Psyllid ID: psy9473

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-
TTTLIGLLKTARLLRLVRVARKIDRYSEYGAAVLLLLMATFALIAHWLACIWYAIGNAEKSSVGWLDILANDTHQFYINGTGGPSIKSRYVTALYFTFSSLTSVGFGNVAPNTDNEKIFTILVMLVGCKYESSAMHAFIAEMGHIIPHCKRGPEQLGASYL
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHcccccccccccccccHHHHHHHHHHHHHHHHHccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHccc
ccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHcccccccccccccccHHEEEHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
TTTLIGLLKTARLLRLVRVARKIDRYSEYGAAVLLLLMATFALIAHWLACIWYAIGNAEKSSVGWLDILANdthqfyingtggpsiksRYVTALYFTFSSltsvgfgnvapntdneKIFTILVMLVGCKYESSAMHAFIAEMGhiiphckrgpeqlgasyl
tttligllktarllRLVRVARKIDRYSEYGAAVLLLLMATFALIAHWLACIWYAIGNAEKSSVGWLDILANDTHQFYINGTGGPSIKSRYVTALYFTFSSLTSVGFGNVAPNTDNEKIFTILVMLVGCKYESSAMHAFIAEMGHIIPHCKRGPEQLGASYL
TTtligllktarllrlvrvarkiDRYSEYGAAVLLLLMATFALIAHWLACIWYAIGNAEKSSVGWLDILANDTHQFYINGTGGPSIKSRYVTALYFTFSSLTSVGFGNVAPNTDNEKIFTILVMLVGCKYESSAMHAFIAEMGHIIPHCKRGPEQLGASYL
***LIGLLKTARLLRLVRVARKIDRYSEYGAAVLLLLMATFALIAHWLACIWYAIGNAEKSSVGWLDILANDTHQFYINGTGGPSIKSRYVTALYFTFSSLTSVGFGNVAPNTDNEKIFTILVMLVGCKYESSAMHAFIAEMGHIIPHCK***********
TTTLIGLLKTARLLRLVRVARKIDRYSEYGAAVLLLLMATFALIAHWLACIWYAIGNAEKSSVGWLDILANDTHQFYINGTGGPSIKSRYVTALYFTFSSLTSVGFGNVAPNTDNEKIFTILVMLVGCKYESSAMHAFIAEMGHIIPHCKRGPEQLG*SYL
TTTLIGLLKTARLLRLVRVARKIDRYSEYGAAVLLLLMATFALIAHWLACIWYAIGNAEKSSVGWLDILANDTHQFYINGTGGPSIKSRYVTALYFTFSSLTSVGFGNVAPNTDNEKIFTILVMLVGCKYESSAMHAFIAEMGHIIPHCKRGPEQLGASYL
TTTLIGLLKTARLLRLVRVARKIDRYSEYGAAVLLLLMATFALIAHWLACIWYAIGNAEKSSVGWLDILANDTHQFYINGTGGPSIKSRYVTALYFTFSSLTSVGFGNVAPNTDNEKIFTILVMLVGCKYESSAMHAFIAEMGHIIPHCKRGPEQLGAS**
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
TTTLIGLLKTARLLRLVRVARKIDRYSEYGAAVLLLLMATFALIAHWLACIWYAIGNAEKSSVGWLDILANDTHQFYINGTGGPSIKSRYVTALYFTFSSLTSVGFGNVAPNTDNEKIFTILVMLVGCKYESSAMHAFIAEMGHIIPHCKRGPEQLGASYL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query161 2.2.26 [Sep-21-2011]
Q9NS40 1196 Potassium voltage-gated c yes N/A 0.788 0.106 0.729 4e-50
Q9ER47 1195 Potassium voltage-gated c yes N/A 0.788 0.106 0.729 4e-50
O54852 1195 Potassium voltage-gated c yes N/A 0.788 0.106 0.729 4e-50
Q9PT84 526 Potassium voltage-gated c no N/A 0.788 0.241 0.736 2e-49
O54853 950 Potassium voltage-gated c no N/A 0.782 0.132 0.723 5e-49
Q12809 1159 Potassium voltage-gated c no N/A 0.788 0.109 0.734 5e-49
Q9TSZ3 1158 Potassium voltage-gated c no N/A 0.788 0.109 0.734 5e-49
O08962 1163 Potassium voltage-gated c no N/A 0.788 0.109 0.734 6e-49
Q8WNY2 1161 Potassium voltage-gated c no N/A 0.788 0.109 0.734 7e-49
Q9H252 994 Potassium voltage-gated c no N/A 0.782 0.126 0.723 7e-49
>sp|Q9NS40|KCNH7_HUMAN Potassium voltage-gated channel subfamily H member 7 OS=Homo sapiens GN=KCNH7 PE=2 SV=2 Back     alignment and function desciption
 Score =  196 bits (499), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 97/133 (72%), Positives = 110/133 (82%), Gaps = 6/133 (4%)

Query: 1   TTTLIGLLKTARLLRLVRVARKIDRYSEYGAAVLLLLMATFALIAHWLACIWYAIGNAEK 60
           TTTLIGLLKTARLLRLVRVARK+DRYSEYGAAVL+LLM  FALIAHWLACIWYAIGN E+
Sbjct: 519 TTTLIGLLKTARLLRLVRVARKLDRYSEYGAAVLMLLMCIFALIAHWLACIWYAIGNVER 578

Query: 61  ----SSVGWLDILANDTHQFY--INGTGGPSIKSRYVTALYFTFSSLTSVGFGNVAPNTD 114
                 +GWLD L     + Y   + + GPSIK +YVTALYFTFSSLTSVGFGNV+PNT+
Sbjct: 579 PYLTDKIGWLDSLGQQIGKRYNDSDSSSGPSIKDKYVTALYFTFSSLTSVGFGNVSPNTN 638

Query: 115 NEKIFTILVMLVG 127
           +EKIF+I VML+G
Sbjct: 639 SEKIFSICVMLIG 651
Pore-forming (alpha) subunit of voltage-gated potassium channel. Channel properties may be modulated by cAMP and subunit assembly.
Homo sapiens (taxid: 9606)
>sp|Q9ER47|KCNH7_MOUSE Potassium voltage-gated channel subfamily H member 7 OS=Mus musculus GN=Kcnh7 PE=2 SV=2 Back     alignment and function description
>sp|O54852|KCNH7_RAT Potassium voltage-gated channel subfamily H member 7 OS=Rattus norvegicus GN=Kcnh7 PE=1 SV=1 Back     alignment and function description
>sp|Q9PT84|KCNH2_CHICK Potassium voltage-gated channel subfamily H member 2 (Fragment) OS=Gallus gallus GN=KCNH2 PE=2 SV=1 Back     alignment and function description
>sp|O54853|KCNH6_RAT Potassium voltage-gated channel subfamily H member 6 OS=Rattus norvegicus GN=Kcnh6 PE=1 SV=1 Back     alignment and function description
>sp|Q12809|KCNH2_HUMAN Potassium voltage-gated channel subfamily H member 2 OS=Homo sapiens GN=KCNH2 PE=1 SV=1 Back     alignment and function description
>sp|Q9TSZ3|KCNH2_CANFA Potassium voltage-gated channel subfamily H member 2 OS=Canis familiaris GN=KCNH2 PE=2 SV=1 Back     alignment and function description
>sp|O08962|KCNH2_RAT Potassium voltage-gated channel subfamily H member 2 OS=Rattus norvegicus GN=Kcnh2 PE=1 SV=1 Back     alignment and function description
>sp|Q8WNY2|KCNH2_RABIT Potassium voltage-gated channel subfamily H member 2 OS=Oryctolagus cuniculus GN=KCNH2 PE=2 SV=3 Back     alignment and function description
>sp|Q9H252|KCNH6_HUMAN Potassium voltage-gated channel subfamily H member 6 OS=Homo sapiens GN=KCNH6 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query161
328782740 1054 PREDICTED: hypothetical protein LOC41049 0.832 0.127 0.840 8e-62
332028911 929 Potassium voltage-gated channel subfamil 0.788 0.136 0.901 1e-61
307197082 962 Potassium voltage-gated channel subfamil 0.795 0.133 0.894 1e-61
307180612 973 Potassium voltage-gated channel subfamil 0.795 0.131 0.894 2e-61
328700860 1210 PREDICTED: potassium voltage-gated chann 0.832 0.110 0.847 2e-61
328700858 1349 PREDICTED: potassium voltage-gated chann 0.832 0.099 0.847 2e-61
340724576 1053 PREDICTED: potassium voltage-gated chann 0.832 0.127 0.833 2e-61
383854726 1055 PREDICTED: uncharacterized protein LOC10 0.832 0.127 0.840 3e-61
380021134 874 PREDICTED: potassium voltage-gated chann 0.795 0.146 0.879 3e-60
340724578 981 PREDICTED: potassium voltage-gated chann 0.795 0.130 0.872 4e-60
>gi|328782740|ref|XP_393977.4| PREDICTED: hypothetical protein LOC410498 [Apis mellifera] Back     alignment and taxonomy information
 Score =  241 bits (615), Expect = 8e-62,   Method: Composition-based stats.
 Identities = 121/144 (84%), Positives = 126/144 (87%), Gaps = 10/144 (6%)

Query: 1   TTTLIGLLKTARLLRLVRVARKIDRYSEYGAAVLLLLMATFALIAHWLACIWYAIGNAE- 59
           TTTLIGLLKTARLLRLVRVARKIDRYSEYGAAVLLLLM TFAL AHW+ACIWYAIGNAE 
Sbjct: 228 TTTLIGLLKTARLLRLVRVARKIDRYSEYGAAVLLLLMGTFALSAHWMACIWYAIGNAER 287

Query: 60  ---KSSVGWLDILANDTHQFYI-NGTGGPSIKSRYVTALYFTFSSLTSVGFGNVAPNTDN 115
              KS VGWLDILANDTHQFY  N TGGPSIKSRY+TALYFTFSSLTSVGFGNVAPNTD 
Sbjct: 288 PTLKSKVGWLDILANDTHQFYFHNNTGGPSIKSRYITALYFTFSSLTSVGFGNVAPNTDT 347

Query: 116 EKIFTILVMLVGCKYESSAMHAFI 139
           EKIFTI+VML+G     S M+A I
Sbjct: 348 EKIFTIIVMLIG-----SLMYASI 366

Source: Apis mellifera

Species: Apis mellifera

Genus: Apis

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|332028911|gb|EGI68929.1| Potassium voltage-gated channel subfamily H member 7 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|307197082|gb|EFN78450.1| Potassium voltage-gated channel subfamily H member 7 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|307180612|gb|EFN68567.1| Potassium voltage-gated channel subfamily H member 7 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|328700860|ref|XP_001947207.2| PREDICTED: potassium voltage-gated channel subfamily H member 2-like isoform 1 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|328700858|ref|XP_003241406.1| PREDICTED: potassium voltage-gated channel subfamily H member 2-like isoform 2 [Acyrthosiphon pisum] Back     alignment and taxonomy information
>gi|340724576|ref|XP_003400657.1| PREDICTED: potassium voltage-gated channel subfamily H member 7-like isoform 1 [Bombus terrestris] gi|350397867|ref|XP_003485015.1| PREDICTED: potassium voltage-gated channel subfamily H member 7-like isoform 1 [Bombus impatiens] Back     alignment and taxonomy information
>gi|383854726|ref|XP_003702871.1| PREDICTED: uncharacterized protein LOC100881087 [Megachile rotundata] Back     alignment and taxonomy information
>gi|380021134|ref|XP_003694429.1| PREDICTED: potassium voltage-gated channel subfamily H member 7-like [Apis florea] Back     alignment and taxonomy information
>gi|340724578|ref|XP_003400658.1| PREDICTED: potassium voltage-gated channel subfamily H member 7-like isoform 2 [Bombus terrestris] gi|350397870|ref|XP_003485016.1| PREDICTED: potassium voltage-gated channel subfamily H member 7-like isoform 2 [Bombus impatiens] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query161
FB|FBgn0003353 855 sei "seizure" [Drosophila mela 0.645 0.121 0.788 2.7e-39
UNIPROTKB|G1K2Y3 522 Gga.55796 "Uncharacterized pro 0.645 0.199 0.690 1.9e-35
UNIPROTKB|Q9PT84 526 KCNH2 "Potassium voltage-gated 0.645 0.197 0.690 1.9e-35
UNIPROTKB|G5E9I0 888 KCNH2 "Potassium voltage-gated 0.645 0.117 0.715 3.7e-35
UNIPROTKB|F1Q208 1058 KCNH2 "Potassium voltage-gated 0.645 0.098 0.715 5.5e-35
UNIPROTKB|C4PFH9 1063 KCNH2 "Voltage-gated potassium 0.645 0.097 0.715 5.6e-35
UNIPROTKB|F1MCI9 1096 Bt.103515 "Uncharacterized pro 0.645 0.094 0.715 5.9e-35
UNIPROTKB|Q9TSZ3 1158 KCNH2 "Potassium voltage-gated 0.645 0.089 0.715 6.5e-35
UNIPROTKB|Q12809 1159 KCNH2 "Potassium voltage-gated 0.645 0.089 0.715 6.6e-35
MGI|MGI:1341722 1162 Kcnh2 "potassium voltage-gated 0.645 0.089 0.715 6.6e-35
FB|FBgn0003353 sei "seizure" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 428 (155.7 bits), Expect = 2.7e-39, P = 2.7e-39
 Identities = 86/109 (78%), Positives = 93/109 (85%)

Query:    24 DRYSEYGAAVLLLLMATFALIAHWLACIWYAIGNAEKS----SVGWLDILANDTHQFYI- 78
             DRYSEYGAAVL+LLMATF LIAHWLACIWYAIGNAEKS    ++GWL+ LA D  + Y  
Sbjct:   455 DRYSEYGAAVLILLMATFILIAHWLACIWYAIGNAEKSIASKNIGWLNSLAYDIQEPYFD 514

Query:    79 NGTGGPSIKSRYVTALYFTFSSLTSVGFGNVAPNTDNEKIFTILVMLVG 127
             N TGGPSIKSRY+TALYFTF+SLTSVGFGNVAPNTD EK FTI VMLVG
Sbjct:   515 NRTGGPSIKSRYITALYFTFTSLTSVGFGNVAPNTDAEKAFTICVMLVG 563
GO:0008076 "voltage-gated potassium channel complex" evidence=NAS
GO:0005249 "voltage-gated potassium channel activity" evidence=IEA;NAS
GO:0006813 "potassium ion transport" evidence=IEA;NAS
GO:0055085 "transmembrane transport" evidence=IEA
GO:0016020 "membrane" evidence=IEA
GO:0007605 "sensory perception of sound" evidence=IMP
UNIPROTKB|G1K2Y3 Gga.55796 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q9PT84 KCNH2 "Potassium voltage-gated channel subfamily H member 2" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|G5E9I0 KCNH2 "Potassium voltage-gated channel subfamily H member 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1Q208 KCNH2 "Potassium voltage-gated channel subfamily H member 2" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|C4PFH9 KCNH2 "Voltage-gated potassium channel subfamily H isoform 3.1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1MCI9 Bt.103515 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q9TSZ3 KCNH2 "Potassium voltage-gated channel subfamily H member 2" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q12809 KCNH2 "Potassium voltage-gated channel subfamily H member 2" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1341722 Kcnh2 "potassium voltage-gated channel, subfamily H (eag-related), member 2" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9ER47KCNH7_MOUSENo assigned EC number0.72930.78880.1062yesN/A
O54852KCNH7_RATNo assigned EC number0.72930.78880.1062yesN/A
Q9NS40KCNH7_HUMANNo assigned EC number0.72930.78880.1061yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query161
pfam00520194 pfam00520, Ion_trans, Ion transport protein 6e-09
pfam0788574 pfam07885, Ion_trans_2, Ion channel 5e-08
PLN03192 823 PLN03192, PLN03192, Voltage-dependent potassium ch 3e-07
PRK10537 393 PRK10537, PRK10537, voltage-gated potassium channe 9e-04
>gnl|CDD|215968 pfam00520, Ion_trans, Ion transport protein Back     alignment and domain information 
 Score = 52.3 bits (126), Expect = 6e-09
 Identities = 33/133 (24%), Positives = 56/133 (42%), Gaps = 13/133 (9%)

Query: 2   TTLIGLLKTARLLRLVRVARKIDRYSEYGAAVLLLL--MATFALIAHWLACIWYAIGNAE 59
           + L+ +L+  RLLRL+R+ R+         ++   L  +    L+   L  I+  IG   
Sbjct: 56  SGLLRVLRLLRLLRLLRLLRRFPGLRTLLQSLGRSLKSLLNLLLLLLLLLFIFAIIGVQ- 114

Query: 60  KSSVGWLDILANDTHQFYINGTGGPSIKSRYVTALYFTFSSLTSVGFGNV-----APNTD 114
                      +       N   G S    Y  AL + F +LT+ G+G+V      P T 
Sbjct: 115 -----LFGGELDKCCDKNENPINGNSNFDSYGEALLWLFRTLTTEGWGDVMYDTLVPGTV 169

Query: 115 NEKIFTILVMLVG 127
             KIF ++ +++G
Sbjct: 170 LGKIFFVIFIILG 182

This family contains Sodium, Potassium, Calcium ion channels. This family is 6 transmembrane helices in which the last two helices flank a loop which determines ion selectivity. In some sub-families (e.g. Na channels) the domain is repeated four times, whereas in others (e.g. K channels) the protein forms as a tetramer in the membrane. A bacterial structure of the protein is known for the last two helices but is not the Pfam family due to it lacking the first four helices. Length = 194
>gnl|CDD|219619 pfam07885, Ion_trans_2, Ion channel Back     alignment and domain information
>gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>gnl|CDD|236711 PRK10537, PRK10537, voltage-gated potassium channel; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 161
KOG0501|consensus 971 99.95
PLN03192 823 Voltage-dependent potassium channel; Provisional 99.93
KOG0498|consensus 727 99.91
KOG0500|consensus 536 99.86
KOG3713|consensus477 99.85
KOG1419|consensus 654 99.79
KOG1545|consensus507 99.71
KOG0499|consensus 815 99.69
PF0788579 Ion_trans_2: Ion channel; InterPro: IPR013099 This 99.65
KOG1420|consensus 1103 99.56
KOG4390|consensus 632 99.45
PRK10537 393 voltage-gated potassium channel; Provisional 99.38
PF00520200 Ion_trans: Ion transport protein calcium channel s 99.36
PF01007 336 IRK: Inward rectifier potassium channel; InterPro: 99.26
KOG3827|consensus 400 98.93
KOG1418|consensus 433 98.83
KOG4404|consensus350 98.61
KOG3684|consensus 489 98.53
KOG4404|consensus 350 98.06
KOG1418|consensus 433 97.78
KOG3193|consensus 1087 96.48
PF00520200 Ion_trans: Ion transport protein calcium channel s 95.97
PLN03223 1634 Polycystin cation channel protein; Provisional 95.91
PF00060148 Lig_chan: Ligand-gated ion channel; InterPro: IPR0 95.69
TIGR00870 743 trp transient-receptor-potential calcium channel p 93.52
PF08016425 PKD_channel: Polycystin cation channel; InterPro: 93.07
KOG4440|consensus 993 92.39
KOG2302|consensus 1956 91.29
KOG1054|consensus 897 89.72
KOG3676|consensus 782 85.74
KOG1052|consensus 656 80.95
>KOG0501|consensus Back     alignment and domain information 
Probab=99.95  E-value=2.4e-27  Score=189.40  Aligned_cols=149  Identities=48%  Similarity=0.847  Sum_probs=131.1

Q ss_pred             ChhhhHHHHHHHHHhHHhHHHHHHHHHhhhHHHHHHHHHHHHHHHHHHHHHHHHHHhcCC--------Cccchhhchhcc
Q psy9473           1 TTTLIGLLKTARLLRLVRVARKIDRYSEYGAAVLLLLMATFALIAHWLACIWYAIGNAEK--------SSVGWLDILAND   72 (161)
Q Consensus         1 ~~~~~~llr~~Rllrl~r~~~~~~~~~~~~~~~l~~~~~~~~~~~h~~aci~~~i~~~~~--------~~~~w~~~~~~~   72 (161)
                      +.++|+.||.+||+|+-|+.|++++|.+++.+.++.+++.+.++.||+||+||.++.+|.        ..++|+.+..++
T Consensus       320 I~SLFSaLKVVRLLRLGRVaRKLD~YlEYGAA~LvLLlC~y~lvAHWlACiWysIGd~ev~~~~~n~i~~dsWL~kLa~~  399 (971)
T KOG0501|consen  320 IGSLFSALKVVRLLRLGRVARKLDHYLEYGAAVLVLLLCVYGLVAHWLACIWYSIGDYEVRDEMDNTIQPDSWLWKLAND  399 (971)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHhhHHHHHHHHHHHHHHHHHHHHhheeccchheecccccccccchHHHHHHhh
Confidence            368899999999999999999999999999999999999999999999999999999765        247999988777


Q ss_pred             ccccccCC-------CCCCchhhHHHHHHHHHhhhhcccccCCcccCCchhHHHHHHHHHHHHHHHHHHHHHHHHHHhhh
Q psy9473          73 THQFYING-------TGGPSIKSRYVTALYFTFSSLTSVGFGNVAPNTDNEKIFTILVMLVGCKYESSAMHAFIAEMGHI  145 (161)
Q Consensus        73 ~~~~~~~~-------~~~~~~~~~y~~s~y~a~~tlttvGyGd~~p~t~~e~~~~~~~~l~G~~~~a~~~~~~~~~~~~~  145 (161)
                      ...++.-.       ..+++..+.|+.|+||.+++|||||||++.|.|+.|++|+++.|++|.+++|.+.|.+...+++.
T Consensus       400 ~~tpY~~~~s~~~~~~gGPSr~S~YissLYfTMt~mttvGFGNiA~~TD~EKiF~v~mMii~aLLYAtIFG~vTTI~QQM  479 (971)
T KOG0501|consen  400 IGTPYNYNLSNKGTLVGGPSRTSAYISSLYFTMTCMTTVGFGNIAPNTDNEKIFGVCMMIIGALLYATIFGHVTTIIQQM  479 (971)
T ss_pred             cCCCceeccCCCceeecCCcccceehhhhhhhhhhhhcccccccCCCccHHHHHHHHHHHHHHHHHHHHHhhHHHHHHHH
Confidence            76654211       34777788999999999999999999999999999999999999999999999999887777665


Q ss_pred             chhc
Q psy9473         146 IPHC  149 (161)
Q Consensus       146 ~~~~  149 (161)
                      -.+.
T Consensus       480 ~s~T  483 (971)
T KOG0501|consen  480 TSNT  483 (971)
T ss_pred             Hhhh
Confidence            4443

>PLN03192 Voltage-dependent potassium channel; Provisional Back     alignment and domain information
>KOG0498|consensus Back     alignment and domain information
>KOG0500|consensus Back     alignment and domain information
>KOG3713|consensus Back     alignment and domain information
>KOG1419|consensus Back     alignment and domain information
>KOG1545|consensus Back     alignment and domain information
>KOG0499|consensus Back     alignment and domain information
>PF07885 Ion_trans_2: Ion channel; InterPro: IPR013099 This entry includes the two membrane helix type ion channels found in bacteria [] Back     alignment and domain information
>KOG1420|consensus Back     alignment and domain information
>KOG4390|consensus Back     alignment and domain information
>PRK10537 voltage-gated potassium channel; Provisional Back     alignment and domain information
>PF00520 Ion_trans: Ion transport protein calcium channel signature potassium channel signature sodium channel signature; InterPro: IPR005821 This group of proteins is found in sodium, potassium, and calcium ion channels proteins Back     alignment and domain information
>PF01007 IRK: Inward rectifier potassium channel; InterPro: IPR013521 Potassium channels are the most diverse group of the ion channel family [, ] Back     alignment and domain information
>KOG3827|consensus Back     alignment and domain information
>KOG1418|consensus Back     alignment and domain information
>KOG4404|consensus Back     alignment and domain information
>KOG3684|consensus Back     alignment and domain information
>KOG4404|consensus Back     alignment and domain information
>KOG1418|consensus Back     alignment and domain information
>KOG3193|consensus Back     alignment and domain information
>PF00520 Ion_trans: Ion transport protein calcium channel signature potassium channel signature sodium channel signature; InterPro: IPR005821 This group of proteins is found in sodium, potassium, and calcium ion channels proteins Back     alignment and domain information
>PLN03223 Polycystin cation channel protein; Provisional Back     alignment and domain information
>PF00060 Lig_chan: Ligand-gated ion channel; InterPro: IPR001320 The ability of synapses to modify their synaptic strength in response to activity is a fundamental property of the nervous system and may be an essential component of learning and memory Back     alignment and domain information
>TIGR00870 trp transient-receptor-potential calcium channel protein Back     alignment and domain information
>PF08016 PKD_channel: Polycystin cation channel; InterPro: IPR013122 Polycystic kidney diseases (PKD) are disorders characterised by large numbers of cysts distributed throughout grossly-enlarged kidneys Back     alignment and domain information
>KOG4440|consensus Back     alignment and domain information
>KOG2302|consensus Back     alignment and domain information
>KOG1054|consensus Back     alignment and domain information
>KOG3676|consensus Back     alignment and domain information
>KOG1052|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query161
3tet_A97 Crystal Structure Of Nak2k Channel Y66f Mutant Leng 7e-06
3t1c_A97 Crystal Structure Of Nak Channel D66y Mutant Length 7e-06
3ouf_A97 Structure Of A K+ Selective Nak Mutant Length = 97 2e-05
2q67_A114 Crystal Structure Of Nak Channel D66a Mutant Length 3e-05
3e83_A96 Crystal Structure Of The The Open Nak Channel Pore 3e-05
3tcu_A97 Crystal Structure Of Nak2k Channel D68e Mutant Leng 4e-05
2q6a_A114 Crystal Structure Of Nak Channel D66e Mutant Length 4e-05
2ahy_A110 Na+ Complex Of The Nak Channel Length = 110 4e-05
2q69_A114 Crystal Structure Of Nak Channel D66n Mutant Length 4e-05
3t4d_A97 Crystal Structure Of Nak2k Channel Y55f Mutant Leng 5e-05
2q68_A114 Crystal Structure Of Nak Channel D66a, S70e Double 6e-05
3vou_A148 The Crystal Structure Of Nak-Navsulp Chimera Channe 6e-05
3t4z_A97 Crystal Structure Of Nak2k Channel Y55w Mutant Leng 8e-05
3t2m_A97 Crystal Structure Of Nak Channel N68d Mutant Length 1e-04
>pdb|3TET|A Chain A, Crystal Structure Of Nak2k Channel Y66f Mutant Length = 97 Back     alignment and structure 
Iteration: 1

 Score = 46.6 bits (109), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 22/48 (45%), Positives = 31/48 (64%)
Query: 89  RYVTALYFTFSSLTSVGFGNVAPNTDNEKIFTILVMLVGCKYESSAMH 136
           R + ALYF+  +LT+VGFG+ +P TD  KIFTIL + +G       +H
Sbjct: 32  RPIDALYFSVVTLTTVGFGDFSPQTDFGKIFTILYIFIGIGLVFGFIH 79
>pdb|3T1C|A Chain A, Crystal Structure Of Nak Channel D66y Mutant Length = 97 Back     alignment and structure
>pdb|3OUF|A Chain A, Structure Of A K+ Selective Nak Mutant Length = 97 Back     alignment and structure
>pdb|2Q67|A Chain A, Crystal Structure Of Nak Channel D66a Mutant Length = 114 Back     alignment and structure
>pdb|3E83|A Chain A, Crystal Structure Of The The Open Nak Channel Pore Length = 96 Back     alignment and structure
>pdb|3TCU|A Chain A, Crystal Structure Of Nak2k Channel D68e Mutant Length = 97 Back     alignment and structure
>pdb|2Q6A|A Chain A, Crystal Structure Of Nak Channel D66e Mutant Length = 114 Back     alignment and structure
>pdb|2AHY|A Chain A, Na+ Complex Of The Nak Channel Length = 110 Back     alignment and structure
>pdb|2Q69|A Chain A, Crystal Structure Of Nak Channel D66n Mutant Length = 114 Back     alignment and structure
>pdb|3T4D|A Chain A, Crystal Structure Of Nak2k Channel Y55f Mutant Length = 97 Back     alignment and structure
>pdb|2Q68|A Chain A, Crystal Structure Of Nak Channel D66a, S70e Double Mutants Length = 114 Back     alignment and structure
>pdb|3VOU|A Chain A, The Crystal Structure Of Nak-Navsulp Chimera Channel Length = 148 Back     alignment and structure
>pdb|3T4Z|A Chain A, Crystal Structure Of Nak2k Channel Y55w Mutant Length = 97 Back     alignment and structure
>pdb|3T2M|A Chain A, Crystal Structure Of Nak Channel N68d Mutant Length = 97 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query161
1ujl_A42 Potassium voltage-gated channel subfamily H member 4e-13
3vou_A148 ION transport 2 domain protein, voltage-gated SOD 1e-08
3ouf_A97 Potassium channel protein; ION channel, membrane, 3e-08
2q67_A114 Potassium channel protein; inverted teepee, helix 7e-08
1lnq_A 336 MTHK channels, potassium channel related protein; 2e-07
3ldc_A82 Calcium-gated potassium channel MTHK; transmembran 3e-07
3beh_A 355 MLL3241 protein; transmembrane protein, membrane p 2e-05
1orq_C223 Potassium channel; voltage-dependent, KVAP, FAB co 4e-05
1p7b_A 333 Integral membrane channel and cytosolic domains; t 5e-04
3pjs_K166 KCSA, voltage-gated potassium channel; ION channel 8e-04
1xl4_A 301 Inward rectifier potassium channel; integral membr 8e-04
>1ujl_A Potassium voltage-gated channel subfamily H member 2; two helices, amphiphatic helix, membrane protein; NMR {Synthetic} SCOP: j.12.1.1 Length = 42 Back     alignment and structure
 Score = 59.1 bits (143), Expect = 4e-13
 Identities = 18/42 (42%), Positives = 24/42 (57%), Gaps = 5/42 (11%)

Query: 54 AIGNAEKSS----VGWLDILANDTHQFYI-NGTGGPSIKSRY 90
          AIGN E+      +GWL  L +   + Y  +G GGPSIK +Y
Sbjct: 1  AIGNMEQPHMDSRIGWLHNLGDQIGKPYNSSGLGGPSIKDKY 42
>3vou_A ION transport 2 domain protein, voltage-gated SOD channel; 4-helical bundle, ION channel, membrane, transport protein; 3.20A {Bacillus weihenstephanensis} Length = 148 Back     alignment and structure
>3ouf_A Potassium channel protein; ION channel, membrane, membrane protein; 1.55A {Bacillus cereus} PDB: 3t4z_A 3tcu_A 3t1c_A 3tet_A 3t4d_A 3t2m_A 3e86_A 3e83_A 3e89_A 3e8b_A 3e8f_A 3e8g_A 3e8h_A 3k0d_A 3k0g_A 3k06_A 3k08_A 3k04_A 3k03_A Length = 97 Back     alignment and structure
>2q67_A Potassium channel protein; inverted teepee, helix bundle, tetramer, central cavity, ION metal transport, membrane protein; 2.30A {Bacillus cereus} PDB: 2q68_A 2q6a_A 2q69_A 2ahy_A 2ahz_A Length = 114 Back     alignment and structure
>1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A Length = 336 Back     alignment and structure
>3ldc_A Calcium-gated potassium channel MTHK; transmembrane, ION channel, open conformation, IO transport; 1.45A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3lde_A 3r65_A 3ous_A 3ldd_A Length = 82 Back     alignment and structure
>3beh_A MLL3241 protein; transmembrane protein, membrane protein; HET: LDA; 3.10A {Mesorhizobium loti} PDB: 2zd9_A* Length = 355 Back     alignment and structure
>1orq_C Potassium channel; voltage-dependent, KVAP, FAB complex, MEM protein; 3.20A {Aeropyrum pernix} SCOP: f.14.1.1 PDB: 2a0l_A Length = 223 Back     alignment and structure
>1p7b_A Integral membrane channel and cytosolic domains; transmembrane helices, ION conduction, immunoglobulin fold, assembly; 3.65A {Burkholderia pseudomallei} SCOP: b.1.18.16 f.14.1.1 PDB: 2wll_B* 2wll_A* Length = 333 Back     alignment and structure
>3pjs_K KCSA, voltage-gated potassium channel; ION channel, conducts K+ IONS, cell membrane, transport PROT; 3.80A {Streptomyces lividans} PDB: 1f6g_A Length = 166 Back     alignment and structure
>1xl4_A Inward rectifier potassium channel; integral membrane protein, ION channel, inwardly rectifying channel, metal transport; 2.60A {Magnetospirillum magnetotacticum} SCOP: b.1.18.16 f.14.1.1 PDB: 1xl6_A* 2wlh_A 2wli_B 2wlj_A* 2wlk_A* 2wlm_A 2wlo_A 2wln_A 3zrs_A 2wli_A 2x6c_A* 2x6b_A* 2x6a_A* Length = 301 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query161
2a9h_A155 Voltage-gated potassium channel; potassium channel 99.9
2ih3_C122 Voltage-gated potassium channel; ION channel D-ami 99.89
1orq_C223 Potassium channel; voltage-dependent, KVAP, FAB co 99.88
3beh_A 355 MLL3241 protein; transmembrane protein, membrane p 99.84
2r9r_B514 Paddle chimera voltage gated potassium channel KV; 99.78
2k1e_A103 Water soluble analogue of potassium channel, KCSA; 99.77
2q67_A114 Potassium channel protein; inverted teepee, helix 99.75
4h33_A137 LMO2059 protein; bilayers, KVLM, lipidic cubic pha 99.75
3eff_K139 Voltage-gated potassium channel; FULL length KCSA, 99.73
3ouf_A97 Potassium channel protein; ION channel, membrane, 99.69
3vou_A148 ION transport 2 domain protein, voltage-gated SOD 99.67
3ldc_A82 Calcium-gated potassium channel MTHK; transmembran 99.65
1xl4_A 301 Inward rectifier potassium channel; integral membr 99.61
3sya_A 340 G protein-activated inward rectifier potassium CH; 99.56
2qks_A 321 KIR3.1-prokaryotic KIR channel chimera; G-protein 99.55
1p7b_A 333 Integral membrane channel and cytosolic domains; t 99.54
3spc_A 343 Inward-rectifier K+ channel KIR2.2; PIP, membrane 99.54
3pjs_K166 KCSA, voltage-gated potassium channel; ION channel 99.49
3rvy_A285 ION transport protein; tetrameric ION channel, vol 99.43
3um7_A 309 Potassium channel subfamily K member 4; potassium 99.38
4gx0_A 565 TRKA domain protein; membrane protein, ION channel 99.36
3um7_A309 Potassium channel subfamily K member 4; potassium 99.35
3ukm_A 280 Potassium channel subfamily K member 1; membrane p 99.29
3ukm_A280 Potassium channel subfamily K member 1; membrane p 99.22
1lnq_A 336 MTHK channels, potassium channel related protein; 99.1
4dxw_A229 Navrh, ION transport protein; tetrameric, voltage- 98.61
3kg2_A 823 Glutamate receptor 2; ION channel, membrane protei 95.43
3rvy_A285 ION transport protein; tetrameric ION channel, vol 84.85
4f4l_A112 ION transport protein; alpha helical membrane prot 84.67
>2a9h_A Voltage-gated potassium channel; potassium channel, KCSA, structure, membrane protein, metal transport; HET: PCA; NMR {Streptomyces lividans} SCOP: f.14.1.1 Back     alignment and structure
Probab=99.90  E-value=1.7e-23  Score=145.34  Aligned_cols=70  Identities=19%  Similarity=0.212  Sum_probs=57.5

Q ss_pred             hhHHHHHHHHHhhhhcccccCCcccCCchhHHHHHHHHHHHHHHHHHHHHHHHHHHhhhchhcCCCCCcc
Q psy9473          87 KSRYVTALYFTFSSLTSVGFGNVAPNTDNEKIFTILVMLVGCKYESSAMHAFIAEMGHIIPHCKRGPEQL  156 (161)
Q Consensus        87 ~~~y~~s~y~a~~tlttvGyGd~~p~t~~e~~~~~~~~l~G~~~~a~~~~~~~~~~~~~~~~~~~~~~~~  156 (161)
                      ..+|.+|+||+++|+|||||||+.|.|+.+|+++++++++|+.++++++|.+.+.+.+...+..+..++.
T Consensus        82 ~~s~~~a~y~s~vTltTVGYGDi~P~t~~gr~~~~~~~l~Gv~~~a~~~~~i~~~~~~~~~~~~~~~~r~  151 (155)
T 2a9h_A           82 LISYPDALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSYGLVFAAVATWFVGREQERRGHFVRH  151 (155)
T ss_dssp             TTSHHHHHHHHHHHHTTCCCSSSCCCSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHSCCC---------
T ss_pred             cCcccceeheeeeeeecccCCCCCCCChhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhh
Confidence            3579999999999999999999999999999999999999999999999999999887765544444433
>2ih3_C Voltage-gated potassium channel; ION channel D-amino acid semi-synthetic, membrane protein; HET: 1EM; 1.72A {Streptomyces lividans} PDB: 2ih1_C* 1r3j_C* 1k4d_C* 1r3i_C* 1k4c_C* 1r3k_C* 1r3l_C* 2bob_C* 2boc_C* 2hvj_C* 2hvk_C* 2itc_C 2itd_C 3gb7_C* 3iga_C* 1jvm_A 1s5h_C* 3ifx_A* 1j95_A 2jk5_C* ... Back     alignment and structure
>1orq_C Potassium channel; voltage-dependent, KVAP, FAB complex, MEM protein; 3.20A {Aeropyrum pernix} SCOP: f.14.1.1 PDB: 2a0l_A Back     alignment and structure
>3beh_A MLL3241 protein; transmembrane protein, membrane protein; HET: LDA; 3.10A {Mesorhizobium loti} PDB: 2zd9_A* Back     alignment and structure
>2r9r_B Paddle chimera voltage gated potassium channel KV; voltage sensor, voltage dependent, ION CH shaker, membrane protein, eukaryotic; HET: NAP PGW; 2.40A {Rattus norvegicus} PDB: 3lnm_B* 3lut_B* 2a79_B* Back     alignment and structure
>2k1e_A Water soluble analogue of potassium channel, KCSA; homotetramer, ION transport, ionic channel, membrane, transmembrane, transport; NMR {Escherichia coli} PDB: 2kb1_A Back     alignment and structure
>2q67_A Potassium channel protein; inverted teepee, helix bundle, tetramer, central cavity, ION metal transport, membrane protein; 2.30A {Bacillus cereus} PDB: 2q68_A 2q6a_A 2q69_A 2ahy_A 2ahz_A Back     alignment and structure
>4h33_A LMO2059 protein; bilayers, KVLM, lipidic cubic phase (LCP), pore module, ION membrane protein; HET: OLC; 3.10A {Listeria monocytogenes} PDB: 4h37_A Back     alignment and structure
>3eff_K Voltage-gated potassium channel; FULL length KCSA, bulge helix, cell membrane, ION transport, ionic channel, membrane, transmembrane; 3.80A {Streptomyces lividans} Back     alignment and structure
>3ouf_A Potassium channel protein; ION channel, membrane, membrane protein; 1.55A {Bacillus cereus} PDB: 3t4z_A 3tcu_A 3t1c_A 3tet_A 3t4d_A 3t2m_A 3e86_A 3e83_A 3e89_A 3e8b_A 3e8f_A 3e8g_A 3e8h_A 3k0d_A 3k0g_A 3k06_A 3k08_A 3k04_A 3k03_A Back     alignment and structure
>3vou_A ION transport 2 domain protein, voltage-gated SOD channel; 4-helical bundle, ION channel, membrane, transport protein; 3.20A {Bacillus weihenstephanensis} Back     alignment and structure
>3ldc_A Calcium-gated potassium channel MTHK; transmembrane, ION channel, open conformation, IO transport; 1.45A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3lde_A 4hyo_A 4hz3_D 3r65_A 3ous_A 3ldd_A Back     alignment and structure
>1xl4_A Inward rectifier potassium channel; integral membrane protein, ION channel, inwardly rectifying channel, metal transport; 2.60A {Magnetospirillum magnetotacticum} SCOP: b.1.18.16 f.14.1.1 PDB: 1xl6_A* 2wlh_A 2wli_B 2wlj_A* 2wlk_A* 2wlm_A 2wlo_A 2wln_A 3zrs_A 2wli_A 2x6c_A* 2x6b_A* 2x6a_A* Back     alignment and structure
>3sya_A G protein-activated inward rectifier potassium CH; ION channel, potassium channel, inward rectification, sodium PIP2 binding, G protein binding; HET: PIO; 2.98A {Mus musculus} PDB: 3syo_A 3syc_A 3syp_A 3syq_A* Back     alignment and structure
>2qks_A KIR3.1-prokaryotic KIR channel chimera; G-protein gated inward rectifier, potassium channel selectivity filter, metal transport; HET: BNG; 2.20A {Burkholderia xenovorans} Back     alignment and structure
>1p7b_A Integral membrane channel and cytosolic domains; transmembrane helices, ION conduction, immunoglobulin fold, assembly; 3.65A {Burkholderia pseudomallei} SCOP: b.1.18.16 f.14.1.1 PDB: 2wll_B* 2wll_A* Back     alignment and structure
>3spc_A Inward-rectifier K+ channel KIR2.2; PIP, membrane protein, lipid, receptor, metal transport; HET: P8P; 2.45A {Gallus gallus} PDB: 3jyc_A* 3spi_A* 3sph_A* 3spj_A 3spg_A* Back     alignment and structure
>3pjs_K KCSA, voltage-gated potassium channel; ION channel, conducts K+ IONS, cell membrane, transport PROT; 3.80A {Streptomyces lividans} PDB: 1f6g_A Back     alignment and structure
>3rvy_A ION transport protein; tetrameric ION channel, voltage-gated sodium-selective ION C membrane, metal transport; HET: PX4; 2.70A {Arcobacter butzleri} PDB: 3rvz_A* 4ekw_A* 3rw0_A* Back     alignment and structure
>3um7_A Potassium channel subfamily K member 4; potassium ION channel, metal transport; 3.31A {Homo sapiens} Back     alignment and structure
>4gx0_A TRKA domain protein; membrane protein, ION channel, ADP binding, NAD binding, MEM transport protein; HET: MAL GLC; 2.60A {Geobacter sulfurreducens} PDB: 4gx1_A* 4gx2_A* 4gx5_A 4gvl_A* Back     alignment and structure
>3um7_A Potassium channel subfamily K member 4; potassium ION channel, metal transport; 3.31A {Homo sapiens} Back     alignment and structure
>3ukm_A Potassium channel subfamily K member 1; membrane protein, eukaryotic, two-pore DO potassium channel, K2P channel, membrane; HET: UND; 3.40A {Homo sapiens} Back     alignment and structure
>3ukm_A Potassium channel subfamily K member 1; membrane protein, eukaryotic, two-pore DO potassium channel, K2P channel, membrane; HET: UND; 3.40A {Homo sapiens} Back     alignment and structure
>1lnq_A MTHK channels, potassium channel related protein; rossman fold, helix bundle, membrane protein; 3.30A {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.2.1.9 d.286.1.1 f.14.1.1 PDB: 3rbz_A Back     alignment and structure
>4dxw_A Navrh, ION transport protein; tetrameric, voltage-gated sodium channel, sodium selective, gated ION channel; HET: BNG PX4; 3.05A {Alpha proteobacterium HIMB114} Back     alignment and structure
>3kg2_A Glutamate receptor 2; ION channel, membrane protein, cell membrane, glycoprotein, transport, membrane, postsynaptic cell membrane, editing; HET: ZK1 NAG BMA; 3.60A {Rattus norvegicus} Back     alignment and structure
>3rvy_A ION transport protein; tetrameric ION channel, voltage-gated sodium-selective ION C membrane, metal transport; HET: PX4; 2.70A {Arcobacter butzleri} PDB: 3rvz_A* 4ekw_A* 3rw0_A* Back     alignment and structure
>4f4l_A ION transport protein; alpha helical membrane protein, voltage-gated sodium channel membrane, metal transport; 3.49A {Magnetococcus marinus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 161
d1lnqa280 f.14.1.1 (A:19-98) Potassium channel-related prote 2e-08
d1xl4a2116 f.14.1.1 (A:23-138) Inward rectifier potassium cha 2e-04
d1p7ba2116 f.14.1.1 (A:36-151) Inward rectifier potassium cha 6e-04
d1r3jc_103 f.14.1.1 (C:) Potassium channel protein {Streptomy 8e-04
>d1lnqa2 f.14.1.1 (A:19-98) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Length = 80 Back     information, alignment and structure

class: Membrane and cell surface proteins and peptides
fold: Voltage-gated potassium channels
superfamily: Voltage-gated potassium channels
family: Voltage-gated potassium channels
domain: Potassium channel-related protein MthK
species: Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]

 Score = 46.6 bits (111), Expect = 2e-08
 Identities = 12/39 (30%), Positives = 27/39 (69%)

Query: 90  YVTALYFTFSSLTSVGFGNVAPNTDNEKIFTILVMLVGC 128
           +  +LY+TF ++ +VG+G+ +P+T     FT+ ++++G 
Sbjct: 28  WTVSLYWTFVTIATVGYGDYSPSTPLGMYFTVTLIVLGI 66
>d1xl4a2 f.14.1.1 (A:23-138) Inward rectifier potassium channel kirbac3.1 {Magnetospirillum magnetotacticum [TaxId: 188]} Length = 116 Back     information, alignment and structure
>d1p7ba2 f.14.1.1 (A:36-151) Inward rectifier potassium channel Kirbac1.1 {Burkholderia pseudomallei [TaxId: 28450]} Length = 116 Back     information, alignment and structure
>d1r3jc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} Length = 103 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query161
d1r3jc_103 Potassium channel protein {Streptomyces coelicolor 99.81
d1xl4a2116 Inward rectifier potassium channel kirbac3.1 {Magn 99.76
d1p7ba2116 Inward rectifier potassium channel Kirbac1.1 {Burk 99.73
d1lnqa280 Potassium channel-related protein MthK {Archaeon M 99.46
d2h8pc157 Potassium channel protein {Streptomyces coelicolor 98.7
>d1r3jc_ f.14.1.1 (C:) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
class: Membrane and cell surface proteins and peptides
fold: Voltage-gated potassium channels
superfamily: Voltage-gated potassium channels
family: Voltage-gated potassium channels
domain: Potassium channel protein
species: Streptomyces coelicolor [TaxId: 1902]

Probab=99.81  E-value=1.8e-19  Score=115.49  Aligned_cols=61  Identities=21%  Similarity=0.288  Sum_probs=55.8

Q ss_pred             hHHHHHHHHHhhhhcccccCCcccCCchhHHHHHHHHHHHHHHHHHHHHHHHHHHhhhchh
Q psy9473          88 SRYVTALYFTFSSLTSVGFGNVAPNTDNEKIFTILVMLVGCKYESSAMHAFIAEMGHIIPH  148 (161)
Q Consensus        88 ~~y~~s~y~a~~tlttvGyGd~~p~t~~e~~~~~~~~l~G~~~~a~~~~~~~~~~~~~~~~  148 (161)
                      .+|.+|+||+++|+||+||||+.|+|+.+|+++++.++.|+.+++.+++.+.+.+.+..++
T Consensus        39 ~s~~~aly~~~vT~tTvGYGDi~P~t~~gr~~~~~~~~~Gi~~~~~~~~~i~~~~~~~~~~   99 (103)
T d1r3jc_          39 ITYPRALWWSVETATTVGYGDLYPVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQE   99 (103)
T ss_dssp             CSHHHHHHHHHHHHTTCCCSSSCCCSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             CchhhhhhhheeeecccccCccccCChhHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
Confidence            4699999999999999999999999999999999999999999999999998887665443
>d1xl4a2 f.14.1.1 (A:23-138) Inward rectifier potassium channel kirbac3.1 {Magnetospirillum magnetotacticum [TaxId: 188]} Back     information, alignment and structure
>d1p7ba2 f.14.1.1 (A:36-151) Inward rectifier potassium channel Kirbac1.1 {Burkholderia pseudomallei [TaxId: 28450]} Back     information, alignment and structure
>d1lnqa2 f.14.1.1 (A:19-98) Potassium channel-related protein MthK {Archaeon Methanothermobacter thermautotrophicus [TaxId: 145262]} Back     information, alignment and structure
>d2h8pc1 f.14.1.1 (C:22-78) Potassium channel protein {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure