A, Human Eg5 Motor Domain Bound To Mg-Adp And Monastrol Length = 359 Back     alignment and structure
>pdb|1X88|A Chain A, Human Eg5 Motor Domain Bound To Mg-Adp And Monastrol Length = 359 Back     alignment and structure
>pdb|4A28|A Chain A, Eg5-2 Length = 368 Back     alignment and structure
>pdb|4A28|A Chain A, Eg5-2 Length = 368 Back     alignment and structure
>pdb|4A1Z|A Chain A, Eg5-1 Length = 368 Back     alignment and structure
>pdb|4A1Z|A Chain A, Eg5-1 Length = 368 Back     alignment and structure
>pdb|4AQV|C Chain C, Model Of Human Kinesin-5 Motor Domain (3hqd) And Mammalian Tubulin Heterodimer (1jff) Docked Into The 9.7-angstrom Cryo-em Map Of Microtubule-bound Kinesin-5 Motor Domain In The Ampppnp State. Length = 373 Back     alignment and structure
>pdb|4AQV|C Chain C, Model Of Human Kinesin-5 Motor Domain (3hqd) And Mammalian Tubulin Heterodimer (1jff) Docked Into The 9.7-angstrom Cryo-em Map Of Microtubule-bound Kinesin-5 Motor Domain In The Ampppnp State. Length = 373 Back     alignment and structure
>pdb|3ZCW|A Chain A, Eg5 - New Allosteric Binding Site Length = 348 Back     alignment and structure
>pdb|3ZCW|A Chain A, Eg5 - New Allosteric Binding Site Length = 348 Back     alignment and structure
>pdb|2WBE|C Chain C, Kinesin-5-Tubulin Complex With Amppnp Length = 373 Back     alignment and structure
>pdb|2WBE|C Chain C, Kinesin-5-Tubulin Complex With Amppnp Length = 373 Back     alignment and structure
>pdb|3B6U|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 3b In Complex With Adp Length = 372 Back     alignment and structure
>pdb|3B6U|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 3b In Complex With Adp Length = 372 Back     alignment and structure
>pdb|3B6V|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 3c In Complex With Adp Length = 395 Back     alignment and structure
>pdb|3B6V|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 3c In Complex With Adp Length = 395 Back     alignment and structure
>pdb|1GOJ|A Chain A, Structure Of A Fast Kinesin: Implications For Atpase Mechanism And Interactions With Microtubules Length = 355 Back     alignment and structure
>pdb|1GOJ|A Chain A, Structure Of A Fast Kinesin: Implications For Atpase Mechanism And Interactions With Microtubules Length = 355 Back     alignment and structure
>pdb|2VVG|A Chain A, Crystal Structure Of The G.Intestinalis Kinesin 2 Gikin2a Motor Domain Length = 350 Back     alignment and structure
>pdb|2VVG|A Chain A, Crystal Structure Of The G.Intestinalis Kinesin 2 Gikin2a Motor Domain Length = 350 Back     alignment and structure
>pdb|2Y5W|A Chain A, Crystal Structure Of Drosophila Melanogaster Kinesin-1 Motor Domain Dimer Length = 365 Back     alignment and structure
>pdb|2Y5W|A Chain A, Crystal Structure Of Drosophila Melanogaster Kinesin-1 Motor Domain Dimer Length = 365 Back     alignment and structure
>pdb|1MKJ|A Chain A, Human Kinesin Motor Domain With Docked Neck Linker Length = 349 Back     alignment and structure
>pdb|1MKJ|A Chain A, Human Kinesin Motor Domain With Docked Neck Linker Length = 349 Back     alignment and structure
>pdb|1T5C|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinetochore Protein Cenp-E Length = 349 Back     alignment and structure
>pdb|1T5C|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinetochore Protein Cenp-E Length = 349 Back     alignment and structure
>pdb|4A14|A Chain A, Human Kif7, A Kinesin Involved In Hedgehog Signalling Length = 344 Back     alignment and structure
>pdb|4A14|A Chain A, Human Kif7, A Kinesin Involved In Hedgehog Signalling Length = 344 Back     alignment and structure
>pdb|4ATX|C Chain C, Rigor Kinesin Motor Domain With An Ordered Neck-Linker, Docked On Tubulin Dimer, Modelled Into The 8a Cryo-Em Map Of Doublecortin-Microtubules Decorated With Kinesin Length = 340 Back     alignment and structure
>pdb|4ATX|C Chain C, Rigor Kinesin Motor Domain With An Ordered Neck-Linker, Docked On Tubulin Dimer, Modelled Into The 8a Cryo-Em Map Of Doublecortin-Microtubules Decorated With Kinesin Length = 340 Back     alignment and structure
>pdb|1BG2|A Chain A, Human Ubiquitous Kinesin Motor Domain Length = 325 Back     alignment and structure
>pdb|1BG2|A Chain A, Human Ubiquitous Kinesin Motor Domain Length = 325 Back     alignment and structure
>pdb|2H58|A Chain A, Crystal Structure Of The Kifc3 Motor Domain In Complex With Adp Length = 330 Back     alignment and structure
>pdb|2H58|A Chain A, Crystal Structure Of The Kifc3 Motor Domain In Complex With Adp Length = 330 Back     alignment and structure
>pdb|2XT3|A Chain A, Human Kif7, A Kinesin Involved In Hedgehog Signalling Length = 344 Back     alignment and structure
>pdb|2XT3|A Chain A, Human Kif7, A Kinesin Involved In Hedgehog Signalling Length = 344 Back     alignment and structure
>pdb|3GBJ|A Chain A, Crystal Structure Of The Motor Domain Of Kinesin Kif13b Bound With Adp Length = 354 Back     alignment and structure
>pdb|3GBJ|A Chain A, Crystal Structure Of The Motor Domain Of Kinesin Kif13b Bound With Adp Length = 354 Back     alignment and structure
>pdb|1SDM|A Chain A, Crystal Structure Of Kinesin-Like Calmodulin Binding Protein Length = 369 Back     alignment and structure
>pdb|1SDM|A Chain A, Crystal Structure Of Kinesin-Like Calmodulin Binding Protein Length = 369 Back     alignment and structure
>pdb|3LRE|A Chain A, Crystal Structure Analysis Of Human Kinesin-8 Motor Domain Length = 355 Back     alignment and structure
>pdb|3LRE|A Chain A, Crystal Structure Analysis Of Human Kinesin-8 Motor Domain Length = 355 Back     alignment and structure
>pdb|3H4S|A Chain A, Structure Of The Complex Of A Mitotic Kinesin With Its Calcium Binding Regulator Length = 386 Back     alignment and structure
>pdb|3H4S|A Chain A, Structure Of The Complex Of A Mitotic Kinesin With Its Calcium Binding Regulator Length = 386 Back     alignment and structure
>pdb|3BFN|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 22 Length = 388 Back     alignment and structure
>pdb|3BFN|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member 22 Length = 388 Back     alignment and structure
>pdb|1IA0|K Chain K, Kif1a Head-Microtubule Complex Structure In Atp-Form Length = 394 Back     alignment and structure
>pdb|1IA0|K Chain K, Kif1a Head-Microtubule Complex Structure In Atp-Form Length = 394 Back     alignment and structure
>pdb|1I5S|A Chain A, Crystal Structure Of The Kif1a Motor Domain Complexed With Mg-Adp Length = 367 Back     alignment and structure
>pdb|1I5S|A Chain A, Crystal Structure Of The Kif1a Motor Domain Complexed With Mg-Adp Length = 367 Back     alignment and structure
>pdb|1I6I|A Chain A, Crystal Structure Of The Kif1a Motor Domain Complexed With Mg-Amppcp Length = 366 Back     alignment and structure
>pdb|1I6I|A Chain A, Crystal Structure Of The Kif1a Motor Domain Complexed With Mg-Amppcp Length = 366 Back     alignment and structure
>pdb|1VFV|A Chain A, Crystal Structure Of The Kif1a Motor Domain Complexed With Mg-Amppnp Length = 366 Back     alignment and structure
>pdb|1VFV|A Chain A, Crystal Structure Of The Kif1a Motor Domain Complexed With Mg-Amppnp Length = 366 Back     alignment and structure
>pdb|3NWN|A Chain A, Crystal Structure Of The Human Kif9 Motor Domain In Complex With Adp Length = 359 Back     alignment and structure
>pdb|3NWN|A Chain A, Crystal Structure Of The Human Kif9 Motor Domain In Complex With Adp Length = 359 Back     alignment and structure
>pdb|2OWM|A Chain A, Motor Domain Of Neurospora Crassa Kinesin-3 (Nckin3) Length = 443 Back     alignment and structure
>pdb|2OWM|A Chain A, Motor Domain Of Neurospora Crassa Kinesin-3 (Nckin3) Length = 443 Back     alignment and structure
>pdb|2HEH|A Chain A, Crystal Structure Of The Kif2c Motor Domain (Casp Target) Length = 387 Back     alignment and structure
>pdb|2HEH|A Chain A, Crystal Structure Of The Kif2c Motor Domain (Casp Target) Length = 387 Back     alignment and structure
>pdb|2GRY|A Chain A, Crystal Structure Of The Human Kif2 Motor Domain In Complex With Adp Length = 420 Back     alignment and structure
>pdb|2GRY|A Chain A, Crystal Structure Of The Human Kif2 Motor Domain In Complex With Adp Length = 420 Back     alignment and structure
>pdb|4H1G|A Chain A, Structure Of Candida Albicans Kar3 Motor Domain Fused To Maltose- Binding Protein Length = 715 Back     alignment and structure
>pdb|4H1G|A Chain A, Structure Of Candida Albicans Kar3 Motor Domain Fused To Maltose- Binding Protein Length = 715 Back     alignment and structure
>pdb|1V8J|A Chain A, The Crystal Structure Of The Minimal Functional Domain Of The Microtubule Destabilizer Kif2c Complexed With Mg-adp Length = 410 Back     alignment and structure
>pdb|1V8J|A Chain A, The Crystal Structure Of The Minimal Functional Domain Of The Microtubule Destabilizer Kif2c Complexed With Mg-adp Length = 410 Back     alignment and structure
>pdb|4GKR|A Chain A, Structure Of The C-Terminal Motor Domain Of Kar3 From Candida Glabrata Length = 371 Back     alignment and structure
>pdb|4GKR|A Chain A, Structure Of The C-Terminal Motor Domain Of Kar3 From Candida Glabrata Length = 371 Back     alignment and structure
>pdb|3EDL|D Chain D, Kinesin13-Microtubule Ring Complex Length = 331 Back     alignment and structure
>pdb|3EDL|D Chain D, Kinesin13-Microtubule Ring Complex Length = 331 Back     alignment and structure
>pdb|3U06|A Chain A, Crystal Structure Of The Kinesin-14 Ncdg347d Length = 412 Back     alignment and structure
>pdb|3U06|A Chain A, Crystal Structure Of The Kinesin-14 Ncdg347d Length = 412 Back     alignment and structure
>pdb|2NCD|A Chain A, Ncd (Non-Claret Disjunctional) Dimer From D. Melanogaster Length = 420 Back     alignment and structure
>pdb|2NCD|A Chain A, Ncd (Non-Claret Disjunctional) Dimer From D. Melanogaster Length = 420 Back     alignment and structure
>pdb|1CZ7|A Chain A, The Crystal Structure Of A Minus-End Directed Microtubule Motor Protein Ncd Reveals Variable Dimer Conformations Length = 406 Back     alignment and structure
>pdb|1CZ7|A Chain A, The Crystal Structure Of A Minus-End Directed Microtubule Motor Protein Ncd Reveals Variable Dimer Conformations Length = 406 Back     alignment and structure
>pdb|3L1C|A Chain A, Kinesin-14 Protein Ncd, T436s Mutant Length = 383 Back     alignment and structure
>pdb|3L1C|A Chain A, Kinesin-14 Protein Ncd, T436s Mutant Length = 383 Back     alignment and structure
>pdb|1N6M|A Chain A, Rotation Of The StalkNECK AND ONE HEAD IN A NEW CRYSTAL Structure Of The Kinesin Motor Protein, Ncd Length = 409 Back     alignment and structure
>pdb|1N6M|A Chain A, Rotation Of The StalkNECK AND ONE HEAD IN A NEW CRYSTAL Structure Of The Kinesin Motor Protein, Ncd Length = 409 Back     alignment and structure
>pdb|4ETP|A Chain A, C-Terminal Motor And Motor Homology Domain Of Kar3vik1 Fused To A Synthetic Heterodimeric Coiled Coil Length = 403 Back     alignment and structure
>pdb|4ETP|A Chain A, C-Terminal Motor And Motor Homology Domain Of Kar3vik1 Fused To A Synthetic Heterodimeric Coiled Coil Length = 403 Back     alignment and structure
>pdb|3KAR|A Chain A, The Motor Domain Of Kinesin-Like Protein Kar3, A Saccharomyces Cerevisiae Kinesin-Related Protein Length = 346 Back     alignment and structure
>pdb|3KAR|A Chain A, The Motor Domain Of Kinesin-Like Protein Kar3, A Saccharomyces Cerevisiae Kinesin-Related Protein Length = 346 Back     alignment and structure
>pdb|1F9T|A Chain A, Crystal Structures Of Kinesin Mutants Reveal A Signalling Pathway For Activation Of The Motor Atpase Length = 358 Back     alignment and structure
>pdb|1F9T|A Chain A, Crystal Structures Of Kinesin Mutants Reveal A Signalling Pathway For Activation Of The Motor Atpase Length = 358 Back     alignment and structure
>pdb|2REP|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member C1 Length = 376 Back     alignment and structure
>pdb|2REP|A Chain A, Crystal Structure Of The Motor Domain Of Human Kinesin Family Member C1 Length = 376 Back     alignment and structure
>pdb|3PXN|A Chain A, Crystal Structure Of The Drosophila Kinesin Family Member Kin10NOD IN Complex With Divalent Manganese And Adp Length = 344 Back     alignment and structure
>pdb|3PXN|A Chain A, Crystal Structure Of The Drosophila Kinesin Family Member Kin10NOD IN Complex With Divalent Manganese And Adp Length = 344 Back     alignment and structure
>pdb|3DC4|A Chain A, Crystal Structure Of The Drosophila Kinesin Family Member Nod In Complex With Adp Length = 344 Back     alignment and structure
>pdb|3DC4|A Chain A, Crystal Structure Of The Drosophila Kinesin Family Member Nod In Complex With Adp Length = 344 Back     alignment and structure
>pdb|1F9W|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 Back     alignment and structure
>pdb|1F9W|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 Back     alignment and structure
>pdb|1F9U|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 Back     alignment and structure
>pdb|1F9U|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 Back     alignment and structure
>pdb|1F9V|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 Back     alignment and structure
>pdb|1F9V|A Chain A, Crystal Structures Of Mutants Reveal A Signalling Pathway For Activation Of The Kinesin Motor Atpase Length = 347 Back     alignment and structure
>pdb|3T0Q|A Chain A, Motor Domain Structure Of The Kar3-Like Kinesin From Ashbya Gossypii Length = 349 Back     alignment and structure
>pdb|3T0Q|A Chain A, Motor Domain Structure Of The Kar3-Like Kinesin From Ashbya Gossypii Length = 349 Back     alignment and structure
>pdb|1RY6|A Chain A, Crystal Structure Of Internal Kinesin Motor Domain Length = 360 Back     alignment and structure
>pdb|1RY6|A Chain A, Crystal Structure Of Internal Kinesin Motor Domain Length = 360 Back     alignment and structure
>pdb|2KIN|A Chain A, Kinesin (Monomeric) From Rattus Norvegicus Length = 238 Back     alignment and structure
>pdb|2KIN|A Chain A, Kinesin (Monomeric) From Rattus Norvegicus Length = 238 Back     alignment and structure
>pdb|2KIN|B Chain B, Kinesin (Monomeric) From Rattus Norvegicus Length = 100 Back     alignment and structure
>pdb|3KIN|B Chain B, Kinesin (Dimeric) From Rattus Norvegicus Length = 117 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query583
2wbe_C373 Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mit 0.0
2wbe_C 373 Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mit 6e-65
1x88_A359 Kinesin-like protein KIF11; switch II, motor domai 0.0
1x88_A 359 Kinesin-like protein KIF11; switch II, motor domai 4e-61
3b6u_A372 Kinesin-like protein KIF3B; structural genomics co 1e-168
3b6u_A 372 Kinesin-like protein KIF3B; structural genomics co 5e-56
2y65_A365 Kinesin, kinesin heavy chain; motor protein; HET: 1e-161
2y65_A 365 Kinesin, kinesin heavy chain; motor protein; HET: 6e-54
1goj_A355 Kinesin, kinesin heavy chain; motor protein, ATPas 1e-161
1goj_A 355 Kinesin, kinesin heavy chain; motor protein, ATPas 1e-54
2vvg_A350 Kinesin-2; motor protein, nucleotide-binding, micr 1e-160
2vvg_A 350 Kinesin-2; motor protein, nucleotide-binding, micr 6e-51
4a14_A344 Kinesin, kinesin-like protein KIF7; motor protein, 1e-158
4a14_A 344 Kinesin, kinesin-like protein KIF7; motor protein, 5e-57
3bfn_A388 Kinesin-like protein KIF22; limited proteolysis, s 1e-157
3bfn_A 388 Kinesin-like protein KIF22; limited proteolysis, s 2e-54
3dc4_A344 Kinesin-like protein NOD; catalytic domain, ATPase 1e-156
3dc4_A344 Kinesin-like protein NOD; catalytic domain, ATPase 3e-52
1bg2_A325 Kinesin; motor protein, ATPase, microtubule associ 1e-152
1bg2_A325 Kinesin; motor protein, ATPase, microtubule associ 4e-54
1ry6_A360 Internal kinesin; kinesin motor domain, nucleotide 1e-149
1ry6_A 360 Internal kinesin; kinesin motor domain, nucleotide 2e-51
2nr8_A358 Kinesin-like protein KIF9; motor domain, ADP, stru 1e-149
2nr8_A 358 Kinesin-like protein KIF9; motor domain, ADP, stru 4e-51
1t5c_A349 CENP-E protein, centromeric protein E; kinesin mot 1e-148
1t5c_A 349 CENP-E protein, centromeric protein E; kinesin mot 2e-52
1v8k_A410 Kinesin-like protein KIF2C; microtubule destabiliz 1e-146
1v8k_A 410 Kinesin-like protein KIF2C; microtubule destabiliz 2e-51
2heh_A387 KIF2C protein; kinesin, motor domain, ADP, structu 1e-145
2heh_A387 KIF2C protein; kinesin, motor domain, ADP, structu 1e-51
3cob_A369 Kinesin heavy chain-like protein; motor, switch II 1e-141
3cob_A 369 Kinesin heavy chain-like protein; motor, switch II 4e-49
2h58_A330 Kinesin-like protein KIFC3 variant; motor domain, 1e-141
2h58_A 330 Kinesin-like protein KIFC3 variant; motor domain, 2e-51
3lre_A355 Kinesin-like protein KIF18A; motor protein, nucleo 1e-141
3lre_A 355 Kinesin-like protein KIF18A; motor protein, nucleo 1e-46
2rep_A376 Kinesin-like protein KIFC1; structural genomics co 1e-138
2rep_A 376 Kinesin-like protein KIFC1; structural genomics co 2e-48
3u06_A412 Protein claret segregational; motor domain, stalk 1e-136
3u06_A 412 Protein claret segregational; motor domain, stalk 5e-49
2zfi_A366 Kinesin-like protein KIF1A, kinesin heavy chain is 1e-134
2zfi_A 366 Kinesin-like protein KIF1A, kinesin heavy chain is 5e-46
3gbj_A354 KIF13B protein; kinesin, motor domain, ADP, struct 1e-131
3gbj_A 354 KIF13B protein; kinesin, motor domain, ADP, struct 1e-44
2owm_A443 Nckin3-434, related to kinesin-like protein KIF1C; 1e-129
2owm_A 443 Nckin3-434, related to kinesin-like protein KIF1C; 9e-42
1f9v_A347 Kinesin-like protein KAR3; kinesin-related protein 1e-127
1f9v_A 347 Kinesin-like protein KAR3; kinesin-related protein 7e-46
4etp_A403 Kinesin-like protein KAR3; kinesin motor protein, 1e-126
4etp_A 403 Kinesin-like protein KAR3; kinesin motor protein, 3e-45
3t0q_A349 AGR253WP; kinesin, alpha and beta proteins, P-loop 1e-119
3t0q_A 349 AGR253WP; kinesin, alpha and beta proteins, P-loop 2e-45
2kin_B100 Kinesin; motor protein, cytoskeleton; HET: ADP; 2. 1e-48
3kin_B117 Kinesin heavy chain; motor protein, cytoskeleton; 5e-46
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-07
>2wbe_C Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mitosis, GTP-binding, motor protein, cell division, cell cycle, microtubule, ATP-binding; HET: GTP ANP GDP TA1; 9.40A {Drosophila melanogaster} Length = 373 Back     alignment and structure
 Score =  519 bits (1338), Expect = 0.0
 Identities = 198/293 (67%), Positives = 252/293 (86%), Gaps = 3/293 (1%)

Query: 30  DVYKYVVNPLIDEVLSGYNCTVFAYGQTGTGKTFTMEGEKSNDPSISWQDDPLSGIVPRA 89
           DVY  VV+PLI+EVL+GYNCTVFAYGQTGTGKT TM G ++ +   SW+DD   GI+PRA
Sbjct: 83  DVYSVVVSPLIEEVLNGYNCTVFAYGQTGTGKTHTMVGNETAELKSSWEDDSDIGIIPRA 142

Query: 90  MNHLFDELRLLGDAEFTVRVSFLEIYNEELIDLLSPTDDITKLRLFEDSARKGSVIIQGL 149
           ++HLFDELR++ + E+T+R+S+LE+YNEEL DLLS  DD TK+R+F+DS +KGSVIIQGL
Sbjct: 143 LSHLFDELRMM-EVEYTMRISYLELYNEELCDLLST-DDTTKIRIFDDSTKKGSVIIQGL 200

Query: 150 EEKAVHNKDEVYKILEKGSQKRQTAATLMNAHSSRSHTIFTITIHIKDNSLDGEELLRTG 209
           EE  VH+KD+VYK+LEKG ++R+TA TLMNA SSRSHT+F+I +HI++N ++GE++L+ G
Sbjct: 201 EEIPVHSKDDVYKLLEKGKERRKTATTLMNAQSSRSHTVFSIVVHIRENGIEGEDMLKIG 260

Query: 210 KLNLVDLAGSENIGRSGAQDK-RAREAGNINQSLLTLGRCITALVEKTPHIPYRESKLTR 268
           KLNLVDLAGSEN+ ++G +   R RE  NINQSLLTLGR ITALV++ PH+PYRESKLTR
Sbjct: 261 KLNLVDLAGSENVSKAGNEKGIRVRETVNINQSLLTLGRVITALVDRAPHVPYRESKLTR 320

Query: 269 LLQDSLGGRTKTSIIATVSPAQLNMEETLSTLDYAHRAKNITNRPEINQKMSK 321
           LLQ+SLGGRTKTSIIAT+SP   ++EETLSTL+YAHRAKNI N+PE+NQK++K
Sbjct: 321 LLQESLGGRTKTSIIATISPGHKDIEETLSTLEYAHRAKNIQNKPEVNQKLTK 373
>2wbe_C Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mitosis, GTP-binding, motor protein, cell division, cell cycle, microtubule, ATP-binding; HET: GTP ANP GDP TA1; 9.40A {Drosophila melanogaster} Length = 373 Back     alignment and structure
>1x88_A Kinesin-like protein KIF11; switch II, motor domain, NECK linker, cell cycle; HET: ADP NAT; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 3hqd_A* 3ken_A* 2pg2_A* 1yrs_A* 2fme_A* 2g1q_A* 2gm1_A* 1ii6_A* 2uyi_A* 2uym_A* 2wog_A* 2x2r_A* 2x7c_A* 2x7d_A* 2x7e_A* 2xae_A* 3k3b_A* 3k5e_A* 3l9h_A* 1q0b_A* ... Length = 359 Back     alignment and structure
>1x88_A Kinesin-like protein KIF11; switch II, motor domain, NECK linker, cell cycle; HET: ADP NAT; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 3hqd_A* 3ken_A* 2pg2_A* 1yrs_A* 2fme_A* 2g1q_A* 2gm1_A* 1ii6_A* 2uyi_A* 2uym_A* 2wog_A* 2x2r_A* 2x7c_A* 2x7d_A* 2x7e_A* 2xae_A* 3k3b_A* 3k5e_A* 3l9h_A* 1q0b_A* ... Length = 359 Back     alignment and structure
>3b6u_A Kinesin-like protein KIF3B; structural genomics consortium, motor domain, ADP, SGC, ATP-binding, coiled coil, microtubule, motor protein; HET: ADP; 1.80A {Homo sapiens} PDB: 3b6v_A* Length = 372 Back     alignment and structure
>3b6u_A Kinesin-like protein KIF3B; structural genomics consortium, motor domain, ADP, SGC, ATP-binding, coiled coil, microtubule, motor protein; HET: ADP; 1.80A {Homo sapiens} PDB: 3b6v_A* Length = 372 Back     alignment and structure
>2y65_A Kinesin, kinesin heavy chain; motor protein; HET: ADP; 2.20A {Drosophila melanogaster} PDB: 2y5w_A* Length = 365 Back     alignment and structure
>2y65_A Kinesin, kinesin heavy chain; motor protein; HET: ADP; 2.20A {Drosophila melanogaster} PDB: 2y5w_A* Length = 365 Back     alignment and structure
>1goj_A Kinesin, kinesin heavy chain; motor protein, ATPase; HET: ADP; 2.3A {Neurospora crassa} SCOP: c.37.1.9 Length = 355 Back     alignment and structure
>1goj_A Kinesin, kinesin heavy chain; motor protein, ATPase; HET: ADP; 2.3A {Neurospora crassa} SCOP: c.37.1.9 Length = 355 Back     alignment and structure
>2vvg_A Kinesin-2; motor protein, nucleotide-binding, microtubule, ATP-binding; HET: ADP; 1.60A {Giardia intestinalis} Length = 350 Back     alignment and structure
>2vvg_A Kinesin-2; motor protein, nucleotide-binding, microtubule, ATP-binding; HET: ADP; 1.60A {Giardia intestinalis} Length = 350 Back     alignment and structure
>4a14_A Kinesin, kinesin-like protein KIF7; motor protein, motor domain; HET: ADP; 1.60A {Homo sapiens} PDB: 2xt3_A* Length = 344 Back     alignment and structure
>4a14_A Kinesin, kinesin-like protein KIF7; motor protein, motor domain; HET: ADP; 1.60A {Homo sapiens} PDB: 2xt3_A* Length = 344 Back     alignment and structure
>3bfn_A Kinesin-like protein KIF22; limited proteolysis, structural genomics consortium domain, ADP, SGC, ATP-binding, DNA-binding, microtubule, MO protein; HET: ADP; 2.30A {Homo sapiens} Length = 388 Back     alignment and structure
>3bfn_A Kinesin-like protein KIF22; limited proteolysis, structural genomics consortium domain, ADP, SGC, ATP-binding, DNA-binding, microtubule, MO protein; HET: ADP; 2.30A {Homo sapiens} Length = 388 Back     alignment and structure
>3dc4_A Kinesin-like protein NOD; catalytic domain, ATPase, microtubule, ADP, nucleotide-binding protein, ATP-binding, coiled coil, motor protein; HET: ADP; 1.90A {Drosophila melanogaster} PDB: 3dcb_A* 3dco_N* 3pxn_A* Length = 344 Back     alignment and structure
>3dc4_A Kinesin-like protein NOD; catalytic domain, ATPase, microtubule, ADP, nucleotide-binding protein, ATP-binding, coiled coil, motor protein; HET: ADP; 1.90A {Drosophila melanogaster} PDB: 3dcb_A* 3dco_N* 3pxn_A* Length = 344 Back     alignment and structure
>1bg2_A Kinesin; motor protein, ATPase, microtubule associated; HET: ADP; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 2p4n_K* 1mkj_A* 2kin_A* 3kin_A* Length = 325 Back     alignment and structure
>1bg2_A Kinesin; motor protein, ATPase, microtubule associated; HET: ADP; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 2p4n_K* 1mkj_A* 2kin_A* 3kin_A* Length = 325 Back     alignment and structure
>1ry6_A Internal kinesin; kinesin motor domain, nucleotide-free, transport protein; 1.60A {Plasmodium falciparum} SCOP: c.37.1.9 Length = 360 Back     alignment and structure
>1ry6_A Internal kinesin; kinesin motor domain, nucleotide-free, transport protein; 1.60A {Plasmodium falciparum} SCOP: c.37.1.9 Length = 360 Back     alignment and structure
>1t5c_A CENP-E protein, centromeric protein E; kinesin motor-domain-ADP complex, stranded beta-sheet core with solvent exposed alpha-helices; HET: ADP PIN; 2.50A {Homo sapiens} Length = 349 Back     alignment and structure
>1t5c_A CENP-E protein, centromeric protein E; kinesin motor-domain-ADP complex, stranded beta-sheet core with solvent exposed alpha-helices; HET: ADP PIN; 2.50A {Homo sapiens} Length = 349 Back     alignment and structure
>1v8k_A Kinesin-like protein KIF2C; microtubule destabilizer, structural P; HET: ANP; 2.25A {Mus musculus} SCOP: c.37.1.9 PDB: 1v8j_A* 2gry_A* Length = 410 Back     alignment and structure
>1v8k_A Kinesin-like protein KIF2C; microtubule destabilizer, structural P; HET: ANP; 2.25A {Mus musculus} SCOP: c.37.1.9 PDB: 1v8j_A* 2gry_A* Length = 410 Back     alignment and structure
>2heh_A KIF2C protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, structural protein; HET: ADP; 2.15A {Homo sapiens} PDB: 3edl_D* Length = 387 Back     alignment and structure
>2heh_A KIF2C protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, structural protein; HET: ADP; 2.15A {Homo sapiens} PDB: 3edl_D* Length = 387 Back     alignment and structure
>3cob_A Kinesin heavy chain-like protein; motor, switch II, loop L11, conformation, nucleotide, ATP-binding, microtubule, motor protein; HET: ADP; 2.20A {Solanum tuberosum} SCOP: c.37.1.9 PDB: 3cnz_A* 1sdm_A* 3h4s_A* Length = 369 Back     alignment and structure
>3cob_A Kinesin heavy chain-like protein; motor, switch II, loop L11, conformation, nucleotide, ATP-binding, microtubule, motor protein; HET: ADP; 2.20A {Solanum tuberosum} SCOP: c.37.1.9 PDB: 3cnz_A* 1sdm_A* 3h4s_A* Length = 369 Back     alignment and structure
>2h58_A Kinesin-like protein KIFC3 variant; motor domain, ADP, structural genomics, structur Al genomics consortium, SGC; HET: ADP; 1.85A {Homo sapiens} Length = 330 Back     alignment and structure
>2h58_A Kinesin-like protein KIFC3 variant; motor domain, ADP, structural genomics, structur Al genomics consortium, SGC; HET: ADP; 1.85A {Homo sapiens} Length = 330 Back     alignment and structure
>3lre_A Kinesin-like protein KIF18A; motor protein, nucleotide binding, microtubule binding, ATP- cell projection, cytoskeleton, glycoprotein, microtubule; HET: ADP; 2.20A {Homo sapiens} Length = 355 Back     alignment and structure
>3lre_A Kinesin-like protein KIF18A; motor protein, nucleotide binding, microtubule binding, ATP- cell projection, cytoskeleton, glycoprotein, microtubule; HET: ADP; 2.20A {Homo sapiens} Length = 355 Back     alignment and structure
>2rep_A Kinesin-like protein KIFC1; structural genomics consortium, motor domain, ADP, binding, cell cycle, cell division, endosome, microtubule; HET: ADP; 2.60A {Homo sapiens} Length = 376 Back     alignment and structure
>2rep_A Kinesin-like protein KIFC1; structural genomics consortium, motor domain, ADP, binding, cell cycle, cell division, endosome, microtubule; HET: ADP; 2.60A {Homo sapiens} Length = 376 Back     alignment and structure
>3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* Length = 412 Back     alignment and structure
>3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* Length = 412 Back     alignment and structure
>2zfi_A Kinesin-like protein KIF1A, kinesin heavy chain isoform 5C; alpha and beta protein, enzyme, ATPase, P-loop, motor protein, ATP-binding, coiled coil; HET: ADP; 1.55A {Mus musculus} SCOP: c.37.1.9 PDB: 1vfw_A* 1vfx_A* 1vfz_A* 1vfv_A* 2zfj_A* 2zfk_A* 2zfl_A* 2zfm_A* 1i5s_A* 1i6i_A* 2hxf_C* 1ia0_K* 2hxh_C* Length = 366 Back     alignment and structure
>2zfi_A Kinesin-like protein KIF1A, kinesin heavy chain isoform 5C; alpha and beta protein, enzyme, ATPase, P-loop, motor protein, ATP-binding, coiled coil; HET: ADP; 1.55A {Mus musculus} SCOP: c.37.1.9 PDB: 1vfw_A* 1vfx_A* 1vfz_A* 1vfv_A* 2zfj_A* 2zfk_A* 2zfl_A* 2zfm_A* 1i5s_A* 1i6i_A* 2hxf_C* 1ia0_K* 2hxh_C* Length = 366 Back     alignment and structure
>3gbj_A KIF13B protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, ATP-binding, microtubule, motor protein; HET: ADP; 2.10A {Homo sapiens} Length = 354 Back     alignment and structure
>3gbj_A KIF13B protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, ATP-binding, microtubule, motor protein; HET: ADP; 2.10A {Homo sapiens} Length = 354 Back     alignment and structure
>2owm_A Nckin3-434, related to kinesin-like protein KIF1C; motor domain, ADP, NECK linker, motor PR; HET: ADP; 3.25A {Neurospora crassa} Length = 443 Back     alignment and structure
>2owm_A Nckin3-434, related to kinesin-like protein KIF1C; motor domain, ADP, NECK linker, motor PR; HET: ADP; 3.25A {Neurospora crassa} Length = 443 Back     alignment and structure
>1f9v_A Kinesin-like protein KAR3; kinesin-related protein, motor protein, microtubinding proteinbule, contractIle protein; HET: ADP; 1.30A {Saccharomyces cerevisiae} SCOP: c.37.1.9 PDB: 1f9t_A* 1f9w_A* 1f9u_A* 3kar_A* Length = 347 Back     alignment and structure
>1f9v_A Kinesin-like protein KAR3; kinesin-related protein, motor protein, microtubinding proteinbule, contractIle protein; HET: ADP; 1.30A {Saccharomyces cerevisiae} SCOP: c.37.1.9 PDB: 1f9t_A* 1f9w_A* 1f9u_A* 3kar_A* Length = 347 Back     alignment and structure
>4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} Length = 403 Back     alignment and structure
>4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} Length = 403 Back     alignment and structure
>3t0q_A AGR253WP; kinesin, alpha and beta proteins, P-loop containing nucleosi triphosphate hydrolases, microtubule motor protein; HET: ADP; 2.35A {Ashbya gossypii} Length = 349 Back     alignment and structure
>3t0q_A AGR253WP; kinesin, alpha and beta proteins, P-loop containing nucleosi triphosphate hydrolases, microtubule motor protein; HET: ADP; 2.35A {Ashbya gossypii} Length = 349 Back     alignment and structure
>2kin_B Kinesin; motor protein, cytoskeleton; HET: ADP; 2.00A {Rattus norvegicus} SCOP: c.37.1.9 Length = 100 Back     alignment and structure
>3kin_B Kinesin heavy chain; motor protein, cytoskeleton; HET: ADP; 3.10A {Rattus norvegicus} SCOP: c.37.1.9 Length = 117 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query583
1x88_A359 Kinesin-like protein KIF11; switch II, motor domai 100.0
2y65_A365 Kinesin, kinesin heavy chain; motor protein; HET: 100.0
3b6u_A372 Kinesin-like protein KIF3B; structural genomics co 100.0
2wbe_C373 Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mit 100.0
3bfn_A388 Kinesin-like protein KIF22; limited proteolysis, s 100.0
3cob_A369 Kinesin heavy chain-like protein; motor, switch II 100.0
2vvg_A350 Kinesin-2; motor protein, nucleotide-binding, micr 100.0
1t5c_A349 CENP-E protein, centromeric protein E; kinesin mot 100.0
1goj_A355 Kinesin, kinesin heavy chain; motor protein, ATPas 100.0
2zfi_A366 Kinesin-like protein KIF1A, kinesin heavy chain is 100.0
1bg2_A325 Kinesin; motor protein, ATPase, microtubule associ 100.0
2owm_A443 Nckin3-434, related to kinesin-like protein KIF1C; 100.0
3lre_A355 Kinesin-like protein KIF18A; motor protein, nucleo 100.0
4a14_A344 Kinesin, kinesin-like protein KIF7; motor protein, 100.0
3nwn_A359 Kinesin-like protein KIF9; motor domain, ADP, stru 100.0
2h58_A330 Kinesin-like protein KIFC3 variant; motor domain, 100.0
2nr8_A358 Kinesin-like protein KIF9; motor domain, ADP, stru 100.0
1f9v_A347 Kinesin-like protein KAR3; kinesin-related protein 100.0
3t0q_A349 AGR253WP; kinesin, alpha and beta proteins, P-loop 100.0
2rep_A376 Kinesin-like protein KIFC1; structural genomics co 100.0
3gbj_A354 KIF13B protein; kinesin, motor domain, ADP, struct 100.0
1ry6_A360 Internal kinesin; kinesin motor domain, nucleotide 100.0
2heh_A387 KIF2C protein; kinesin, motor domain, ADP, structu 100.0
4etp_A403 Kinesin-like protein KAR3; kinesin motor protein, 100.0
1v8k_A410 Kinesin-like protein KIF2C; microtubule destabiliz 100.0
3u06_A412 Protein claret segregational; motor domain, stalk 100.0
3dc4_A344 Kinesin-like protein NOD; catalytic domain, ATPase 100.0
4h1g_A715 Maltose binding protein-cakar3 motor domain fusio; 100.0
2wbe_C 373 Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mit 100.0
3bfn_A 388 Kinesin-like protein KIF22; limited proteolysis, s 100.0
1bg2_A 325 Kinesin; motor protein, ATPase, microtubule associ 100.0
3b6u_A 372 Kinesin-like protein KIF3B; structural genomics co 100.0
3lre_A 355 Kinesin-like protein KIF18A; motor protein, nucleo 100.0
2vvg_A 350 Kinesin-2; motor protein, nucleotide-binding, micr 100.0
2heh_A 387 KIF2C protein; kinesin, motor domain, ADP, structu 100.0
1v8k_A 410 Kinesin-like protein KIF2C; microtubule destabiliz 100.0
1x88_A 359 Kinesin-like protein KIF11; switch II, motor domai 100.0
1t5c_A 349 CENP-E protein, centromeric protein E; kinesin mot 100.0
2zfi_A 366 Kinesin-like protein KIF1A, kinesin heavy chain is 100.0
2y65_A 365 Kinesin, kinesin heavy chain; motor protein; HET: 100.0
1goj_A 355 Kinesin, kinesin heavy chain; motor protein, ATPas 100.0
2owm_A 443 Nckin3-434, related to kinesin-like protein KIF1C; 100.0
4a14_A 344 Kinesin, kinesin-like protein KIF7; motor protein, 100.0
3gbj_A 354 KIF13B protein; kinesin, motor domain, ADP, struct 100.0
3cob_A 369 Kinesin heavy chain-like protein; motor, switch II 100.0
1ry6_A 360 Internal kinesin; kinesin motor domain, nucleotide 100.0
3u06_A 412 Protein claret segregational; motor domain, stalk 100.0
2h58_A 330 Kinesin-like protein KIFC3 variant; motor domain, 100.0
3t0q_A 349 AGR253WP; kinesin, alpha and beta proteins, P-loop 100.0
1f9v_A 347 Kinesin-like protein KAR3; kinesin-related protein 100.0
2rep_A 376 Kinesin-like protein KIFC1; structural genomics co 100.0
3nwn_A 359 Kinesin-like protein KIF9; motor domain, ADP, stru 100.0
4etp_A 403 Kinesin-like protein KAR3; kinesin motor protein, 100.0
3dc4_A 344 Kinesin-like protein NOD; catalytic domain, ATPase 100.0
2nr8_A 358 Kinesin-like protein KIF9; motor domain, ADP, stru 100.0
4h1g_A 715 Maltose binding protein-cakar3 motor domain fusio; 100.0
2kin_B100 Kinesin; motor protein, cytoskeleton; HET: ADP; 2. 99.97
3kin_B117 Kinesin heavy chain; motor protein, cytoskeleton; 99.95
2o0a_A298 S.cerevisiae chromosome XVI reading frame ORF YPL2 99.82
2o0a_A298 S.cerevisiae chromosome XVI reading frame ORF YPL2 99.74
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 90.8
3ec2_A180 DNA replication protein DNAC; helicase loader, rep 87.34
2w58_A202 DNAI, primosome component (helicase loader); ATP-b 85.27
2qgz_A308 Helicase loader, putative primosome component; str 82.66
1jbk_A195 CLPB protein; beta barrel, chaperone; 1.80A {Esche 80.66
2qgz_A308 Helicase loader, putative primosome component; str 80.51
>1x88_A Kinesin-like protein KIF11; switch II, motor domain, NECK linker, cell cycle; HET: ADP NAT; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 3hqd_A* 3ken_A* 2pg2_A* 1yrs_A* 2fme_A* 2g1q_A* 2gm1_A* 1ii6_A* 2uyi_A* 2uym_A* 2wog_A* 2x2r_A* 2x7c_A* 2x7d_A* 2x7e_A* 2xae_A* 3k3b_A* 3k5e_A* 3l9h_A* 1q0b_A* ... Back     alignment and structure
Probab=100.00  E-value=1.1e-83  Score=671.89  Aligned_cols=305  Identities=68%  Similarity=1.067  Sum_probs=262.6

Q ss_pred             eeeeeehhhcccCCceEEEeehhhhhhHHHHhcccceeEEEeeccCCCceEEeecccCCCCCCCcccCCCCccchhhhhH
Q psy9448          13 MVVSVMFLVCIFYTTIVDVYKYVVNPLIDEVLSGYNCTVFAYGQTGTGKTFTMEGEKSNDPSISWQDDPLSGIVPRAMNH   92 (583)
Q Consensus        13 ~~~~~~D~Vf~~~~tq~~vy~~~~~plv~~~l~G~n~~i~ayGqtgSGKT~Tm~G~~~~~~~~~~~~~~~~Giipr~~~~   92 (583)
                      ...|.||+||+++++|++||+.+++|+|+++++|||+||||||||||||||||+|....+....+..++..|||||++++
T Consensus        54 ~~~f~FD~Vf~~~~~Q~~Vy~~~~~plv~~~l~G~n~tifAYGqTGSGKTyTM~G~~~~~~~~~~~~~~~~Giipr~~~~  133 (359)
T 1x88_A           54 RKTYTFDMVFGASTKQIDVYRSVVCPILDEVIMGYNCTIFAYGQTGTGKTFTMEGERSPNEEYTWEEDPLAGIIPRTLHQ  133 (359)
T ss_dssp             EEEEECSEEECTTCCHHHHHHHHHHHHHHHHHTTCEEEEEEEECTTSSHHHHHTBCCCGGGCSCGGGCTTBCHHHHHHHH
T ss_pred             ceEEeceEEEeccCchhHHHHHHHHHhHHHHhCCCceEEEEeCCCCCCCceEEeccCCccccccccccccCCchHHHHHH
Confidence            45678999999999999999999999999999999999999999999999999998654333344445567999999999


Q ss_pred             HHHHHhhccceeEEEEEeehhhchHHhhhhcCCCCcc-ceEEeeeccccccceEEeccceeeecchhHHHHHHHhcchhh
Q psy9448          93 LFDELRLLGDAEFTVRVSFLEIYNEELIDLLSPTDDI-TKLRLFEDSARKGSVIIQGLEEKAVHNKDEVYKILEKGSQKR  171 (583)
Q Consensus        93 lf~~~~~~~~~~~~v~vS~~EIyne~v~DLL~~~~~~-~~l~i~~~~~~~~~~~v~~l~~~~v~s~~e~~~ll~~g~~~R  171 (583)
                      ||+.++. .+.+|.|+|||+|||||+|+|||+|.... ..+++++++..+++++|+|++++.|.|++|++++|..|.++|
T Consensus       134 lF~~i~~-~~~~~~v~vS~~EIYnE~i~DLL~~~~~~~~~l~i~~~~~~~~~v~v~gl~~~~v~s~~e~~~ll~~g~~~R  212 (359)
T 1x88_A          134 IFEKLTD-NGTEFSVKVSLLEIYNEELFDLLNPSSDVSERLQMFDDPRNKRGVIIKGLEEITVHNKDEVYQILEKGAAKR  212 (359)
T ss_dssp             HHHHTSS-SSEEEEEEEEEEEEETTEEEETTCTTSCTTCCBEEEEETTEEEEEEEETCCCEEECSGGGHHHHHHHHHHHH
T ss_pred             HHHHHhc-cCceEEEEEEEEEEeCceeeehhcccccccccceEEeccCCCCCEEEcCCEEEEcCCHHHHHHHHHHHHhhc
Confidence            9999876 56789999999999999999999986543 568899988667899999999999999999999999999999


Q ss_pred             hhHHHHhhhcccCceeEEEEEEEeecCCCChhhHhhccCceeeeccCCcccCccchhhhhhhhhcCcchhhhhhhhHHHH
Q psy9448         172 QTAATLMNAHSSRSHTIFTITIHIKDNSLDGEELLRTGKLNLVDLAGSENIGRSGAQDKRAREAGNINQSLLTLGRCITA  251 (583)
Q Consensus       172 ~~~~t~~n~~SSRSH~i~~i~i~~~~~~~~~~~~~~~s~L~~VDLAGsEr~~~~~~~~~~~~E~~~In~SL~~L~~vi~a  251 (583)
                      ++++|.||..|||||+||+|+|+......++......|+|+|||||||||..++++.|.|++|+.+||+||++||+||.+
T Consensus       213 ~~~~T~~N~~SSRSH~if~i~i~~~~~~~~~~~~~~~skL~lVDLAGSEr~~~t~~~g~rl~E~~~INkSL~aLg~vI~a  292 (359)
T 1x88_A          213 TTAATLMNAYSSRSHSVFSVTIHMKETTIDGEELVKIGKLNLVDLAGSENIGRSGAVDKRAREAGNINQSLLTLGRVITA  292 (359)
T ss_dssp             HHHHHHSTTHHHHCEEEEEEEEEEEEECTTSCEEEEEEEEEEEECCCCCC---------------CCCHHHHHHHHHHHH
T ss_pred             ccccccCCCCCCCccEEEEEEEEEecccCCCCceEEEEEEEEEcCCCCCcccccCCcccchHHHhhhhHHHHHHHHHHHH
Confidence            99999999999999999999998765444444555679999999999999999999999999999999999999999999


Q ss_pred             HhhhCCCCCcchhhHhHHhhhhcCCcceeeEEEEeCccccchhhhhhhhhhhhhhccCCCchhhhhh
Q psy9448         252 LVEKTPHIPYRESKLTRLLQDSLGGRTKTSIIATVSPAQLNMEETLSTLDYAHRAKNITNRPEINQK  318 (583)
Q Consensus       252 L~~~~~~ipyR~SkLT~lL~d~Lggn~~t~~I~~vsp~~~~~~eTl~TL~fa~r~k~i~n~~~~n~~  318 (583)
                      |+++..||||||||||+||||+||||++|+||+||||+..+++||++||+||+|||+|+|+|.+|++
T Consensus       293 L~~~~~hvPyRdSkLT~lLqdsLgGnskt~mIa~vsP~~~~~~ETl~TLrfA~rak~I~n~p~vn~~  359 (359)
T 1x88_A          293 LVERTPHVPYRESKLTRILQDSLGGRTRTSIIATISPASLNLEETLSTLEYAHRAKNILNKPEVNQK  359 (359)
T ss_dssp             HHTTCSCCCGGGSHHHHHTGGGSSSSSEEEEEEEECCCGGGHHHHHHHHHHHHHHTTCCCCCC----
T ss_pred             HhcCCCCCccccchHHHHHHHHhCCCCeEEEEEEECCCcccHHHHHHHHHHHHHHhhccCcceeCCC
Confidence            9999999999999999999999999999999999999999999999999999999999999999973
>2y65_A Kinesin, kinesin heavy chain; motor protein; HET: ADP; 2.20A {Drosophila melanogaster} PDB: 2y5w_A* Back     alignment and structure
>3b6u_A Kinesin-like protein KIF3B; structural genomics consortium, motor domain, ADP, SGC, ATP-binding, coiled coil, microtubule, motor protein; HET: ADP; 1.80A {Homo sapiens} PDB: 3b6v_A* Back     alignment and structure
>2wbe_C Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mitosis, GTP-binding, motor protein, cell division, cell cycle, microtubule, ATP-binding; HET: GTP ANP GDP TA1; 9.40A {Drosophila melanogaster} Back     alignment and structure
>3bfn_A Kinesin-like protein KIF22; limited proteolysis, structural genomics consortium domain, ADP, SGC, ATP-binding, DNA-binding, microtubule, MO protein; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>3cob_A Kinesin heavy chain-like protein; motor, switch II, loop L11, conformation, nucleotide, ATP-binding, microtubule, motor protein; HET: ADP; 2.20A {Solanum tuberosum} SCOP: c.37.1.9 PDB: 3cnz_A* 1sdm_A* 3h4s_A* Back     alignment and structure
>2vvg_A Kinesin-2; motor protein, nucleotide-binding, microtubule, ATP-binding; HET: ADP; 1.60A {Giardia intestinalis} Back     alignment and structure
>1t5c_A CENP-E protein, centromeric protein E; kinesin motor-domain-ADP complex, stranded beta-sheet core with solvent exposed alpha-helices; HET: ADP PIN; 2.50A {Homo sapiens} Back     alignment and structure
>1goj_A Kinesin, kinesin heavy chain; motor protein, ATPase; HET: ADP; 2.3A {Neurospora crassa} SCOP: c.37.1.9 Back     alignment and structure
>2zfi_A Kinesin-like protein KIF1A, kinesin heavy chain isoform 5C; alpha and beta protein, enzyme, ATPase, P-loop, motor protein, ATP-binding, coiled coil; HET: ADP; 1.55A {Mus musculus} SCOP: c.37.1.9 PDB: 1vfw_A* 1vfx_A* 1vfz_A* 1vfv_A* 2zfj_A* 2zfk_A* 2zfl_A* 2zfm_A* 1i5s_A* 1i6i_A* 2hxf_C* 1ia0_K* 2hxh_C* Back     alignment and structure
>1bg2_A Kinesin; motor protein, ATPase, microtubule associated; HET: ADP; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 2p4n_K* 1mkj_A* 2kin_A* 3kin_A* Back     alignment and structure
>2owm_A Nckin3-434, related to kinesin-like protein KIF1C; motor domain, ADP, NECK linker, motor PR; HET: ADP; 3.25A {Neurospora crassa} Back     alignment and structure
>3lre_A Kinesin-like protein KIF18A; motor protein, nucleotide binding, microtubule binding, ATP- cell projection, cytoskeleton, glycoprotein, microtubule; HET: ADP; 2.20A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>4a14_A Kinesin, kinesin-like protein KIF7; motor protein, motor domain; HET: ADP; 1.60A {Homo sapiens} SCOP: c.37.1.0 PDB: 2xt3_A* Back     alignment and structure
>3nwn_A Kinesin-like protein KIF9; motor domain, ADP, structural genomics, structural consortium, SGC, contractIle protein; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>2h58_A Kinesin-like protein KIFC3 variant; motor domain, ADP, structural genomics, structur Al genomics consortium, SGC; HET: ADP; 1.85A {Homo sapiens} Back     alignment and structure
>1f9v_A Kinesin-like protein KAR3; kinesin-related protein, motor protein, microtubinding proteinbule, contractIle protein; HET: ADP; 1.30A {Saccharomyces cerevisiae} SCOP: c.37.1.9 PDB: 1f9t_A* 1f9w_A* 1f9u_A* 3kar_A* Back     alignment and structure
>3t0q_A AGR253WP; kinesin, alpha and beta proteins, P-loop containing nucleosi triphosphate hydrolases, microtubule motor protein; HET: ADP; 2.35A {Ashbya gossypii} Back     alignment and structure
>2rep_A Kinesin-like protein KIFC1; structural genomics consortium, motor domain, ADP, binding, cell cycle, cell division, endosome, microtubule; HET: ADP; 2.60A {Homo sapiens} Back     alignment and structure
>3gbj_A KIF13B protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, ATP-binding, microtubule, motor protein; HET: ADP; 2.10A {Homo sapiens} SCOP: c.37.1.9 Back     alignment and structure
>1ry6_A Internal kinesin; kinesin motor domain, nucleotide-free, transport protein; 1.60A {Plasmodium falciparum} SCOP: c.37.1.9 Back     alignment and structure
>2heh_A KIF2C protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, structural protein; HET: ADP; 2.15A {Homo sapiens} PDB: 3edl_D* Back     alignment and structure
>4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1v8k_A Kinesin-like protein KIF2C; microtubule destabilizer, structural P; HET: ANP; 2.25A {Mus musculus} SCOP: c.37.1.9 PDB: 1v8j_A* 2gry_A* Back     alignment and structure
>3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* Back     alignment and structure
>3dc4_A Kinesin-like protein NOD; catalytic domain, ATPase, microtubule, ADP, nucleotide-binding protein, ATP-binding, coiled coil, motor protein; HET: ADP; 1.90A {Drosophila melanogaster} PDB: 3dcb_A* 3dco_N* 3pxn_A* Back     alignment and structure
>4h1g_A Maltose binding protein-cakar3 motor domain fusio; kinesin motor domain, motor protein, chimera; HET: MTT ADP EDO; 2.15A {Escherichia coli} Back     alignment and structure
>2wbe_C Bipolar kinesin KRP-130; EG5, KLP61F, tubulin, mitosis, GTP-binding, motor protein, cell division, cell cycle, microtubule, ATP-binding; HET: GTP ANP GDP TA1; 9.40A {Drosophila melanogaster} Back     alignment and structure
>3bfn_A Kinesin-like protein KIF22; limited proteolysis, structural genomics consortium domain, ADP, SGC, ATP-binding, DNA-binding, microtubule, MO protein; HET: ADP; 2.30A {Homo sapiens} Back     alignment and structure
>1bg2_A Kinesin; motor protein, ATPase, microtubule associated; HET: ADP; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 2p4n_K* 1mkj_A* 2kin_A* 3kin_A* Back     alignment and structure
>3b6u_A Kinesin-like protein KIF3B; structural genomics consortium, motor domain, ADP, SGC, ATP-binding, coiled coil, microtubule, motor protein; HET: ADP; 1.80A {Homo sapiens} PDB: 3b6v_A* Back     alignment and structure
>3lre_A Kinesin-like protein KIF18A; motor protein, nucleotide binding, microtubule binding, ATP- cell projection, cytoskeleton, glycoprotein, microtubule; HET: ADP; 2.20A {Homo sapiens} SCOP: c.37.1.0 Back     alignment and structure
>2vvg_A Kinesin-2; motor protein, nucleotide-binding, microtubule, ATP-binding; HET: ADP; 1.60A {Giardia intestinalis} Back     alignment and structure
>2heh_A KIF2C protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, structural protein; HET: ADP; 2.15A {Homo sapiens} PDB: 3edl_D* Back     alignment and structure
>1v8k_A Kinesin-like protein KIF2C; microtubule destabilizer, structural P; HET: ANP; 2.25A {Mus musculus} SCOP: c.37.1.9 PDB: 1v8j_A* 2gry_A* Back     alignment and structure
>1x88_A Kinesin-like protein KIF11; switch II, motor domain, NECK linker, cell cycle; HET: ADP NAT; 1.80A {Homo sapiens} SCOP: c.37.1.9 PDB: 3hqd_A* 3ken_A* 2pg2_A* 1yrs_A* 2fme_A* 2g1q_A* 2gm1_A* 1ii6_A* 2uyi_A* 2uym_A* 2wog_A* 2x2r_A* 2x7c_A* 2x7d_A* 2x7e_A* 2xae_A* 3k3b_A* 3k5e_A* 3l9h_A* 1q0b_A* ... Back     alignment and structure
>1t5c_A CENP-E protein, centromeric protein E; kinesin motor-domain-ADP complex, stranded beta-sheet core with solvent exposed alpha-helices; HET: ADP PIN; 2.50A {Homo sapiens} Back     alignment and structure
>2zfi_A Kinesin-like protein KIF1A, kinesin heavy chain isoform 5C; alpha and beta protein, enzyme, ATPase, P-loop, motor protein, ATP-binding, coiled coil; HET: ADP; 1.55A {Mus musculus} SCOP: c.37.1.9 PDB: 1vfw_A* 1vfx_A* 1vfz_A* 1vfv_A* 2zfj_A* 2zfk_A* 2zfl_A* 2zfm_A* 1i5s_A* 1i6i_A* 2hxf_C* 1ia0_K* 2hxh_C* Back     alignment and structure
>2y65_A Kinesin, kinesin heavy chain; motor protein; HET: ADP; 2.20A {Drosophila melanogaster} PDB: 2y5w_A* Back     alignment and structure
>1goj_A Kinesin, kinesin heavy chain; motor protein, ATPase; HET: ADP; 2.3A {Neurospora crassa} SCOP: c.37.1.9 Back     alignment and structure
>2owm_A Nckin3-434, related to kinesin-like protein KIF1C; motor domain, ADP, NECK linker, motor PR; HET: ADP; 3.25A {Neurospora crassa} Back     alignment and structure
>4a14_A Kinesin, kinesin-like protein KIF7; motor protein, motor domain; HET: ADP; 1.60A {Homo sapiens} SCOP: c.37.1.0 PDB: 2xt3_A* Back     alignment and structure
>3gbj_A KIF13B protein; kinesin, motor domain, ADP, structural genomics, structural genomics consortium, SGC, ATP-binding, microtubule, motor protein; HET: ADP; 2.10A {Homo sapiens} SCOP: c.37.1.9 Back     alignment and structure
>3cob_A Kinesin heavy chain-like protein; motor, switch II, loop L11, conformation, nucleotide, ATP-binding, microtubule, motor protein; HET: ADP; 2.20A {Solanum tuberosum} SCOP: c.37.1.9 PDB: 3cnz_A* 1sdm_A* 3h4s_A* Back     alignment and structure
>1ry6_A Internal kinesin; kinesin motor domain, nucleotide-free, transport protein; 1.60A {Plasmodium falciparum} SCOP: c.37.1.9 Back     alignment and structure
>3u06_A Protein claret segregational; motor domain, stalk rotation, power stroke, kinesin-14, MICR binding, NCD, transport, molecular motor; HET: ADP GOL; 2.35A {Drosophila melanogaster} PDB: 2ncd_A* 1n6m_A* 1cz7_A* 3l1c_A* Back     alignment and structure
>2h58_A Kinesin-like protein KIFC3 variant; motor domain, ADP, structural genomics, structur Al genomics consortium, SGC; HET: ADP; 1.85A {Homo sapiens} Back     alignment and structure
>3t0q_A AGR253WP; kinesin, alpha and beta proteins, P-loop containing nucleosi triphosphate hydrolases, microtubule motor protein; HET: ADP; 2.35A {Ashbya gossypii} Back     alignment and structure
>1f9v_A Kinesin-like protein KAR3; kinesin-related protein, motor protein, microtubinding proteinbule, contractIle protein; HET: ADP; 1.30A {Saccharomyces cerevisiae} SCOP: c.37.1.9 PDB: 1f9t_A* 1f9w_A* 1f9u_A* 3kar_A* Back     alignment and structure
>2rep_A Kinesin-like protein KIFC1; structural genomics consortium, motor domain, ADP, binding, cell cycle, cell division, endosome, microtubule; HET: ADP; 2.60A {Homo sapiens} Back     alignment and structure
>3nwn_A Kinesin-like protein KIF9; motor domain, ADP, structural genomics, structural consortium, SGC, contractIle protein; HET: ADP; 2.00A {Homo sapiens} Back     alignment and structure
>4etp_A Kinesin-like protein KAR3; kinesin motor protein, kinesin motor homology domain, karyog mitosis, microtubules; HET: ADP EBC; 2.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3dc4_A Kinesin-like protein NOD; catalytic domain, ATPase, microtubule, ADP, nucleotide-binding protein, ATP-binding, coiled coil, motor protein; HET: ADP; 1.90A {Drosophila melanogaster} PDB: 3dcb_A* 3dco_N* 3pxn_A* Back     alignment and structure
>4h1g_A Maltose binding protein-cakar3 motor domain fusio; kinesin motor domain, motor protein, chimera; HET: MTT ADP EDO; 2.15A {Escherichia coli} Back     alignment and structure
>2kin_B Kinesin; motor protein, cytoskeleton; HET: ADP; 2.00A {Rattus norvegicus} SCOP: c.37.1.9 Back     alignment and structure
>3kin_B Kinesin heavy chain; motor protein, cytoskeleton; HET: ADP; 3.10A {Rattus norvegicus} SCOP: c.37.1.9 Back     alignment and structure
>2o0a_A S.cerevisiae chromosome XVI reading frame ORF YPL253C; VIK1, motor homology domain, kinesin, motor domain, microtubule-binding; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2o0a_A S.cerevisiae chromosome XVI reading frame ORF YPL253C; VIK1, motor homology domain, kinesin, motor domain, microtubule-binding; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>3ec2_A DNA replication protein DNAC; helicase loader, replication initiation factor, ATP-binding, nucleotide-binding; HET: DNA ADP; 2.70A {Aquifex aeolicus} PDB: 3ecc_A* Back     alignment and structure
>2w58_A DNAI, primosome component (helicase loader); ATP-binding, nucleotide-binding, hydrolase; HET: ADP; 2.50A {Geobacillus kaustophilus HTA426} Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure
>1jbk_A CLPB protein; beta barrel, chaperone; 1.80A {Escherichia coli} SCOP: c.37.1.20 Back     alignment and structure
>2qgz_A Helicase loader, putative primosome component; structural genomics, PSI-2, protein structure initiative; 2.40A {Streptococcus pyogenes serotype M3} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 583
d1x88a1345 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), 1e-85
d1x88a1 345 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), 3e-30
d1bg2a_323 c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId 3e-73
d1bg2a_323 c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId 2e-26
d1goja_354 c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5 5e-69
d1goja_ 354 c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5 2e-24
d2zfia1349 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), 1e-67
d2zfia1 349 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), 6e-22
d1ry6a_330 c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodiu 5e-66
d1ry6a_330 c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodiu 6e-25
d1v8ka_362 c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c 5e-65
d1v8ka_362 c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c 2e-21
d1f9va_342 c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjun 5e-61
d1f9va_ 342 c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjun 6e-17
d2ncda_368 c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjun 1e-58
d2ncda_368 c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjun 4e-17
d1sdma_364 c.37.1.9 (A:) Kinesin heavy chain-like protein {Po 3e-58
d1sdma_ 364 c.37.1.9 (A:) Kinesin heavy chain-like protein {Po 6e-18
>d1x88a1 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]} Length = 345 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Motor proteins
domain: Kinesin
species: Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]

 Score =  267 bits (684), Expect = 1e-85
 Identities = 202/288 (70%), Positives = 250/288 (86%), Gaps = 2/288 (0%)

Query: 26  TTIVDVYKYVVNPLIDEVLSGYNCTVFAYGQTGTGKTFTMEGEKSNDPSISWQDDPLSGI 85
           T  +DVY+ VV P++DEV+ GYNCT+FAYGQTGTGKTFTMEGE+S +   +W++DPL+GI
Sbjct: 59  TKQIDVYRSVVCPILDEVIMGYNCTIFAYGQTGTGKTFTMEGERSPNEEYTWEEDPLAGI 118

Query: 86  VPRAMNHLFDELRLLGDAEFTVRVSFLEIYNEELIDLLSPTDDIT-KLRLFEDSARKGSV 144
           +PR ++ +F E       EF+V+VS LEIYNEEL DLL+P+ D++ +L++F+D   K  V
Sbjct: 119 IPRTLHQIF-EKLTDNGTEFSVKVSLLEIYNEELFDLLNPSSDVSERLQMFDDPRNKRGV 177

Query: 145 IIQGLEEKAVHNKDEVYKILEKGSQKRQTAATLMNAHSSRSHTIFTITIHIKDNSLDGEE 204
           II+GLEE  VHNKDEVY+ILEKG+ KR TAATLMNA+SSRSH++F++TIH+K+ ++DGEE
Sbjct: 178 IIKGLEEITVHNKDEVYQILEKGAAKRTTAATLMNAYSSRSHSVFSVTIHMKETTIDGEE 237

Query: 205 LLRTGKLNLVDLAGSENIGRSGAQDKRAREAGNINQSLLTLGRCITALVEKTPHIPYRES 264
           L++ GKLNLVDLAGSENIGRSGA DKRAREAGNINQSLLTLGR ITALVE+TPH+PYRES
Sbjct: 238 LVKIGKLNLVDLAGSENIGRSGAVDKRAREAGNINQSLLTLGRVITALVERTPHVPYRES 297

Query: 265 KLTRLLQDSLGGRTKTSIIATVSPAQLNMEETLSTLDYAHRAKNITNR 312
           KLTR+LQDSLGGRT+TSIIAT+SPA LN+EETLSTL+YAHRAKNI N+
Sbjct: 298 KLTRILQDSLGGRTRTSIIATISPASLNLEETLSTLEYAHRAKNILNK 345
>d1x88a1 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]} Length = 345 Back     information, alignment and structure
>d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} Length = 323 Back     information, alignment and structure
>d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} Length = 354 Back     information, alignment and structure
>d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} Length = 354 Back     information, alignment and structure
>d2zfia1 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]} Length = 349 Back     information, alignment and structure
>d2zfia1 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]} Length = 349 Back     information, alignment and structure
>d1ry6a_ c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 330 Back     information, alignment and structure
>d1ry6a_ c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 330 Back     information, alignment and structure
>d1v8ka_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090]} Length = 362 Back     information, alignment and structure
>d1v8ka_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090]} Length = 362 Back     information, alignment and structure
>d1f9va_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d1f9va_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId: 4932]} Length = 342 Back     information, alignment and structure
>d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 368 Back     information, alignment and structure
>d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 368 Back     information, alignment and structure
>d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]} Length = 364 Back     information, alignment and structure
>d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]} Length = 364 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query583
d1sdma_364 Kinesin heavy chain-like protein {Potato (Solanum 100.0
d1x88a1345 Kinesin {Human (Homo sapiens), mitotic kinesin eg5 100.0
d1goja_354 Kinesin {Neurospora crassa [TaxId: 5141]} 100.0
d1v8ka_362 Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090 100.0
d1bg2a_323 Kinesin {Human (Homo sapiens) [TaxId: 9606]} 100.0
d2zfia1349 Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090 100.0
d1ry6a_330 Kinesin {Malaria parasite (Plasmodium falciparum) 100.0
d1f9va_342 Kinesin motor Ncd (non-claret disjunctional) {Bake 100.0
d2ncda_368 Kinesin motor Ncd (non-claret disjunctional) {Frui 100.0
d1v8ka_ 362 Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090 100.0
d2zfia1 349 Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090 100.0
d1x88a1 345 Kinesin {Human (Homo sapiens), mitotic kinesin eg5 100.0
d1sdma_ 364 Kinesin heavy chain-like protein {Potato (Solanum 100.0
d1ry6a_ 330 Kinesin {Malaria parasite (Plasmodium falciparum) 100.0
d1goja_ 354 Kinesin {Neurospora crassa [TaxId: 5141]} 100.0
d1bg2a_ 323 Kinesin {Human (Homo sapiens) [TaxId: 9606]} 100.0
d2ncda_ 368 Kinesin motor Ncd (non-claret disjunctional) {Frui 100.0
d1f9va_ 342 Kinesin motor Ncd (non-claret disjunctional) {Bake 100.0
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 88.84
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 85.44
d1gvnb_273 Plasmid maintenance system epsilon/zeta, toxin zet 84.77
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 84.73
d1r7ra3265 Membrane fusion ATPase VCP/p97 {Mouse (Mus musculu 83.74
d1p9ra_401 Extracellular secretion NTPase EpsE {Vibrio choler 83.73
d1l8qa2213 Chromosomal replication initiation factor DnaA {Aq 80.97
d1w5sa2287 CDC6-like protein APE0152, N-terminal domain {Aero 80.92
>d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: P-loop containing nucleoside triphosphate hydrolases
superfamily: P-loop containing nucleoside triphosphate hydrolases
family: Motor proteins
domain: Kinesin heavy chain-like protein
species: Potato (Solanum tuberosum) [TaxId: 4113]

Probab=100.00  E-value=1.2e-74  Score=606.95  Aligned_cols=307  Identities=37%  Similarity=0.578  Sum_probs=266.8

Q ss_pred             eeeeeehhhcccCCceEEEeehhhhhhHHHHhcccceeEEEeeccCCCceEEeecccCCCCCCCcccCCCCccchhhhhH
Q psy9448          13 MVVSVMFLVCIFYTTIVDVYKYVVNPLIDEVLSGYNCTVFAYGQTGTGKTFTMEGEKSNDPSISWQDDPLSGIVPRAMNH   92 (583)
Q Consensus        13 ~~~~~~D~Vf~~~~tq~~vy~~~~~plv~~~l~G~n~~i~ayGqtgSGKT~Tm~G~~~~~~~~~~~~~~~~Giipr~~~~   92 (583)
                      ...|.||+||+++++|++||+.+ .|+|+++++|+|+||||||||||||||||+|+...           +||+||++++
T Consensus        41 ~~~f~FD~vf~~~~~q~~vy~~v-~~lv~~~l~G~n~~i~aYGqTGSGKTyTm~G~~~~-----------~Giipr~~~~  108 (364)
T d1sdma_          41 AKQHMYDRVFDGNATQDDVFEDT-KYLVQSAVDGYNVCIFAYGQTGSGKTFTIYGADSN-----------PGLTPRAMSE  108 (364)
T ss_dssp             EEEEECSEEECTTCCHHHHHHTT-THHHHHHHTTCEEEEEEECSTTSSHHHHHTBCSSS-----------BCHHHHHHHH
T ss_pred             ceEEECCeecCCCCCHHHHHHHH-HHHHHHHhcCCceeeeccccCCCCcccccccCccc-----------cchhHHHHHH
Confidence            46778999999999999999975 89999999999999999999999999999998653           4999999999


Q ss_pred             HHHHHhhcc-ceeEEEEEeehhhchHHhhhhcCCCCcc-ceEEeeeccccccceEEeccceeeecchhHHHHHHHhcchh
Q psy9448          93 LFDELRLLG-DAEFTVRVSFLEIYNEELIDLLSPTDDI-TKLRLFEDSARKGSVIIQGLEEKAVHNKDEVYKILEKGSQK  170 (583)
Q Consensus        93 lf~~~~~~~-~~~~~v~vS~~EIyne~v~DLL~~~~~~-~~l~i~~~~~~~~~~~v~~l~~~~v~s~~e~~~ll~~g~~~  170 (583)
                      ||..+.... ..+|.|++||+|||||+++|||.|.... ..+.+.+++  .++++|+|++++.|.+.+|++.+|..|.++
T Consensus       109 lf~~i~~~~~~~~~~v~~S~~EIyne~i~DLL~~~~~~~~~l~~~~~~--~~~~~v~~l~~~~v~s~~~~~~~l~~g~~~  186 (364)
T d1sdma_         109 LFRIMKKDSNKFSFSLKAYMVELYQDTLVDLLLPKQAKRLKLDIKKDS--KGMVSVENVTVVSISTYEELKTIIQRGSEQ  186 (364)
T ss_dssp             HHHHHHHGGGTEEEEEEEEEEEESSSCEEETTSCTTSCCCCCEEEECT--TSCEEEETCCCEEECSHHHHHHHHHHHHHH
T ss_pred             HHhhhhhccccccceEEEEEEEEeccccccccCcccccccccceeecc--cCccccccceeeeeCCHHHHHHHhhcccee
Confidence            999998754 4789999999999999999999886543 356777776  678999999999999999999999999999


Q ss_pred             hhhHHHHhhhcccCceeEEEEEEEeecCCCChhhHhhccCceeeeccCCcccCccchhhhhhhhhcCcchhhhhhhhHHH
Q psy9448         171 RQTAATLMNAHSSRSHTIFTITIHIKDNSLDGEELLRTGKLNLVDLAGSENIGRSGAQDKRAREAGNINQSLLTLGRCIT  250 (583)
Q Consensus       171 R~~~~t~~n~~SSRSH~i~~i~i~~~~~~~~~~~~~~~s~L~~VDLAGsEr~~~~~~~~~~~~E~~~In~SL~~L~~vi~  250 (583)
                      |.+++|.+|..|||||+||++++.+.....   .....++|+|||||||||..++++.+.+++|+..||+||++|++||.
T Consensus       187 R~~~~t~~n~~ssRsH~i~~i~v~~~~~~~---~~~~~~kl~~vDLAGsEr~~~~~~~g~~~~E~~~iN~SL~~L~~vi~  263 (364)
T d1sdma_         187 RHTTGTLMNEQSSRSHLIVSVIIESTNLQT---QAIARGKLSFVDLAGSERVKKSGSAGNQLKEAQSINKSLSALGDVIS  263 (364)
T ss_dssp             HCCCSSCTTCHHHHSEEEEEEEEEEEETTT---CCEEEEEEEEEECCCCSCCCC---------CCCTTCHHHHHHHHHHH
T ss_pred             eccccccccccccccceEEEEEEEEeccCc---ceeeeEEEEeechhhccccccccccCceeeeccccccchhhHHHHHH
Confidence            999999999999999999999998766432   23457899999999999999999999999999999999999999999


Q ss_pred             HHhhhCCCCCcchhhHhHHhhhhcCCcceeeEEEEeCccccchhhhhhhhhhhhhhccCCCchhhhhhhhHHHHHHHHHH
Q psy9448         251 ALVEKTPHIPYRESKLTRLLQDSLGGRTKTSIIATVSPAQLNMEETLSTLDYAHRAKNITNRPEINQKMSKKALLRVTSI  330 (583)
Q Consensus       251 aL~~~~~~ipyR~SkLT~lL~d~Lggn~~t~~I~~vsp~~~~~~eTl~TL~fa~r~k~i~n~~~~n~~~~~~~~~~~~~~  330 (583)
                      +|+++..|||||+||||+||+|+||||++|+||+||||+..+++||++||+||+|||+|+|+|.+|+...   .+..|++
T Consensus       264 aL~~~~~~ipyR~SkLT~lL~d~Lggns~t~~I~~isp~~~~~~eTl~TL~fa~~ak~i~n~p~~n~~~~---~~~~l~~  340 (364)
T d1sdma_         264 ALSSGNQHIPYRNHKLTMLMSDSLGGNAKTLMFVNISPAESNLDETHNSLTYASRVRSIVNDPSKNVSSK---EVARLKK  340 (364)
T ss_dssp             HHHHTCSCCCGGGCHHHHHTTTTTTSSSEEEEEEEECCBGGGHHHHHHHHHHHHHHTTCCCCCCCCEECH---HHHHHHT
T ss_pred             HHHcCCCcCCchhhhhhHHHHhhcCCCceEEEEEEeCCCcchHHHHHHHHHHHHHHhhcccCCcccCCHH---HHHHHHH
Confidence            9999999999999999999999999999999999999999999999999999999999999999998653   3555666


Q ss_pred             HHHHhhhhhh
Q psy9448         331 NMEETLSTLD  340 (583)
Q Consensus       331 e~~~~l~~~~  340 (583)
                      ++.. |++++
T Consensus       341 ~i~~-l~~~~  349 (364)
T d1sdma_         341 LVSY-WKEQA  349 (364)
T ss_dssp             TTTC-C----
T ss_pred             HHHH-HHHHH
Confidence            6655 55544
>d1x88a1 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]} Back     information, alignment and structure
>d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1v8ka_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090]} Back     information, alignment and structure
>d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2zfia1 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]} Back     information, alignment and structure
>d1ry6a_ c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1f9va_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId: 4932]} Back     information, alignment and structure
>d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1v8ka_ c.37.1.9 (A:) Kinesin {Mouse (Mus musculus), kif2c [TaxId: 10090]} Back     information, alignment and structure
>d2zfia1 c.37.1.9 (A:4-352) Kinesin {Mouse (Mus musculus), kif1a [TaxId: 10090]} Back     information, alignment and structure
>d1x88a1 c.37.1.9 (A:18-362) Kinesin {Human (Homo sapiens), mitotic kinesin eg5 [TaxId: 9606]} Back     information, alignment and structure
>d1sdma_ c.37.1.9 (A:) Kinesin heavy chain-like protein {Potato (Solanum tuberosum) [TaxId: 4113]} Back     information, alignment and structure
>d1ry6a_ c.37.1.9 (A:) Kinesin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1goja_ c.37.1.9 (A:) Kinesin {Neurospora crassa [TaxId: 5141]} Back     information, alignment and structure
>d1bg2a_ c.37.1.9 (A:) Kinesin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ncda_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1f9va_ c.37.1.9 (A:) Kinesin motor Ncd (non-claret disjunctional) {Baker's yeast (Saccharomyces cerevisiae), Kar [TaxId: 4932]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gvnb_ c.37.1.21 (B:) Plasmid maintenance system epsilon/zeta, toxin zeta subunit {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1r7ra3 c.37.1.20 (A:471-735) Membrane fusion ATPase VCP/p97 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1p9ra_ c.37.1.11 (A:) Extracellular secretion NTPase EpsE {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1l8qa2 c.37.1.20 (A:77-289) Chromosomal replication initiation factor DnaA {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1w5sa2 c.37.1.20 (A:7-293) CDC6-like protein APE0152, N-terminal domain {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure