Psyllid ID: psy9489


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------28
FLGTVDKLGTAYEDKILSFGFGTHIAVPLLRQETEKNPQMSKEEAIALIKTCMDLLYVRDARSGAKNGPSLGKYHDFPNVLPHYFRRSGSFSTPLTTGTSVLGLVFNGGVILAADSAGYYGSMMRFNDCPRIMQINKFTILGAGNDYADFQYLNDIVKQKITPLTTGTSVLGLVFNGGVILAADSAGYYGSMMRFNDCPRIMQINKFTILGAGNDYADFQYLNDIVKQKILDDDLHNDGFVLKPKSLHSWLTRVLYNRRSQFDPLWINAFVAGMQNGEP
ccccccccccEEEcccEEEHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccEEEEEEccEEEEEEEcccccccccccccccccEEcccEEEEcccccccccHHHHHHcccccccccccccEEEEEEccEEEEEEEcccccccEEEEcccccEEEEcccEEEEEcccHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHcccccccccEEEEEEEEEcccc
ccccHcccccccccccHHcHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccccccEEEccEEEEEEccEEEEEEEccEEEccEEEEcccccEEEEcccEEEEEEEEHHHHHHHHHHHHHHHHccEEEccEEEEEEccEEEEEEEccEEEccEEEEcccccEEEEcccEEEEEEEEHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHcccccHHEEEEEEcccccc
FLGTVDKLGTAyedkilsfgfgthiavpllrqeteknpqmSKEEAIALIKTCMDLLYVRdarsgakngpslgkyhdfpnvlphyfrrsgsfstplttgtsVLGLVFNGGVILaadsagyygsmmrfndcprimqinkftilgagndyadfqYLNDIVkqkitplttgtsvlGLVFNGGVILaadsagyygsmmrfndcprimqinkftilgagndyadfqYLNDIVKqkildddlhndgfvlkpkslHSWLTRVLYnrrsqfdplWINAFVAGMQNGEP
flgtvdklGTAYEDKILSFGFGTHIAVPLLrqeteknpqmSKEEAIALIKTCMDLLYVRDARSgakngpslgkyhdFPNVLPHYFRRSGSFSTPLTTGTSVLGLVFNGGVILAADSAGYYGSMMRFNDCPRIMQINKFTILGAGNDYADFQYLNDIVKQKITPLTTGTSVLGLVFNGGVILAADSAGYYGSMMRFNDCPRIMQINKFTILGAGNDYADFQYLNDIVKQKILDDDLHNDGFVLKPKSLHSWLTRVLYNRRSQFDPLWINAFVAGMQNGEP
FLGTVDKLGTAYEDKILSFGFGTHIAVPLLRQETEKNPQMSKEEAIALIKTCMDLLYVRDARSGAKNGPSLGKYHDFPNVLPHYFRRSGSFSTPLTTGTSVLGLVFNGGVILAADSAGYYGSMMRFNDCPRIMQINKFTILGAGNDYADFQYLNDIVKQKITPLTTGTSVLGLVFNGGVILAADSAGYYGSMMRFNDCPRIMQINKFTILGAGNDYADFQYLNDIVKQKILDDDLHNDGFVLKPKSLHSWLTRVLYNRRSQFDPLWINAFVAGMQNGEP
*****DKLGTAYEDKILSFGFGTHIAVPLLR*************AIALIKTCMDLLYVRDARSGA**GPSLGKYHDFPNVLPHYFRRSGSFSTPLTTGTSVLGLVFNGGVILAADSAGYYGSMMRFNDCPRIMQINKFTILGAGNDYADFQYLNDIVKQKITPLTTGTSVLGLVFNGGVILAADSAGYYGSMMRFNDCPRIMQINKFTILGAGNDYADFQYLNDIVKQKILDDDLHNDGFVLKPKSLHSWLTRVLYNRRSQFDPLWINAFVAG******
FLGTVDKLGTAYEDKILSFGFGTHIAVPLLRQET********EEAIALIKTCMDLLYVRDARSGAKNGPSLGKYHDFP************FSTPLTTGTSVLGLVFNGGVILAADSAGYYGSMMRFNDCPRIMQINKFTILGAGNDYADFQYLNDIVKQKITPLTTGTSVLGLVFNGGVILAADSAGYYGSMMRFNDCPRIMQINKFTILGAGNDYADFQYLNDIVKQKILDDDLHNDGFVLKPKSLHSWLTRVLYNRRSQFDPLWINAFVAGMQN***
FLGTVDKLGTAYEDKILSFGFGTHIAVPLLRQETEKNPQMSKEEAIALIKTCMDLLYVRDARSGAKNGPSLGKYHDFPNVLPHYFRRSGSFSTPLTTGTSVLGLVFNGGVILAADSAGYYGSMMRFNDCPRIMQINKFTILGAGNDYADFQYLNDIVKQKITPLTTGTSVLGLVFNGGVILAADSAGYYGSMMRFNDCPRIMQINKFTILGAGNDYADFQYLNDIVKQKILDDDLHNDGFVLKPKSLHSWLTRVLYNRRSQFDPLWINAFVAGMQNGEP
FLGTVDKLGTAYEDKILSFGFGTHIAVPLLRQETEKNPQMSKEEAIALIKTCMDLLYVRDARSGAKNGPSLGK**D************GSFSTPLTTGTSVLGLVFNGGVILAADSAGYYGSMMRFNDCPRIMQINKFTILGAGNDYADFQYLNDIVKQKITPLTTGTSVLGLVFNGGVILAADSAGYYGSMMRFNDCPRIMQINKFTILGAGNDYADFQYLNDIVKQKILDDDLHNDGFVLKPKSLHSWLTRVLYNRRSQFDPLWINAFVAGMQN***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
FLGTVDKLGTAYEDKILSFGFGTHIAVPLLRQETEKNPQMSKEEAIALIKTCMDLLYVRDARSGAKNGPSLGKYHDFPNVLPHYFRRSGSFSTPLTTGTSVLGLVFNGGVILAADSAGYYGSMMRFNDCPRIMQINKFTILGAGNDYADFQYLNDIVKQKITPLTTGTSVLGLVFNGGVILAADSAGYYGSMMRFNDCPRIMQINKFTILGAGNDYADFQYLNDIVKQKILDDDLHNDGFVLKPKSLHSWLTRVLYNRRSQFDPLWINAFVAGMQNGEP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query279 2.2.26 [Sep-21-2011]
P28024242 Proteasome subunit beta t N/A N/A 0.419 0.483 0.532 1e-35
Q3T108264 Proteasome subunit beta t yes N/A 0.487 0.515 0.474 7e-33
P28070264 Proteasome subunit beta t yes N/A 0.473 0.5 0.473 3e-32
P99026264 Proteasome subunit beta t yes N/A 0.437 0.462 0.483 4e-32
P34067263 Proteasome subunit beta t yes N/A 0.387 0.410 0.5 3e-31
Q29384154 Proteasome subunit beta t no N/A 0.347 0.629 0.518 2e-30
Q9VNA5268 Proteasome subunit beta t yes N/A 0.394 0.410 0.459 2e-23
Q7DLR9 246 Proteasome subunit beta t yes N/A 0.419 0.475 0.380 6e-23
Q9USQ9 262 Probable proteasome subun yes N/A 0.440 0.469 0.384 7e-23
Q556Q0 259 Proteasome subunit beta t yes N/A 0.433 0.467 0.377 2e-19
>sp|P28024|PSB4_XENLA Proteasome subunit beta type-4 (Fragment) OS=Xenopus laevis GN=psmb4 PE=2 SV=2 Back     alignment and function desciption
 Score =  150 bits (378), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 65/122 (53%), Positives = 89/122 (72%)

Query: 157 VKQKITPLTTGTSVLGLVFNGGVILAADSAGYYGSMMRFNDCPRIMQINKFTILGAGNDY 216
           V+  + P+ TGTSVLG+ F+GGVI+AAD  G YGS+ RF +  RIM++N+ TILGA  DY
Sbjct: 21  VRHTLNPMVTGTSVLGVKFDGGVIIAADMLGSYGSLARFRNISRIMKVNENTILGASGDY 80

Query: 217 ADFQYLNDIVKQKILDDDLHNDGFVLKPKSLHSWLTRVLYNRRSQFDPLWINAFVAGMQN 276
           AD+QYL  ++ Q ++D++L  DG    PK++HSWLTRV+YNRRS+ +PLW    + G  N
Sbjct: 81  ADYQYLKQVIDQMVIDEELVGDGHNYSPKAIHSWLTRVMYNRRSKMNPLWNTVVIGGFYN 140

Query: 277 GE 278
           GE
Sbjct: 141 GE 142




The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity.
Xenopus laevis (taxid: 8355)
EC: 3EC: .EC: 4EC: .EC: 2EC: 5EC: .EC: 1
>sp|Q3T108|PSB4_BOVIN Proteasome subunit beta type-4 OS=Bos taurus GN=PSMB4 PE=1 SV=1 Back     alignment and function description
>sp|P28070|PSB4_HUMAN Proteasome subunit beta type-4 OS=Homo sapiens GN=PSMB4 PE=1 SV=4 Back     alignment and function description
>sp|P99026|PSB4_MOUSE Proteasome subunit beta type-4 OS=Mus musculus GN=Psmb4 PE=1 SV=1 Back     alignment and function description
>sp|P34067|PSB4_RAT Proteasome subunit beta type-4 OS=Rattus norvegicus GN=Psmb4 PE=1 SV=2 Back     alignment and function description
>sp|Q29384|PSB4_PIG Proteasome subunit beta type-4 (Fragment) OS=Sus scrofa GN=PSMB4 PE=2 SV=1 Back     alignment and function description
>sp|Q9VNA5|PSB4_DROME Proteasome subunit beta type-4 OS=Drosophila melanogaster GN=Prosbeta7 PE=2 SV=1 Back     alignment and function description
>sp|Q7DLR9|PSB4_ARATH Proteasome subunit beta type-4 OS=Arabidopsis thaliana GN=PBG1 PE=1 SV=2 Back     alignment and function description
>sp|Q9USQ9|PSB7_SCHPO Probable proteasome subunit beta type-7 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC577.10 PE=3 SV=1 Back     alignment and function description
>sp|Q556Q0|PSB4_DICDI Proteasome subunit beta type-4 OS=Dictyostelium discoideum GN=psmB4-1 PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query279
321473527262 hypothetical protein DAPPUDRAFT_99667 [D 0.430 0.458 0.580 2e-38
91087761254 PREDICTED: similar to predicted protein 0.437 0.480 0.563 5e-38
389610131262 proteasome beta7 subunit [Papilio xuthus 0.415 0.442 0.547 8e-38
242005373265 proteasome subunit beta type 4 precursor 0.440 0.464 0.547 1e-37
241242109154 20S proteasome, regulatory subunit beta, 0.437 0.792 0.557 3e-36
442759993254 Putative 20s proteasome regulatory subun 0.433 0.476 0.540 1e-35
443697819215 hypothetical protein CAPTEDRAFT_178772 [ 0.415 0.539 0.560 1e-35
156542911262 PREDICTED: proteasome subunit beta type- 0.405 0.431 0.55 6e-35
427787451254 Putative 20s proteasome regulatory subun 0.415 0.456 0.555 8e-35
357612754163 hypothetical protein KGM_20431 [Danaus p 0.448 0.766 0.552 1e-34
>gi|321473527|gb|EFX84494.1| hypothetical protein DAPPUDRAFT_99667 [Daphnia pulex] Back     alignment and taxonomy information
 Score =  165 bits (417), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 98/124 (79%)

Query: 156 IVKQKITPLTTGTSVLGLVFNGGVILAADSAGYYGSMMRFNDCPRIMQINKFTILGAGND 215
           I+ +  +P+TTGTS+LGL+F+GGV+LA D  G YGSM +F    RI+++N  T+LGA  D
Sbjct: 40  IITRTQSPVTTGTSILGLIFDGGVMLAGDMLGSYGSMAKFRSIERIIKVNNSTVLGATGD 99

Query: 216 YADFQYLNDIVKQKILDDDLHNDGFVLKPKSLHSWLTRVLYNRRSQFDPLWINAFVAGMQ 275
            ADFQ+L  I++QK++D+D  +DGF LKPK+LH+WLTRVLYNRRS+FDPLW    VAG++
Sbjct: 100 IADFQHLQSIIEQKVIDEDCADDGFTLKPKALHTWLTRVLYNRRSKFDPLWNTFLVAGIE 159

Query: 276 NGEP 279
           +GEP
Sbjct: 160 DGEP 163




Source: Daphnia pulex

Species: Daphnia pulex

Genus: Daphnia

Family: Daphniidae

Order: Diplostraca

Class: Branchiopoda

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|91087761|ref|XP_974991.1| PREDICTED: similar to predicted protein [Tribolium castaneum] gi|270009385|gb|EFA05833.1| hypothetical protein TcasGA2_TC008617 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|389610131|dbj|BAM18677.1| proteasome beta7 subunit [Papilio xuthus] Back     alignment and taxonomy information
>gi|242005373|ref|XP_002423543.1| proteasome subunit beta type 4 precursor, putative [Pediculus humanus corporis] gi|212506672|gb|EEB10805.1| proteasome subunit beta type 4 precursor, putative [Pediculus humanus corporis] Back     alignment and taxonomy information
>gi|241242109|ref|XP_002401910.1| 20S proteasome, regulatory subunit beta, putative [Ixodes scapularis] gi|215496245|gb|EEC05885.1| 20S proteasome, regulatory subunit beta, putative [Ixodes scapularis] Back     alignment and taxonomy information
>gi|442759993|gb|JAA72155.1| Putative 20s proteasome regulatory subunit beta type psmb4/pre4 [Ixodes ricinus] Back     alignment and taxonomy information
>gi|443697819|gb|ELT98117.1| hypothetical protein CAPTEDRAFT_178772 [Capitella teleta] Back     alignment and taxonomy information
>gi|156542911|ref|XP_001601321.1| PREDICTED: proteasome subunit beta type-4-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|427787451|gb|JAA59177.1| Putative 20s proteasome regulatory subunit beta type psmb4/pre4 [Rhipicephalus pulchellus] Back     alignment and taxonomy information
>gi|357612754|gb|EHJ68152.1| hypothetical protein KGM_20431 [Danaus plexippus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query279
ZFIN|ZDB-GENE-050417-333256 psmb4 "proteasome (prosome, ma 0.437 0.476 0.532 2.2e-34
UNIPROTKB|P28024242 psmb4 "Proteasome subunit beta 0.437 0.504 0.532 3.6e-34
UNIPROTKB|H9L0U6258 PSMB4 "Proteasome subunit beta 0.422 0.457 0.525 1.2e-33
UNIPROTKB|Q3T108264 PSMB4 "Proteasome subunit beta 0.487 0.515 0.474 6e-32
UNIPROTKB|F1ST02264 PSMB4 "Proteasome subunit beta 0.473 0.5 0.481 9.8e-32
UNIPROTKB|P28070264 PSMB4 "Proteasome subunit beta 0.473 0.5 0.473 2e-31
MGI|MGI:1098257264 Psmb4 "proteasome (prosome, ma 0.415 0.439 0.508 5.4e-31
UNIPROTKB|E2RBR6264 PSMB4 "Proteasome subunit beta 0.415 0.439 0.508 6.9e-31
RGD|61877263 Psmb4 "proteasome (prosome, ma 0.415 0.441 0.5 3.8e-30
UNIPROTKB|P34067263 Psmb4 "Proteasome subunit beta 0.415 0.441 0.5 3.8e-30
ZFIN|ZDB-GENE-050417-333 psmb4 "proteasome (prosome, macropain) subunit, beta type, 4" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 373 (136.4 bits), Expect = 2.2e-34, P = 2.2e-34
 Identities = 65/122 (53%), Positives = 88/122 (72%)

Query:   157 VKQKITPLTTGTSVLGLVFNGGVILAADSAGYYGSMMRFNDCPRIMQINKFTILGAGNDY 216
             +K  + P+ TGTSVLG+ F GGVI+AAD  G YGS+ RF +  R+M++N  TILGA  DY
Sbjct:    35 IKHTLNPMVTGTSVLGVKFKGGVIIAADMLGSYGSLARFRNISRLMKVNNSTILGASGDY 94

Query:   217 ADFQYLNDIVKQKILDDDLHNDGFVLKPKSLHSWLTRVLYNRRSQFDPLWINAFVAGMQN 276
             AD+QYL  I++Q ++D++L  DG    PK++HSWLTRV+YNRRS+ +PLW    + G  N
Sbjct:    95 ADYQYLKQIIEQMVIDEELLGDGHSYTPKAIHSWLTRVMYNRRSKMNPLWNTVVIGGFYN 154

Query:   277 GE 278
             GE
Sbjct:   155 GE 156


GO:0004175 "endopeptidase activity" evidence=IEA
GO:0004298 "threonine-type endopeptidase activity" evidence=IEA
GO:0051603 "proteolysis involved in cellular protein catabolic process" evidence=IEA
GO:0005839 "proteasome core complex" evidence=IEA
GO:0005634 "nucleus" evidence=IEA
GO:0005737 "cytoplasm" evidence=IEA
GO:0016787 "hydrolase activity" evidence=IEA
GO:0000502 "proteasome complex" evidence=IEA
GO:0006508 "proteolysis" evidence=IEA
GO:0008233 "peptidase activity" evidence=IEA
UNIPROTKB|P28024 psmb4 "Proteasome subunit beta type-4" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
UNIPROTKB|H9L0U6 PSMB4 "Proteasome subunit beta type" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|Q3T108 PSMB4 "Proteasome subunit beta type-4" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1ST02 PSMB4 "Proteasome subunit beta type" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|P28070 PSMB4 "Proteasome subunit beta type-4" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:1098257 Psmb4 "proteasome (prosome, macropain) subunit, beta type 4" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E2RBR6 PSMB4 "Proteasome subunit beta type" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
RGD|61877 Psmb4 "proteasome (prosome, macropain) subunit, beta type 4" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|P34067 Psmb4 "Proteasome subunit beta type-4" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.4.25.1LOW CONFIDENCE prediction!
3rd Layer3.4.25LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query279
cd03760197 cd03760, proteasome_beta_type_4, proteasome beta t 2e-54
cd01912189 cd01912, proteasome_beta, proteasome beta subunit 1e-26
cd03760197 cd03760, proteasome_beta_type_4, proteasome beta t 3e-26
cd03760197 cd03760, proteasome_beta_type_4, proteasome beta t 3e-25
cd01906182 cd01906, proteasome_protease_HslV, proteasome_prot 9e-19
cd01912189 cd01912, proteasome_beta, proteasome beta subunit 6e-15
cd01912189 cd01912, proteasome_beta, proteasome beta subunit 1e-12
COG0638236 COG0638, PRE1, 20S proteasome, alpha and beta subu 2e-11
cd01901164 cd01901, Ntn_hydrolase, The Ntn hydrolases (N-term 2e-11
pfam00227188 pfam00227, Proteasome, Proteasome subunit 2e-10
cd01906182 cd01906, proteasome_protease_HslV, proteasome_prot 4e-10
pfam00227188 pfam00227, Proteasome, Proteasome subunit 2e-09
cd01906182 cd01906, proteasome_protease_HslV, proteasome_prot 1e-08
COG0638236 COG0638, PRE1, 20S proteasome, alpha and beta subu 2e-07
pfam00227188 pfam00227, Proteasome, Proteasome subunit 1e-06
cd01901164 cd01901, Ntn_hydrolase, The Ntn hydrolases (N-term 2e-05
COG0638236 COG0638, PRE1, 20S proteasome, alpha and beta subu 4e-05
cd03758193 cd03758, proteasome_beta_type_2, proteasome beta t 5e-04
TIGR03634185 TIGR03634, arc_protsome_B, proteasome endopeptidas 0.001
TIGR03634185 TIGR03634, arc_protsome_B, proteasome endopeptidas 0.001
cd03764188 cd03764, proteasome_beta_archeal, Archeal proteaso 0.004
PTZ00488247 PTZ00488, PTZ00488, Proteasome subunit beta type-5 0.004
>gnl|CDD|239729 cd03760, proteasome_beta_type_4, proteasome beta type-4 subunit Back     alignment and domain information
 Score =  174 bits (444), Expect = 2e-54
 Identities = 60/115 (52%), Positives = 81/115 (70%), Gaps = 1/115 (0%)

Query: 166 TGTSVLGLVFNGGVILAADSAGYYGSMMRFNDCPRIMQINKFTILGAGNDYADFQYLNDI 225
           TGTSV+ + +  GVI+AAD+ G YGS+ RF +  RI ++   T+LGA  DYADFQYL  +
Sbjct: 1   TGTSVIAIKYKDGVIIAADTLGSYGSLARFKNVERIFKVGDNTLLGASGDYADFQYLKRL 60

Query: 226 VKQKILDDDLHNDGFVLKPKSLHSWLTRVLYNRRSQFDPLWINAFVAGMQN-GEP 279
           + Q ++DD+  +DG  L PK +HS+LTRVLYNRRS+ +PLW    V G+ N GEP
Sbjct: 61  LDQLVIDDECLDDGHSLSPKEIHSYLTRVLYNRRSKMNPLWNTLVVGGVDNEGEP 115


The 20S proteasome, multisubunit proteolytic complex, is the central enzyme of nonlysosomal protein degradation in both the cytosol and nucleus. It is composed of 28 subunits arranged as four homoheptameric rings that stack on top of one another forming an elongated alpha-beta-beta-alpha cylinder with a central cavity. The proteasome alpha and beta subunits are members of the N-terminal nucleophile (Ntn)-hydrolase superfamily. Their N-terminal threonine residues are exposed as a nucleophile in peptide bond hydrolysis.Mammals have 7 alpha and 7 beta proteasome subunits while archaea have one of each. Length = 197

>gnl|CDD|238893 cd01912, proteasome_beta, proteasome beta subunit Back     alignment and domain information
>gnl|CDD|239729 cd03760, proteasome_beta_type_4, proteasome beta type-4 subunit Back     alignment and domain information
>gnl|CDD|239729 cd03760, proteasome_beta_type_4, proteasome beta type-4 subunit Back     alignment and domain information
>gnl|CDD|238887 cd01906, proteasome_protease_HslV, proteasome_protease_HslV Back     alignment and domain information
>gnl|CDD|238893 cd01912, proteasome_beta, proteasome beta subunit Back     alignment and domain information
>gnl|CDD|238893 cd01912, proteasome_beta, proteasome beta subunit Back     alignment and domain information
>gnl|CDD|223711 COG0638, PRE1, 20S proteasome, alpha and beta subunits [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|238884 cd01901, Ntn_hydrolase, The Ntn hydrolases (N-terminal nucleophile) are a diverse superfamily of of enzymes that are activated autocatalytically via an N-terminally lcated nucleophilic amino acid Back     alignment and domain information
>gnl|CDD|215805 pfam00227, Proteasome, Proteasome subunit Back     alignment and domain information
>gnl|CDD|238887 cd01906, proteasome_protease_HslV, proteasome_protease_HslV Back     alignment and domain information
>gnl|CDD|215805 pfam00227, Proteasome, Proteasome subunit Back     alignment and domain information
>gnl|CDD|238887 cd01906, proteasome_protease_HslV, proteasome_protease_HslV Back     alignment and domain information
>gnl|CDD|223711 COG0638, PRE1, 20S proteasome, alpha and beta subunits [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|215805 pfam00227, Proteasome, Proteasome subunit Back     alignment and domain information
>gnl|CDD|238884 cd01901, Ntn_hydrolase, The Ntn hydrolases (N-terminal nucleophile) are a diverse superfamily of of enzymes that are activated autocatalytically via an N-terminally lcated nucleophilic amino acid Back     alignment and domain information
>gnl|CDD|223711 COG0638, PRE1, 20S proteasome, alpha and beta subunits [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>gnl|CDD|239727 cd03758, proteasome_beta_type_2, proteasome beta type-2 subunit Back     alignment and domain information
>gnl|CDD|234287 TIGR03634, arc_protsome_B, proteasome endopeptidase complex, archaeal, beta subunit Back     alignment and domain information
>gnl|CDD|234287 TIGR03634, arc_protsome_B, proteasome endopeptidase complex, archaeal, beta subunit Back     alignment and domain information
>gnl|CDD|239733 cd03764, proteasome_beta_archeal, Archeal proteasome, beta subunit Back     alignment and domain information
>gnl|CDD|185666 PTZ00488, PTZ00488, Proteasome subunit beta type-5; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 279
KOG0175|consensus285 99.94
PTZ00488247 Proteasome subunit beta type-5; Provisional 99.93
COG0638236 PRE1 20S proteasome, alpha and beta subunits [Post 99.91
cd03757212 proteasome_beta_type_1 proteasome beta type-1 subu 99.9
KOG0185|consensus 256 99.9
cd03760197 proteasome_beta_type_4 proteasome beta type-4 subu 99.9
cd03761188 proteasome_beta_type_5 proteasome beta type-5 subu 99.9
cd03759195 proteasome_beta_type_3 proteasome beta type-3 subu 99.89
cd03750227 proteasome_alpha_type_2 proteasome_alpha_type_2. T 99.89
TIGR03634185 arc_protsome_B proteasome endopeptidase complex, a 99.89
KOG0185|consensus256 99.88
cd03752213 proteasome_alpha_type_4 proteasome_alpha_type_4. T 99.88
PRK05456172 ATP-dependent protease subunit HslV; Provisional 99.88
cd03751212 proteasome_alpha_type_3 proteasome_alpha_type_3. T 99.88
cd03763189 proteasome_beta_type_7 proteasome beta type-7 subu 99.88
cd03758193 proteasome_beta_type_2 proteasome beta type-2 subu 99.88
cd03762188 proteasome_beta_type_6 proteasome beta type-6 subu 99.88
TIGR03690219 20S_bact_beta proteasome, beta subunit, bacterial 99.88
cd03764188 proteasome_beta_archeal Archeal proteasome, beta s 99.87
PTZ00246253 proteasome subunit alpha; Provisional 99.87
cd03756211 proteasome_alpha_archeal proteasome_alpha_archeal. 99.87
cd01911209 proteasome_alpha proteasome alpha subunit. The 20S 99.87
KOG0174|consensus224 99.87
cd03755207 proteasome_alpha_type_7 proteasome_alpha_type_7. T 99.87
KOG0179|consensus235 99.87
TIGR03633224 arc_protsome_A proteasome endopeptidase complex, a 99.87
KOG0177|consensus200 99.86
PF00227190 Proteasome: Proteasome subunit; InterPro: IPR00135 99.86
cd01913171 protease_HslV Protease HslV and the ATPase/chapero 99.86
cd03749211 proteasome_alpha_type_1 proteasome_alpha_type_1. T 99.85
cd03753213 proteasome_alpha_type_5 proteasome_alpha_type_5. T 99.85
TIGR03692171 ATP_dep_HslV ATP-dependent protease HslVU, peptida 99.85
PRK03996241 proteasome subunit alpha; Provisional 99.85
KOG0173|consensus271 99.84
cd01912189 proteasome_beta proteasome beta subunit. The 20S p 99.84
cd03754215 proteasome_alpha_type_6 proteasome_alpha_type_6. T 99.84
cd03760197 proteasome_beta_type_4 proteasome beta type-4 subu 99.82
cd01906182 proteasome_protease_HslV proteasome_protease_HslV. 99.82
TIGR03691228 20S_bact_alpha proteasome, alpha subunit, bacteria 99.81
cd03750227 proteasome_alpha_type_2 proteasome_alpha_type_2. T 99.8
cd03759195 proteasome_beta_type_3 proteasome beta type-3 subu 99.8
KOG0176|consensus241 99.8
cd03757212 proteasome_beta_type_1 proteasome beta type-1 subu 99.79
cd03761188 proteasome_beta_type_5 proteasome beta type-5 subu 99.79
TIGR03634185 arc_protsome_B proteasome endopeptidase complex, a 99.79
cd03751212 proteasome_alpha_type_3 proteasome_alpha_type_3. T 99.78
PTZ00488247 Proteasome subunit beta type-5; Provisional 99.78
cd03755207 proteasome_alpha_type_7 proteasome_alpha_type_7. T 99.78
cd03765236 proteasome_beta_bacterial Bacterial proteasome, be 99.78
cd03764188 proteasome_beta_archeal Archeal proteasome, beta s 99.78
COG0638236 PRE1 20S proteasome, alpha and beta subunits [Post 99.77
cd03756211 proteasome_alpha_archeal proteasome_alpha_archeal. 99.77
TIGR03633224 arc_protsome_A proteasome endopeptidase complex, a 99.77
cd03758193 proteasome_beta_type_2 proteasome beta type-2 subu 99.76
cd01911209 proteasome_alpha proteasome alpha subunit. The 20S 99.75
PRK03996241 proteasome subunit alpha; Provisional 99.75
cd03762188 proteasome_beta_type_6 proteasome beta type-6 subu 99.75
TIGR03690 219 20S_bact_beta proteasome, beta subunit, bacterial 99.74
cd03754215 proteasome_alpha_type_6 proteasome_alpha_type_6. T 99.74
KOG0180|consensus204 99.74
cd03752213 proteasome_alpha_type_4 proteasome_alpha_type_4. T 99.74
cd03749211 proteasome_alpha_type_1 proteasome_alpha_type_1. T 99.74
KOG0179|consensus235 99.73
cd03763189 proteasome_beta_type_7 proteasome beta type-7 subu 99.73
cd03753213 proteasome_alpha_type_5 proteasome_alpha_type_5. T 99.73
PTZ00246 253 proteasome subunit alpha; Provisional 99.72
cd01912189 proteasome_beta proteasome beta subunit. The 20S p 99.71
cd01906182 proteasome_protease_HslV proteasome_protease_HslV. 99.69
PF00227190 Proteasome: Proteasome subunit; InterPro: IPR00135 99.67
KOG0174|consensus224 99.65
KOG0177|consensus200 99.63
KOG0176|consensus241 99.61
KOG0184|consensus254 99.61
KOG0175|consensus 285 99.58
cd03765 236 proteasome_beta_bacterial Bacterial proteasome, be 99.57
KOG0184|consensus 254 99.57
KOG0178|consensus249 99.56
KOG0181|consensus233 99.54
TIGR03691228 20S_bact_alpha proteasome, alpha subunit, bacteria 99.52
KOG0183|consensus249 99.52
cd01901164 Ntn_hydrolase The Ntn hydrolases (N-terminal nucle 99.51
KOG0180|consensus204 99.47
KOG0178|consensus 249 99.45
KOG0183|consensus 249 99.41
cd01901164 Ntn_hydrolase The Ntn hydrolases (N-terminal nucle 99.4
KOG0181|consensus233 99.37
PRK05456172 ATP-dependent protease subunit HslV; Provisional 99.34
cd01913171 protease_HslV Protease HslV and the ATPase/chapero 99.34
TIGR03692171 ATP_dep_HslV ATP-dependent protease HslVU, peptida 99.32
KOG0173|consensus 271 99.26
KOG0182|consensus246 99.21
KOG0182|consensus246 99.14
KOG0863|consensus 264 99.09
KOG0863|consensus264 99.04
COG5405178 HslV ATP-dependent protease HslVU (ClpYQ), peptida 98.31
COG5405178 HslV ATP-dependent protease HslVU (ClpYQ), peptida 96.32
>KOG0175|consensus Back     alignment and domain information
Probab=99.94  E-value=5.2e-28  Score=208.32  Aligned_cols=172  Identities=19%  Similarity=0.259  Sum_probs=141.7

Q ss_pred             CCCCCCeeecCCCCCCCcc-c-cCC--CcCc--CccCCccEEEEEeCCeEEEEEeCCCccCCceeeCCCCceEEecCceE
Q psy9489          67 NGPSLGKYHDFPNVLPHYF-R-RSG--SFST--PLTTGTSVLGLVFNGGVILAADSAGYYGSMMRFNDCPRIMQINKFTI  140 (279)
Q Consensus        67 ~g~~~~~f~~~~~~~~~~~-~-~~~--~~~~--~~~~G~t~lgi~~~~gVvlaaD~r~~~~~~i~~~~~~Ki~~i~~~~~  140 (279)
                      +..+|  +..||+.+|.+| + ...  ....  .+.+|||+||++|++|||+|+|+|+|.|++|.++.++||..||++++
T Consensus        36 ~f~~~--~~~P~~~~p~~~l~~~~~~~~~~~~i~~~hGTTTLAF~f~~GvivAvDSRAs~G~YIasqtv~KVIeIn~ylL  113 (285)
T KOG0175|consen   36 RFANP--LALPPGESPQTFLFAITDDETAGVLIKFAHGTTTLAFKFKGGVIVAVDSRASAGSYIASQTVKKVIEINPYLL  113 (285)
T ss_pred             cccCc--ccCCCCCCchhhhhhccCCCcccceeeecCCceEEEEEecCcEEEEEeccccccceeechhhceeeeechhhh
Confidence            33555  888999999888 2 221  1111  24599999999999999999999999999999999999999999999


Q ss_pred             eeecCcccccccchhhhhc--------cccccc---------------------ceeeEEEEEeCCcEEEEEcCCCccCc
Q psy9489         141 LGAGNDYADFQYLNDIVKQ--------KITPLT---------------------TGTSVLGLVFNGGVILAADSAGYYGS  191 (279)
Q Consensus       141 ~~~sG~~aD~~~l~~~l~~--------~~~pi~---------------------~g~tvlgi~~~~gvlia~D~~gs~g~  191 (279)
                      .++||.+||||+|.+.+.+        +.+.++                     .|+.+.|.+-+++-|+.+|.-|+-  
T Consensus       114 GTmAGgAADCqfWer~L~kecRL~eLRnkeriSVsaASKllsN~~y~YkGmGLsmGtMi~G~Dk~GP~lyYVDseG~R--  191 (285)
T KOG0175|consen  114 GTMAGGAADCQFWERVLAKECRLHELRNKERISVSAASKLLSNMVYQYKGMGLSMGTMIAGWDKKGPGLYYVDSEGTR--  191 (285)
T ss_pred             hcccCcchhhHHHHHHHHHHHHHHHHhcCcceehHHHHHHHHHHHhhccCcchhheeeEeeccCCCCceEEEcCCCCE--
Confidence            9999999999999999885        122222                     334444555556666666666643  


Q ss_pred             eeeecCCCceEEecccEEEEeccChhhHHHHHHHHHhhcccccccccCCCCCHHHHHHHHHHHHhhc
Q psy9489         192 MMRFNDCPRIMQINKFTILGAGNDYADFQYLNDIVKQKILDDDLHNDGFVLKPKSLHSWLTRVLYNR  258 (279)
Q Consensus       192 li~~~~~~kI~~i~~~~~~~gSG~~aD~~~l~~~l~~~~~~~~~~ee~~~l~~~~la~~isr~lys~  258 (279)
                                  +..+++.+|||+    .+++++|++.|+++|+.+|+.+|..++|+++.+|+.||.
T Consensus       192 ------------l~G~~FSVGSGs----~yAYGVLDsgYr~dls~eEA~~L~rrAI~hAThRDaySG  242 (285)
T KOG0175|consen  192 ------------LSGDLFSVGSGS----TYAYGVLDSGYRYDLSDEEAYDLARRAIYHATHRDAYSG  242 (285)
T ss_pred             ------------ecCceEeecCCC----ceeEEeeccCCCCCCCHHHHHHHHHHHHHHHHhcccccC
Confidence                        677899999999    999999999999999999999999999999999999975



>PTZ00488 Proteasome subunit beta type-5; Provisional Back     alignment and domain information
>COG0638 PRE1 20S proteasome, alpha and beta subunits [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03757 proteasome_beta_type_1 proteasome beta type-1 subunit Back     alignment and domain information
>KOG0185|consensus Back     alignment and domain information
>cd03760 proteasome_beta_type_4 proteasome beta type-4 subunit Back     alignment and domain information
>cd03761 proteasome_beta_type_5 proteasome beta type-5 subunit Back     alignment and domain information
>cd03759 proteasome_beta_type_3 proteasome beta type-3 subunit Back     alignment and domain information
>cd03750 proteasome_alpha_type_2 proteasome_alpha_type_2 Back     alignment and domain information
>TIGR03634 arc_protsome_B proteasome endopeptidase complex, archaeal, beta subunit Back     alignment and domain information
>KOG0185|consensus Back     alignment and domain information
>cd03752 proteasome_alpha_type_4 proteasome_alpha_type_4 Back     alignment and domain information
>PRK05456 ATP-dependent protease subunit HslV; Provisional Back     alignment and domain information
>cd03751 proteasome_alpha_type_3 proteasome_alpha_type_3 Back     alignment and domain information
>cd03763 proteasome_beta_type_7 proteasome beta type-7 subunit Back     alignment and domain information
>cd03758 proteasome_beta_type_2 proteasome beta type-2 subunit Back     alignment and domain information
>cd03762 proteasome_beta_type_6 proteasome beta type-6 subunit Back     alignment and domain information
>TIGR03690 20S_bact_beta proteasome, beta subunit, bacterial type Back     alignment and domain information
>cd03764 proteasome_beta_archeal Archeal proteasome, beta subunit Back     alignment and domain information
>PTZ00246 proteasome subunit alpha; Provisional Back     alignment and domain information
>cd03756 proteasome_alpha_archeal proteasome_alpha_archeal Back     alignment and domain information
>cd01911 proteasome_alpha proteasome alpha subunit Back     alignment and domain information
>KOG0174|consensus Back     alignment and domain information
>cd03755 proteasome_alpha_type_7 proteasome_alpha_type_7 Back     alignment and domain information
>KOG0179|consensus Back     alignment and domain information
>TIGR03633 arc_protsome_A proteasome endopeptidase complex, archaeal, alpha subunit Back     alignment and domain information
>KOG0177|consensus Back     alignment and domain information
>PF00227 Proteasome: Proteasome subunit; InterPro: IPR001353 ATP-dependent protease complexes are present in all three kingdoms of life, where they rid the cell of misfolded or damaged proteins and control the level of certain regulatory proteins Back     alignment and domain information
>cd01913 protease_HslV Protease HslV and the ATPase/chaperone HslU are part of an ATP-dependent proteolytic system that is the prokaryotic homolog of the proteasome Back     alignment and domain information
>cd03749 proteasome_alpha_type_1 proteasome_alpha_type_1 Back     alignment and domain information
>cd03753 proteasome_alpha_type_5 proteasome_alpha_type_5 Back     alignment and domain information
>TIGR03692 ATP_dep_HslV ATP-dependent protease HslVU, peptidase subunit Back     alignment and domain information
>PRK03996 proteasome subunit alpha; Provisional Back     alignment and domain information
>KOG0173|consensus Back     alignment and domain information
>cd01912 proteasome_beta proteasome beta subunit Back     alignment and domain information
>cd03754 proteasome_alpha_type_6 proteasome_alpha_type_6 Back     alignment and domain information
>cd03760 proteasome_beta_type_4 proteasome beta type-4 subunit Back     alignment and domain information
>cd01906 proteasome_protease_HslV proteasome_protease_HslV Back     alignment and domain information
>TIGR03691 20S_bact_alpha proteasome, alpha subunit, bacterial type Back     alignment and domain information
>cd03750 proteasome_alpha_type_2 proteasome_alpha_type_2 Back     alignment and domain information
>cd03759 proteasome_beta_type_3 proteasome beta type-3 subunit Back     alignment and domain information
>KOG0176|consensus Back     alignment and domain information
>cd03757 proteasome_beta_type_1 proteasome beta type-1 subunit Back     alignment and domain information
>cd03761 proteasome_beta_type_5 proteasome beta type-5 subunit Back     alignment and domain information
>TIGR03634 arc_protsome_B proteasome endopeptidase complex, archaeal, beta subunit Back     alignment and domain information
>cd03751 proteasome_alpha_type_3 proteasome_alpha_type_3 Back     alignment and domain information
>PTZ00488 Proteasome subunit beta type-5; Provisional Back     alignment and domain information
>cd03755 proteasome_alpha_type_7 proteasome_alpha_type_7 Back     alignment and domain information
>cd03765 proteasome_beta_bacterial Bacterial proteasome, beta subunit Back     alignment and domain information
>cd03764 proteasome_beta_archeal Archeal proteasome, beta subunit Back     alignment and domain information
>COG0638 PRE1 20S proteasome, alpha and beta subunits [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03756 proteasome_alpha_archeal proteasome_alpha_archeal Back     alignment and domain information
>TIGR03633 arc_protsome_A proteasome endopeptidase complex, archaeal, alpha subunit Back     alignment and domain information
>cd03758 proteasome_beta_type_2 proteasome beta type-2 subunit Back     alignment and domain information
>cd01911 proteasome_alpha proteasome alpha subunit Back     alignment and domain information
>PRK03996 proteasome subunit alpha; Provisional Back     alignment and domain information
>cd03762 proteasome_beta_type_6 proteasome beta type-6 subunit Back     alignment and domain information
>TIGR03690 20S_bact_beta proteasome, beta subunit, bacterial type Back     alignment and domain information
>cd03754 proteasome_alpha_type_6 proteasome_alpha_type_6 Back     alignment and domain information
>KOG0180|consensus Back     alignment and domain information
>cd03752 proteasome_alpha_type_4 proteasome_alpha_type_4 Back     alignment and domain information
>cd03749 proteasome_alpha_type_1 proteasome_alpha_type_1 Back     alignment and domain information
>KOG0179|consensus Back     alignment and domain information
>cd03763 proteasome_beta_type_7 proteasome beta type-7 subunit Back     alignment and domain information
>cd03753 proteasome_alpha_type_5 proteasome_alpha_type_5 Back     alignment and domain information
>PTZ00246 proteasome subunit alpha; Provisional Back     alignment and domain information
>cd01912 proteasome_beta proteasome beta subunit Back     alignment and domain information
>cd01906 proteasome_protease_HslV proteasome_protease_HslV Back     alignment and domain information
>PF00227 Proteasome: Proteasome subunit; InterPro: IPR001353 ATP-dependent protease complexes are present in all three kingdoms of life, where they rid the cell of misfolded or damaged proteins and control the level of certain regulatory proteins Back     alignment and domain information
>KOG0174|consensus Back     alignment and domain information
>KOG0177|consensus Back     alignment and domain information
>KOG0176|consensus Back     alignment and domain information
>KOG0184|consensus Back     alignment and domain information
>KOG0175|consensus Back     alignment and domain information
>cd03765 proteasome_beta_bacterial Bacterial proteasome, beta subunit Back     alignment and domain information
>KOG0184|consensus Back     alignment and domain information
>KOG0178|consensus Back     alignment and domain information
>KOG0181|consensus Back     alignment and domain information
>TIGR03691 20S_bact_alpha proteasome, alpha subunit, bacterial type Back     alignment and domain information
>KOG0183|consensus Back     alignment and domain information
>cd01901 Ntn_hydrolase The Ntn hydrolases (N-terminal nucleophile) are a diverse superfamily of of enzymes that are activated autocatalytically via an N-terminally lcated nucleophilic amino acid Back     alignment and domain information
>KOG0180|consensus Back     alignment and domain information
>KOG0178|consensus Back     alignment and domain information
>KOG0183|consensus Back     alignment and domain information
>cd01901 Ntn_hydrolase The Ntn hydrolases (N-terminal nucleophile) are a diverse superfamily of of enzymes that are activated autocatalytically via an N-terminally lcated nucleophilic amino acid Back     alignment and domain information
>KOG0181|consensus Back     alignment and domain information
>PRK05456 ATP-dependent protease subunit HslV; Provisional Back     alignment and domain information
>cd01913 protease_HslV Protease HslV and the ATPase/chaperone HslU are part of an ATP-dependent proteolytic system that is the prokaryotic homolog of the proteasome Back     alignment and domain information
>TIGR03692 ATP_dep_HslV ATP-dependent protease HslVU, peptidase subunit Back     alignment and domain information
>KOG0173|consensus Back     alignment and domain information
>KOG0182|consensus Back     alignment and domain information
>KOG0182|consensus Back     alignment and domain information
>KOG0863|consensus Back     alignment and domain information
>KOG0863|consensus Back     alignment and domain information
>COG5405 HslV ATP-dependent protease HslVU (ClpYQ), peptidase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5405 HslV ATP-dependent protease HslVU (ClpYQ), peptidase subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query279
1iru_N219 Crystal Structure Of The Mammalian 20s Proteasome A 3e-33
3unb_M219 Mouse Constitutive 20s Proteasome In Complex With P 3e-33
1ryp_N 233 Crystal Structure Of The 20s Proteasome From Yeast 6e-20
1g0u_M 266 A Gated Channel Into The Proteasome Core Particle L 6e-20
3nzj_H261 Crystal Structure Of Yeast 20s Proteasome In Comple 3e-04
3nzj_H 261 Crystal Structure Of Yeast 20s Proteasome In Comple 6e-04
>pdb|1IRU|N Chain N, Crystal Structure Of The Mammalian 20s Proteasome At 2.75 A Resolution Length = 219 Back     alignment and structure

Iteration: 1

Score = 138 bits (348), Expect = 3e-33, Method: Compositional matrix adjust. Identities = 59/116 (50%), Positives = 83/116 (71%) Query: 163 PLTTGTSVLGLVFNGGVILAADSAGYYGSMMRFNDCPRIMQINKFTILGAGNDYADFQYL 222 P+ TGTSVLG+ F GGV++AAD G YGS+ RF + RIM++N T+LGA DYADFQYL Sbjct: 4 PMVTGTSVLGVKFEGGVVIAADMLGSYGSLARFRNISRIMRVNNSTMLGASGDYADFQYL 63 Query: 223 NDIVKQKILDDDLHNDGFVLKPKSLHSWLTRVLYNRRSQFDPLWINAFVAGMQNGE 278 ++ Q ++D++L DG P+++HSWLTR +Y+RRS+ +PLW + G +GE Sbjct: 64 KQVLGQMVIDEELLGDGHSYSPRAIHSWLTRAMYSRRSKMNPLWNTMVIGGYADGE 119
>pdb|3UNB|M Chain M, Mouse Constitutive 20s Proteasome In Complex With Pr-957 Length = 219 Back     alignment and structure
>pdb|1RYP|N Chain N, Crystal Structure Of The 20s Proteasome From Yeast At 2.4 Angstroms Resolution Length = 233 Back     alignment and structure
>pdb|1G0U|M Chain M, A Gated Channel Into The Proteasome Core Particle Length = 266 Back     alignment and structure
>pdb|3NZJ|H Chain H, Crystal Structure Of Yeast 20s Proteasome In Complex With Ligand 2a Length = 261 Back     alignment and structure
>pdb|3NZJ|H Chain H, Crystal Structure Of Yeast 20s Proteasome In Complex With Ligand 2a Length = 261 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query279
1iru_N219 20S proteasome; cell cycle, immune response, prote 6e-40
1iru_N219 20S proteasome; cell cycle, immune response, prote 3e-21
1iru_N219 20S proteasome; cell cycle, immune response, prote 8e-18
1ryp_N 233 20S proteasome; multicatalytic proteinase, protein 1e-36
1ryp_N233 20S proteasome; multicatalytic proteinase, protein 8e-21
1ryp_N233 20S proteasome; multicatalytic proteinase, protein 5e-15
1g0u_M 266 Proteasome component PRE4; ubiquitin, degradation, 1e-35
1g0u_M266 Proteasome component PRE4; ubiquitin, degradation, 8e-21
1g0u_M266 Proteasome component PRE4; ubiquitin, degradation, 9e-15
1iru_K201 20S proteasome; cell cycle, immune response, prote 2e-25
1iru_K201 20S proteasome; cell cycle, immune response, prote 6e-14
1iru_K201 20S proteasome; cell cycle, immune response, prote 7e-12
1ryp_K198 20S proteasome; multicatalytic proteinase, protein 7e-25
1ryp_K198 20S proteasome; multicatalytic proteinase, protein 1e-13
1ryp_K198 20S proteasome; multicatalytic proteinase, protein 5e-12
1iru_M213 20S proteasome; cell cycle, immune response, prote 2e-18
1iru_M213 20S proteasome; cell cycle, immune response, prote 4e-12
1iru_M213 20S proteasome; cell cycle, immune response, prote 6e-07
1ryp_M 222 20S proteasome; multicatalytic proteinase, protein 2e-13
1ryp_M222 20S proteasome; multicatalytic proteinase, protein 3e-09
1ryp_J204 20S proteasome; multicatalytic proteinase, protein 3e-13
1ryp_J204 20S proteasome; multicatalytic proteinase, protein 2e-09
1iru_I 234 20S proteasome; cell cycle, immune response, prote 1e-12
1iru_I234 20S proteasome; cell cycle, immune response, prote 1e-08
1iru_I234 20S proteasome; cell cycle, immune response, prote 8e-06
1iru_J205 20S proteasome; cell cycle, immune response, prote 2e-11
1iru_J205 20S proteasome; cell cycle, immune response, prote 6e-08
3nzj_H261 Proteasome component PUP1; ubiquitin, protein degr 3e-10
3nzj_H 261 Proteasome component PUP1; ubiquitin, protein degr 8e-10
3nzj_K 287 Proteasome component PRE2; ubiquitin, protein degr 2e-09
3nzj_K287 Proteasome component PRE2; ubiquitin, protein degr 5e-08
1ryp_H205 20S proteasome; multicatalytic proteinase, protein 3e-09
1ryp_H205 20S proteasome; multicatalytic proteinase, protein 1e-08
2jay_A291 Proteasome; hydrolase; 1.99A {Mycobacterium tuberc 5e-09
2jay_A 291 Proteasome; hydrolase; 1.99A {Mycobacterium tuberc 1e-08
3unf_N199 Proteasome subunit beta type-9; antigen presentati 8e-09
3unf_N199 Proteasome subunit beta type-9; antigen presentati 8e-07
1yar_H217 Proteasome beta subunit; proteasome 20S, PA26 prot 9e-09
1yar_H217 Proteasome beta subunit; proteasome 20S, PA26 prot 5e-08
1iru_H205 20S proteasome; cell cycle, immune response, prote 2e-08
1iru_H205 20S proteasome; cell cycle, immune response, prote 1e-06
1ryp_L 212 20S proteasome; multicatalytic proteinase, protein 4e-08
1ryp_L212 20S proteasome; multicatalytic proteinase, protein 3e-06
1q5r_H 294 Proteasome beta-type subunit 1; proteasome assembl 6e-08
1q5r_H294 Proteasome beta-type subunit 1; proteasome assembl 4e-07
1j2q_H202 Proteasome beta subunit; ubiquitin, CP, hydrolase; 1e-07
1j2q_H202 Proteasome beta subunit; ubiquitin, CP, hydrolase; 2e-06
3h4p_A 264 Proteasome subunit alpha; core particle, cytoplasm 1e-07
3h4p_A264 Proteasome subunit alpha; core particle, cytoplasm 2e-06
1iru_L204 20S proteasome; cell cycle, immune response, prote 2e-07
1iru_L204 20S proteasome; cell cycle, immune response, prote 3e-06
1ryp_I 222 20S proteasome; multicatalytic proteinase, protein 4e-07
1ryp_I222 20S proteasome; multicatalytic proteinase, protein 4e-06
1q5q_H 235 Proteasome beta-type subunit 1; proteasome assembl 2e-06
1q5q_H235 Proteasome beta-type subunit 1; proteasome assembl 2e-05
3unf_H234 Proteasome subunit beta type-10; antigen presentat 3e-06
>1iru_N 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_M* 3une_M 3unf_M* 3unh_M Length = 219 Back     alignment and structure
 Score =  137 bits (347), Expect = 6e-40
 Identities = 59/118 (50%), Positives = 83/118 (70%)

Query: 162 TPLTTGTSVLGLVFNGGVILAADSAGYYGSMMRFNDCPRIMQINKFTILGAGNDYADFQY 221
            P+ TGTSVLG+ F GGV++AAD  G YGS+ RF +  RIM++N  T+LGA  DYADFQY
Sbjct: 3   NPMVTGTSVLGVKFEGGVVIAADMLGSYGSLARFRNISRIMRVNNSTMLGASGDYADFQY 62

Query: 222 LNDIVKQKILDDDLHNDGFVLKPKSLHSWLTRVLYNRRSQFDPLWINAFVAGMQNGEP 279
           L  ++ Q ++D++L  DG    P+++HSWLTR +Y+RRS+ +PLW    + G  +GE 
Sbjct: 63  LKQVLGQMVIDEELLGDGHSYSPRAIHSWLTRAMYSRRSKMNPLWNTMVIGGYADGES 120


>1iru_N 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_M* 3une_M 3unf_M* 3unh_M Length = 219 Back     alignment and structure
>1iru_N 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_M* 3une_M 3unf_M* 3unh_M Length = 219 Back     alignment and structure
>1ryp_N 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_N* 1jd2_M* 1g65_M 1vsy_N 1z7q_N 2f16_M* 2fak_M* 2fny_M* 2gpl_M* 3d29_M* 3dy3_M* 3dy4_M* 3e47_M* 3gpj_M* 3gpt_M* 3gpw_M* 3hye_M* 3l5q_R 3mg0_M* 3mg4_M* ... Length = 233 Back     alignment and structure
>1ryp_N 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_N* 1jd2_M* 1g65_M 1vsy_N 1z7q_N 2f16_M* 2fak_M* 2fny_M* 2gpl_M* 3d29_M* 3dy3_M* 3dy4_M* 3e47_M* 3gpj_M* 3gpt_M* 3gpw_M* 3hye_M* 3l5q_R 3mg0_M* 3mg4_M* ... Length = 233 Back     alignment and structure
>1ryp_N 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_N* 1jd2_M* 1g65_M 1vsy_N 1z7q_N 2f16_M* 2fak_M* 2fny_M* 2gpl_M* 3d29_M* 3dy3_M* 3dy4_M* 3e47_M* 3gpj_M* 3gpt_M* 3gpw_M* 3hye_M* 3l5q_R 3mg0_M* 3mg4_M* ... Length = 233 Back     alignment and structure
>1g0u_M Proteasome component PRE4; ubiquitin, degradation, protease, NTN-hydrolase; 2.40A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 2zcy_M* 3bdm_M* 3mg6_M* 3mg7_M* 3mg8_M* 3nzj_M* 3nzw_M* 3nzx_M* Length = 266 Back     alignment and structure
>1g0u_M Proteasome component PRE4; ubiquitin, degradation, protease, NTN-hydrolase; 2.40A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 2zcy_M* 3bdm_M* 3mg6_M* 3mg7_M* 3mg8_M* 3nzj_M* 3nzw_M* 3nzx_M* Length = 266 Back     alignment and structure
>1g0u_M Proteasome component PRE4; ubiquitin, degradation, protease, NTN-hydrolase; 2.40A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 2zcy_M* 3bdm_M* 3mg6_M* 3mg7_M* 3mg8_M* 3nzj_M* 3nzw_M* 3nzx_M* Length = 266 Back     alignment and structure
>1iru_K 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_J* 3une_J 3unf_J* 3unh_J Length = 201 Back     alignment and structure
>1iru_K 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_J* 3une_J 3unf_J* 3unh_J Length = 201 Back     alignment and structure
>1iru_K 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_J* 3une_J 3unf_J* 3unh_J Length = 201 Back     alignment and structure
>1ryp_K 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_K 1g0u_J* 1jd2_J* 1g65_J 1vsy_K 1z7q_K 2f16_J* 2fak_J* 2fny_J* 2gpl_J* 2zcy_J* 3bdm_J* 3d29_J* 3dy3_J* 3dy4_J* 3e47_J* 3gpj_J* 3gpt_J* 3gpw_J* 3hye_J* ... Length = 198 Back     alignment and structure
>1ryp_K 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_K 1g0u_J* 1jd2_J* 1g65_J 1vsy_K 1z7q_K 2f16_J* 2fak_J* 2fny_J* 2gpl_J* 2zcy_J* 3bdm_J* 3d29_J* 3dy3_J* 3dy4_J* 3e47_J* 3gpj_J* 3gpt_J* 3gpw_J* 3hye_J* ... Length = 198 Back     alignment and structure
>1ryp_K 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_K 1g0u_J* 1jd2_J* 1g65_J 1vsy_K 1z7q_K 2f16_J* 2fak_J* 2fny_J* 2gpl_J* 2zcy_J* 3bdm_J* 3d29_J* 3dy3_J* 3dy4_J* 3e47_J* 3gpj_J* 3gpt_J* 3gpw_J* 3hye_J* ... Length = 198 Back     alignment and structure
>1iru_M 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_L* 3une_L 3unf_L* 3unh_L Length = 213 Back     alignment and structure
>1iru_M 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_L* 3une_L 3unf_L* 3unh_L Length = 213 Back     alignment and structure
>1iru_M 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_L* 3une_L 3unf_L* 3unh_L Length = 213 Back     alignment and structure
>1ryp_M 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_M* 1jd2_L* 1g65_L 1vsy_M 1z7q_M 2f16_L* 2fak_L* 2fny_L* 2gpl_L* 3d29_L* 3dy3_L* 3dy4_L* 3e47_L* 3gpj_L* 3gpt_L* 3gpw_L* 3hye_L* 3l5q_Q 3mg0_L* 3mg4_L* ... Length = 222 Back     alignment and structure
>1ryp_M 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_M* 1jd2_L* 1g65_L 1vsy_M 1z7q_M 2f16_L* 2fak_L* 2fny_L* 2gpl_L* 3d29_L* 3dy3_L* 3dy4_L* 3e47_L* 3gpj_L* 3gpt_L* 3gpw_L* 3hye_L* 3l5q_Q 3mg0_L* 3mg4_L* ... Length = 222 Back     alignment and structure
>1ryp_J 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_I* 1g65_I 1vsy_J 2f16_I* 2fak_I* 2fny_I* 2gpl_I* 3d29_I* 3dy3_I* 3dy4_I* 3e47_I* 3gpj_I* 3gpt_I* 3gpw_I* 3hye_I* 3l5q_N 3mg0_I* 3mg4_I* 3oeu_I* 3oev_I* ... Length = 204 Back     alignment and structure
>1ryp_J 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_I* 1g65_I 1vsy_J 2f16_I* 2fak_I* 2fny_I* 2gpl_I* 3d29_I* 3dy3_I* 3dy4_I* 3e47_I* 3gpj_I* 3gpt_I* 3gpw_I* 3hye_I* 3l5q_N 3mg0_I* 3mg4_I* 3oeu_I* 3oev_I* ... Length = 204 Back     alignment and structure
>1iru_I 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_H* 3une_H Length = 234 Back     alignment and structure
>1iru_I 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_H* 3une_H Length = 234 Back     alignment and structure
>1iru_I 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_H* 3une_H Length = 234 Back     alignment and structure
>1iru_J 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_I* 3une_I 3unf_I* 3unh_I Length = 205 Back     alignment and structure
>1iru_J 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_I* 3une_I 3unf_I* 3unh_I Length = 205 Back     alignment and structure
>3nzj_H Proteasome component PUP1; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 3nzw_H* 3nzx_H* Length = 261 Back     alignment and structure
>3nzj_H Proteasome component PUP1; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 3nzw_H* 3nzx_H* Length = 261 Back     alignment and structure
>3nzj_K Proteasome component PRE2; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 3nzw_K* 3nzx_K* Length = 287 Back     alignment and structure
>3nzj_K Proteasome component PRE2; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 3nzw_K* 3nzx_K* Length = 287 Back     alignment and structure
>1ryp_H 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 3nzj_N* 3nzw_N* 3nzx_N* 1vsy_H 3l5q_B 1g65_N* 1fnt_H 1g0u_N* 1jd2_N* 1z7q_H 2f16_N* 2fak_N* 2fny_N* 2gpl_N* 2zcy_N* 3bdm_N* 3d29_N* 3dy3_N* 3dy4_N* 3e47_N* ... Length = 205 Back     alignment and structure
>1ryp_H 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 3nzj_N* 3nzw_N* 3nzx_N* 1vsy_H 3l5q_B 1g65_N* 1fnt_H 1g0u_N* 1jd2_N* 1z7q_H 2f16_N* 2fak_N* 2fny_N* 2gpl_N* 2zcy_N* 3bdm_N* 3d29_N* 3dy3_N* 3dy4_N* 3e47_N* ... Length = 205 Back     alignment and structure
>2jay_A Proteasome; hydrolase; 1.99A {Mycobacterium tuberculosis} PDB: 3mka_C 3mi0_C* 2fhg_H* 2fhh_H 3krd_C* 3mfe_G 3hfa_H* 3h6i_C 3h6f_C 3hf9_H 3mfe_H Length = 291 Back     alignment and structure
>2jay_A Proteasome; hydrolase; 1.99A {Mycobacterium tuberculosis} PDB: 3mka_C 3mi0_C* 2fhg_H* 2fhh_H 3krd_C* 3mfe_G 3hfa_H* 3h6i_C 3h6f_C 3hf9_H 3mfe_H Length = 291 Back     alignment and structure
>3unf_N Proteasome subunit beta type-9; antigen presentation, drug development, protein degradation, hydrolase-hydrolase inhibitor complex; HET: 04C; 2.90A {Mus musculus} PDB: 3unh_N Length = 199 Back     alignment and structure
>3unf_N Proteasome subunit beta type-9; antigen presentation, drug development, protein degradation, hydrolase-hydrolase inhibitor complex; HET: 04C; 2.90A {Mus musculus} PDB: 3unh_N Length = 199 Back     alignment and structure
>1yar_H Proteasome beta subunit; proteasome 20S, PA26 proteasome activator 11S, hydrolase-HYD activator complex; 1.90A {Thermoplasma acidophilum} SCOP: d.153.1.4 PDB: 1ya7_H 1yau_H 3ipm_H 1pma_B 3jrm_H 3c92_H 3c91_H 3jse_H 3jtl_H Length = 217 Back     alignment and structure
>1yar_H Proteasome beta subunit; proteasome 20S, PA26 proteasome activator 11S, hydrolase-HYD activator complex; 1.90A {Thermoplasma acidophilum} SCOP: d.153.1.4 PDB: 1ya7_H 1yau_H 3ipm_H 1pma_B 3jrm_H 3c92_H 3c91_H 3jse_H 3jtl_H Length = 217 Back     alignment and structure
>1iru_H 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_N* 3une_N Length = 205 Back     alignment and structure
>1iru_H 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_N* 3une_N Length = 205 Back     alignment and structure
>1ryp_L 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_L 1vsy_L 1z7q_L 3l5q_P 1g65_K* 1g0u_K* 1jd2_K* 2f16_K* 2fak_K* 2fny_K* 2gpl_K* 2zcy_K* 3bdm_K* 3d29_K* 3dy3_K* 3dy4_K* 3e47_K* 3gpj_K* 3gpt_K* 3gpw_K* ... Length = 212 Back     alignment and structure
>1ryp_L 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_L 1vsy_L 1z7q_L 3l5q_P 1g65_K* 1g0u_K* 1jd2_K* 2f16_K* 2fak_K* 2fny_K* 2gpl_K* 2zcy_K* 3bdm_K* 3d29_K* 3dy3_K* 3dy4_K* 3e47_K* 3gpj_K* 3gpt_K* 3gpw_K* ... Length = 212 Back     alignment and structure
>1q5r_H Proteasome beta-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, hydrolase; 3.10A {Rhodococcus erythropolis} SCOP: d.153.1.4 PDB: 2h6j_H Length = 294 Back     alignment and structure
>1q5r_H Proteasome beta-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, hydrolase; 3.10A {Rhodococcus erythropolis} SCOP: d.153.1.4 PDB: 2h6j_H Length = 294 Back     alignment and structure
>1j2q_H Proteasome beta subunit; ubiquitin, CP, hydrolase; HET: CIB; 2.83A {Archaeoglobus fulgidus} SCOP: d.153.1.4 Length = 202 Back     alignment and structure
>1j2q_H Proteasome beta subunit; ubiquitin, CP, hydrolase; HET: CIB; 2.83A {Archaeoglobus fulgidus} SCOP: d.153.1.4 Length = 202 Back     alignment and structure
>3h4p_A Proteasome subunit alpha; core particle, cytoplasm, hydrolase, protease, threonine protease; 4.10A {Methanocaldococcus jannaschii} Length = 264 Back     alignment and structure
>3h4p_A Proteasome subunit alpha; core particle, cytoplasm, hydrolase, protease, threonine protease; 4.10A {Methanocaldococcus jannaschii} Length = 264 Back     alignment and structure
>1iru_L 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_K* 3une_K 3unf_K* 3unh_K Length = 204 Back     alignment and structure
>1iru_L 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_K* 3une_K 3unf_K* 3unh_K Length = 204 Back     alignment and structure
>1ryp_I 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1g0u_H* 1jd2_H* 1g65_H 1vsy_I 1z7q_I 2f16_H* 2fak_H* 2fny_H* 2gpl_H* 3d29_H* 3dy3_H* 3dy4_H* 3e47_H* 3gpj_H* 3gpt_H* 3gpw_H* 3hye_H* 3l5q_M 3mg0_H* 3mg4_H* ... Length = 222 Back     alignment and structure
>1ryp_I 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1g0u_H* 1jd2_H* 1g65_H 1vsy_I 1z7q_I 2f16_H* 2fak_H* 2fny_H* 2gpl_H* 3d29_H* 3dy3_H* 3dy4_H* 3e47_H* 3gpj_H* 3gpt_H* 3gpw_H* 3hye_H* 3l5q_M 3mg0_H* 3mg4_H* ... Length = 222 Back     alignment and structure
>1q5q_H Proteasome beta-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, RH erythropolis, hydrolase; 2.60A {Rhodococcus erythropolis} SCOP: d.153.1.4 Length = 235 Back     alignment and structure
>1q5q_H Proteasome beta-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, RH erythropolis, hydrolase; 2.60A {Rhodococcus erythropolis} SCOP: d.153.1.4 Length = 235 Back     alignment and structure
>3unf_H Proteasome subunit beta type-10; antigen presentation, drug development, protein degradation, hydrolase-hydrolase inhibitor complex; HET: 04C; 2.90A {Mus musculus} PDB: 3unh_H Length = 234 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query279
3nzj_K287 Proteasome component PRE2; ubiquitin, protein degr 99.93
1g0u_M266 Proteasome component PRE4; ubiquitin, degradation, 99.91
3nzj_H261 Proteasome component PUP1; ubiquitin, protein degr 99.91
1yar_H217 Proteasome beta subunit; proteasome 20S, PA26 prot 99.91
1iru_M213 20S proteasome; cell cycle, immune response, prote 99.91
1iru_N219 20S proteasome; cell cycle, immune response, prote 99.9
1ryp_H205 20S proteasome; multicatalytic proteinase, protein 99.9
1ryp_M222 20S proteasome; multicatalytic proteinase, protein 99.9
1iru_J205 20S proteasome; cell cycle, immune response, prote 99.89
3h4p_a219 Proteasome subunit beta; core particle, cytoplasm, 99.89
1ryp_N233 20S proteasome; multicatalytic proteinase, protein 99.89
1ryp_A243 20S proteasome; multicatalytic proteinase, protein 99.89
1iru_L204 20S proteasome; cell cycle, immune response, prote 99.88
3unf_H234 Proteasome subunit beta type-10; antigen presentat 99.88
1yar_A233 Proteasome alpha subunit; proteasome 20S, PA26 pro 99.88
1ryp_C244 20S proteasome; multicatalytic proteinase, protein 99.88
1j2q_H202 Proteasome beta subunit; ubiquitin, CP, hydrolase; 99.88
1iru_B233 20S proteasome; cell cycle, immune response, prote 99.88
1q5r_H294 Proteasome beta-type subunit 1; proteasome assembl 99.88
1iru_C261 20S proteasome; cell cycle, immune response, prote 99.88
1ryp_L212 20S proteasome; multicatalytic proteinase, protein 99.88
1ryp_E242 20S proteasome; multicatalytic proteinase, protein 99.88
1iru_E241 20S proteasome; cell cycle, immune response, prote 99.88
1ryp_I222 20S proteasome; multicatalytic proteinase, protein 99.88
2z3b_A180 ATP-dependent protease HSLV; N-terminal nucleophIl 99.88
3h4p_A264 Proteasome subunit alpha; core particle, cytoplasm 99.87
1iru_A246 20S proteasome; cell cycle, immune response, prote 99.87
1ryp_J204 20S proteasome; multicatalytic proteinase, protein 99.87
1iru_H205 20S proteasome; cell cycle, immune response, prote 99.87
1ryp_D241 20S proteasome; multicatalytic proteinase, protein 99.87
1j2p_A246 Alpha-ring, proteasome alpha subunit; hydrolase; 2 99.87
1ryp_G244 20S proteasome; multicatalytic proteinase, protein 99.87
2jay_A291 Proteasome; hydrolase; 1.99A {Mycobacterium tuberc 99.87
1iru_K201 20S proteasome; cell cycle, immune response, prote 99.87
1iru_I234 20S proteasome; cell cycle, immune response, prote 99.87
1ryp_K198 20S proteasome; multicatalytic proteinase, protein 99.87
3nzj_F288 Proteasome component C1; ubiquitin, protein degrad 99.86
1ryp_B250 20S proteasome; multicatalytic proteinase, protein 99.86
1g3k_A174 ATP-dependent protease HSLV; hydrolase; 1.90A {Hae 99.86
1iru_G254 20S proteasome; cell cycle, immune response, prote 99.86
1q5q_H235 Proteasome beta-type subunit 1; proteasome assembl 99.85
1iru_D248 20S proteasome; cell cycle, immune response, prote 99.85
3unf_N199 Proteasome subunit beta type-9; antigen presentati 99.85
1ryp_F233 20S proteasome; multicatalytic proteinase, protein 99.85
1m4y_A171 ATP-dependent protease HSLV; N-terminal catalytic 99.85
1iru_F263 20S proteasome; cell cycle, immune response, prote 99.85
1q5q_A259 Proteasome alpha-type subunit 1; proteasome assemb 99.84
3mi0_A248 Proteasome subunit alpha; enzyme inhibitors, lacto 99.84
1iru_N219 20S proteasome; cell cycle, immune response, prote 99.82
1ryp_N 233 20S proteasome; multicatalytic proteinase, protein 99.81
1ryp_A243 20S proteasome; multicatalytic proteinase, protein 99.81
1g0u_M 266 Proteasome component PRE4; ubiquitin, degradation, 99.8
1iru_B233 20S proteasome; cell cycle, immune response, prote 99.79
1yar_H 217 Proteasome beta subunit; proteasome 20S, PA26 prot 99.78
1iru_M213 20S proteasome; cell cycle, immune response, prote 99.78
3h4p_A 264 Proteasome subunit alpha; core particle, cytoplasm 99.78
1ryp_C244 20S proteasome; multicatalytic proteinase, protein 99.77
1yar_A233 Proteasome alpha subunit; proteasome 20S, PA26 pro 99.77
1ryp_D241 20S proteasome; multicatalytic proteinase, protein 99.77
1iru_A246 20S proteasome; cell cycle, immune response, prote 99.77
1ryp_M 222 20S proteasome; multicatalytic proteinase, protein 99.77
1ryp_G 244 20S proteasome; multicatalytic proteinase, protein 99.77
1j2q_H202 Proteasome beta subunit; ubiquitin, CP, hydrolase; 99.77
1iru_G 254 20S proteasome; cell cycle, immune response, prote 99.77
1iru_E241 20S proteasome; cell cycle, immune response, prote 99.76
1iru_D 248 20S proteasome; cell cycle, immune response, prote 99.76
3h4p_a 219 Proteasome subunit beta; core particle, cytoplasm, 99.76
3nzj_F 288 Proteasome component C1; ubiquitin, protein degrad 99.76
1j2p_A 246 Alpha-ring, proteasome alpha subunit; hydrolase; 2 99.76
1ryp_F233 20S proteasome; multicatalytic proteinase, protein 99.75
1iru_C 261 20S proteasome; cell cycle, immune response, prote 99.75
3unf_N199 Proteasome subunit beta type-9; antigen presentati 99.74
1iru_J205 20S proteasome; cell cycle, immune response, prote 99.74
1iru_L204 20S proteasome; cell cycle, immune response, prote 99.74
1ryp_J204 20S proteasome; multicatalytic proteinase, protein 99.74
3nzj_K 287 Proteasome component PRE2; ubiquitin, protein degr 99.74
3nzj_H 261 Proteasome component PUP1; ubiquitin, protein degr 99.74
1ryp_E242 20S proteasome; multicatalytic proteinase, protein 99.74
1iru_F 263 20S proteasome; cell cycle, immune response, prote 99.73
1ryp_H205 20S proteasome; multicatalytic proteinase, protein 99.73
1ryp_B 250 20S proteasome; multicatalytic proteinase, protein 99.72
1iru_K201 20S proteasome; cell cycle, immune response, prote 99.72
1ryp_K198 20S proteasome; multicatalytic proteinase, protein 99.72
1ryp_L 212 20S proteasome; multicatalytic proteinase, protein 99.72
1iru_H205 20S proteasome; cell cycle, immune response, prote 99.72
3unf_H 234 Proteasome subunit beta type-10; antigen presentat 99.71
1ryp_I 222 20S proteasome; multicatalytic proteinase, protein 99.71
1q5q_H 235 Proteasome beta-type subunit 1; proteasome assembl 99.7
3mi0_A 248 Proteasome subunit alpha; enzyme inhibitors, lacto 99.7
1q5r_H 294 Proteasome beta-type subunit 1; proteasome assembl 99.7
1iru_I 234 20S proteasome; cell cycle, immune response, prote 99.7
2jay_A 291 Proteasome; hydrolase; 1.99A {Mycobacterium tuberc 99.68
1q5q_A 259 Proteasome alpha-type subunit 1; proteasome assemb 99.67
1m4y_A171 ATP-dependent protease HSLV; N-terminal catalytic 99.45
2z3b_A180 ATP-dependent protease HSLV; N-terminal nucleophIl 99.39
1g3k_A174 ATP-dependent protease HSLV; hydrolase; 1.90A {Hae 99.39
>3nzj_K Proteasome component PRE2; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 3nzw_K* 3nzx_K* 4b4t_5 Back     alignment and structure
Probab=99.93  E-value=1.7e-26  Score=208.52  Aligned_cols=173  Identities=20%  Similarity=0.277  Sum_probs=126.3

Q ss_pred             CC-CCeeecCCCCCCCcc--ccCC-----CcCcCccCCccEEEEEeCCeEEEEEeCCCccCCceeeCCCCceEEecCceE
Q psy9489          69 PS-LGKYHDFPNVLPHYF--RRSG-----SFSTPLTTGTSVLGLVFNGGVILAADSAGYYGSMMRFNDCPRIMQINKFTI  140 (279)
Q Consensus        69 ~~-~~~f~~~~~~~~~~~--~~~~-----~~~~~~~~G~t~lgi~~~~gVvlaaD~r~~~~~~i~~~~~~Ki~~i~~~~~  140 (279)
                      ++ |..|..||..+|.+|  .+..     ....++.+|||+|||+++||||||+|+|.+.|.++.+++.+||++|+++++
T Consensus        38 ~~~~~~~~~p~~~~p~~~~~~~~~~~~~~~~~~~v~~GtT~vgik~~dGVVlAaD~r~t~G~li~~~~~~KI~~I~d~i~  117 (287)
T 3nzj_K           38 QRLAPSLTVPPIASPQQFLRAHTDDSRNPDCKIKIAHGTTTLAFRFQGGIIVAVDSRATAGNWVASQTVKKVIEINPFLL  117 (287)
T ss_dssp             --------------------------------------CCEEEEEETTEEEEEECCCEEETTEEEESCCCCEEEEETTEE
T ss_pred             CCCCcccccCCCCCHHHHHHHhcccccccchhhheccCceEEEEEECCEEEEEEccccccCceeecCCcceEEEEcCcEE
Confidence            44 778999999999998  2222     234578999999999999999999999999999999999999999999999


Q ss_pred             eeecCcccccccchhhhhccc-----------------------------ccccceeeEEEEE-eCCcEEEEEcCCCccC
Q psy9489         141 LGAGNDYADFQYLNDIVKQKI-----------------------------TPLTTGTSVLGLV-FNGGVILAADSAGYYG  190 (279)
Q Consensus       141 ~~~sG~~aD~~~l~~~l~~~~-----------------------------~pi~~g~tvlgi~-~~~gvlia~D~~gs~g  190 (279)
                      +++||..||+|.|.+.++...                             .|+..+..+.|++ ..++.|+..|+.|++ 
T Consensus       118 ~~~aG~~AD~~~l~~~lr~~~~~y~~~~~~~isv~~la~~ls~~l~~~r~~p~~v~~lvaG~D~~~gp~Ly~iDp~G~~-  196 (287)
T 3nzj_K          118 GTMAGGAADCQFWETWLGSQCRLHELREKERISVAAASKILSNLVYQYKGAGLSMGTMICGYTRKEGPTIYYVDSDGTR-  196 (287)
T ss_dssp             EECEECHHHHHHHHHHHHHHHHHHHHHHSSCCCHHHHHHHHHHHHHHTTTSCCCEEEEEEEEETTTEEEEEEEETTCCE-
T ss_pred             EEecCCHHHHHHHHHHHHHHHHHHHHHhCCCCCHHHHHHHHHHHHHhhcCCCceEEEEEEEEcCCCCCEEEEECCCceE-
Confidence            999999999999999988511                             1222223344787 457899999999987 


Q ss_pred             ceeeecCCCceEEecccEEEEeccChhhHHHHHHHHHhhcccccccccCCCCCHHHHHHHHHHHHhhcc
Q psy9489         191 SMMRFNDCPRIMQINKFTILGAGNDYADFQYLNDIVKQKILDDDLHNDGFVLKPKSLHSWLTRVLYNRR  259 (279)
Q Consensus       191 ~li~~~~~~kI~~i~~~~~~~gSG~~aD~~~l~~~l~~~~~~~~~~ee~~~l~~~~la~~isr~lys~r  259 (279)
                                   +..++++.|+|+    +++..+|++.|+++|+++|+.++..+++.+++.|+.++..
T Consensus       197 -------------~~~~~~AiGsgs----~~a~~~Le~~y~~dms~eEAi~la~~aL~~a~~rD~~sg~  248 (287)
T 3nzj_K          197 -------------LKGDIFCVGSGQ----TFAYGVLDSNYKWDLSVEDALYLGKRSILAAAHRDAYSGG  248 (287)
T ss_dssp             -------------EECSEEEESTTH----HHHHHHHHTSCCTTCCHHHHHHHHHHHHHHHHHHBTTCCS
T ss_pred             -------------EEcCeEEEecch----HHHHHHHHHhhcCCCCHHHHHHHHHHHHHHHHhhCcCCCC
Confidence                         677899999999    9999999999999999999999999999999999988753



>1g0u_M Proteasome component PRE4; ubiquitin, degradation, protease, NTN-hydrolase; 2.40A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 2zcy_M* 3bdm_M* 3mg6_M* 3mg7_M* 3mg8_M* 3nzj_M* 3nzw_M* 3nzx_M* Back     alignment and structure
>3nzj_H Proteasome component PUP1; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 3nzw_H* 3nzx_H* 4b4t_2 Back     alignment and structure
>1yar_H Proteasome beta subunit; proteasome 20S, PA26 proteasome activator 11S, hydrolase-HYD activator complex; 1.90A {Thermoplasma acidophilum} SCOP: d.153.1.4 PDB: 1ya7_H 1yau_H 3ipm_H 1pma_B 3jrm_H 3c92_H 3c91_H 3jse_H 3jtl_H Back     alignment and structure
>1iru_M 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_L* 3une_L 3unf_L* 3unh_L Back     alignment and structure
>1iru_N 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_M* 3une_M 3unf_M* 3unh_M Back     alignment and structure
>1ryp_H 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 3nzj_N* 3nzw_N* 3nzx_N* 1vsy_H 3l5q_B 1g65_N* 1fnt_H 1g0u_N* 1jd2_N* 1z7q_H 2f16_N* 2fak_N* 2fny_N* 2gpl_N* 2zcy_N* 3bdm_N* 3d29_N* 3dy3_N* 3dy4_N* 3e47_N* ... Back     alignment and structure
>1ryp_M 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_M* 1jd2_L* 1g65_L 1vsy_M 1z7q_M 2f16_L* 2fak_L* 2fny_L* 2gpl_L* 3d29_L* 3dy3_L* 3dy4_L* 3e47_L* 3gpj_L* 3gpt_L* 3gpw_L* 3hye_L* 3l5q_Q 3mg0_L* 3mg4_L* ... Back     alignment and structure
>1iru_J 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_I* 3une_I 3unf_I* 3unh_I Back     alignment and structure
>3h4p_a Proteasome subunit beta; core particle, cytoplasm, hydrolase, protease, threonine protease; 4.10A {Methanocaldococcus jannaschii} Back     alignment and structure
>1ryp_N 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_N* 1jd2_M* 1g65_M 1vsy_N 1z7q_N 2f16_M* 2fak_M* 2fny_M* 2gpl_M* 3d29_M* 3dy3_M* 3dy4_M* 3e47_M* 3gpj_M* 3gpt_M* 3gpw_M* 3hye_M* 3l5q_R 3mg0_M* 3mg4_M* ... Back     alignment and structure
>1ryp_A 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_G* 1g65_G 1vsy_A 2f16_G* 2fak_G* 2fny_G* 2gpl_G* 3d29_G* 3dy3_G* 3dy4_G* 3e47_G* 3gpj_G* 3gpt_G* 3gpw_G* 3hye_G* 3l5q_A 3mg0_G* 3mg4_G* 3oeu_G* 3oev_G* ... Back     alignment and structure
>1iru_L 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_K* 3une_K 3unf_K* 3unh_K Back     alignment and structure
>3unf_H Proteasome subunit beta type-10; antigen presentation, drug development, protein degradation, hydrolase-hydrolase inhibitor complex; HET: 04C; 2.90A {Mus musculus} PDB: 3unh_H Back     alignment and structure
>1yar_A Proteasome alpha subunit; proteasome 20S, PA26 proteasome activator 11S, hydrolase-HYD activator complex; 1.90A {Thermoplasma acidophilum} SCOP: d.153.1.4 PDB: 1ya7_A 1pma_A 3c91_A 3c92_A 3ipm_A 2ku1_A 2ku2_A 1yau_A 3jrm_A 3jse_A 3jtl_A Back     alignment and structure
>1ryp_C 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_B* 1g65_B 2f16_B* 2fak_B* 2fny_B* 2gpl_B* 3d29_B* 3dy3_B* 3dy4_B* 3e47_B* 3gpj_B* 3gpt_B* 3gpw_B* 3hye_B* 3mg0_B* 3mg4_B* 3okj_B* 3shj_B* 3tdd_B* 3nzj_B* ... Back     alignment and structure
>1j2q_H Proteasome beta subunit; ubiquitin, CP, hydrolase; HET: CIB; 2.83A {Archaeoglobus fulgidus} SCOP: d.153.1.4 Back     alignment and structure
>1iru_B 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_A* 3une_A 3unf_A* 3unh_A Back     alignment and structure
>1q5r_H Proteasome beta-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, hydrolase; 3.10A {Rhodococcus erythropolis} SCOP: d.153.1.4 PDB: 2h6j_H Back     alignment and structure
>1iru_C 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_B* 3une_B 3unf_B* 3unh_B Back     alignment and structure
>1ryp_L 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_L 1vsy_L 1z7q_L 3l5q_P 1g65_K* 1g0u_K* 1jd2_K* 2f16_K* 2fak_K* 2fny_K* 2gpl_K* 2zcy_K* 3bdm_K* 3d29_K* 3dy3_K* 3dy4_K* 3e47_K* 3gpj_K* 3gpt_K* 3gpw_K* ... Back     alignment and structure
>1ryp_E 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_D* 1g65_D 2f16_D* 2fak_D* 2fny_D* 2gpl_D* 3d29_D* 3dy3_D* 3dy4_D* 3e47_D* 3gpj_D* 3gpt_D* 3gpw_D* 3hye_D* 3mg0_D* 3mg4_D* 3okj_D* 3shj_D* 3tdd_D* 2z5c_C ... Back     alignment and structure
>1iru_E 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_D* 3une_D 3unf_D* 3unh_D Back     alignment and structure
>1ryp_I 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1g0u_H* 1jd2_H* 1g65_H 1vsy_I 1z7q_I 2f16_H* 2fak_H* 2fny_H* 2gpl_H* 3d29_H* 3dy3_H* 3dy4_H* 3e47_H* 3gpj_H* 3gpt_H* 3gpw_H* 3hye_H* 3l5q_M 3mg0_H* 3mg4_H* ... Back     alignment and structure
>2z3b_A ATP-dependent protease HSLV; N-terminal nucleophIle hydrolase; 2.50A {Bacillus subtilis} SCOP: d.153.1.4 PDB: 2z3a_A 1yyf_D* 3ty6_A Back     alignment and structure
>3h4p_A Proteasome subunit alpha; core particle, cytoplasm, hydrolase, protease, threonine protease; 4.10A {Methanocaldococcus jannaschii} Back     alignment and structure
>1iru_A 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_G* 3une_G 3unf_G* 3unh_G Back     alignment and structure
>1ryp_J 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_I* 1g65_I 1vsy_J 2f16_I* 2fak_I* 2fny_I* 2gpl_I* 3d29_I* 3dy3_I* 3dy4_I* 3e47_I* 3gpj_I* 3gpt_I* 3gpw_I* 3hye_I* 3l5q_N 3mg0_I* 3mg4_I* 3oeu_I* 3oev_I* ... Back     alignment and structure
>1iru_H 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_N* 3une_N Back     alignment and structure
>1ryp_D 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_C* 1g65_C 2f16_C* 2fak_C* 2fny_C* 2gpl_C* 3d29_C* 3dy3_C* 3dy4_C* 3e47_C* 3gpj_C* 3gpt_C* 3gpw_C* 3hye_C* 3mg0_C* 3mg4_C* 3oeu_C* 3oev_C* 3okj_C* 3shj_C* ... Back     alignment and structure
>1j2p_A Alpha-ring, proteasome alpha subunit; hydrolase; 2.60A {Archaeoglobus fulgidus} SCOP: d.153.1.4 PDB: 1j2q_A* Back     alignment and structure
>1ryp_G 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_F* 1g65_F 1vsy_G 2f16_F* 2fak_F* 2fny_F* 2gpl_F* 3d29_F* 3dy3_F* 3dy4_F* 3e47_F* 3gpj_F* 3gpt_F* 3gpw_F* 3hye_F* 3l5q_L 3mg0_F* 3mg4_F* 3okj_F* 3shj_F* ... Back     alignment and structure
>2jay_A Proteasome; hydrolase; 1.99A {Mycobacterium tuberculosis} PDB: 3mka_C 3mi0_C* 2fhg_H* 2fhh_H 3krd_C* 3mfe_G 3hfa_H* 3h6i_C 3h6f_C 3hf9_H 3mfe_H Back     alignment and structure
>1iru_K 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_J* 3une_J 3unf_J* 3unh_J Back     alignment and structure
>1iru_I 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_H* 3une_H Back     alignment and structure
>1ryp_K 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_K 1g0u_J* 1jd2_J* 1g65_J 1vsy_K 1z7q_K 2f16_J* 2fak_J* 2fny_J* 2gpl_J* 2zcy_J* 3bdm_J* 3d29_J* 3dy3_J* 3dy4_J* 3e47_J* 3gpj_J* 3gpt_J* 3gpw_J* 3hye_J* ... Back     alignment and structure
>3nzj_F Proteasome component C1; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 1z7q_G* 3nzw_F* 3nzx_F* 3un4_F* 3un8_F* 4b4t_G 4g4s_G* 3bdm_F* 1fnt_G* 2zcy_F* Back     alignment and structure
>1ryp_B 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_B 1g0u_A* 1jd2_A* 1g65_A 1z7q_B 2f16_A* 2fak_A* 2fny_A* 2gpl_A* 2zcy_A* 3bdm_A* 3d29_A* 3dy3_A* 3dy4_A* 3e47_A* 3gpj_A* 3gpt_A* 3gpw_A* 3hye_A* 3mg0_A* ... Back     alignment and structure
>1g3k_A ATP-dependent protease HSLV; hydrolase; 1.90A {Haemophilus influenzae} SCOP: d.153.1.4 PDB: 1g3i_G 1jjw_A 1kyi_G* 1ofh_G* 1ofi_G* 1e94_A* 1g4a_B* 1g4b_M 1hqy_A* 1ht1_C* 1ht2_A* 1ned_A Back     alignment and structure
>1iru_G 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_F* 3une_F 3unf_F* 3unh_F Back     alignment and structure
>1q5q_H Proteasome beta-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, RH erythropolis, hydrolase; 2.60A {Rhodococcus erythropolis} SCOP: d.153.1.4 Back     alignment and structure
>1iru_D 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unf_C* 3une_C* 3unh_C 3unb_C* Back     alignment and structure
>3unf_N Proteasome subunit beta type-9; antigen presentation, drug development, protein degradation, hydrolase-hydrolase inhibitor complex; HET: 04C; 2.90A {Mus musculus} PDB: 3unh_N Back     alignment and structure
>1ryp_F 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_E* 1g65_E 2f16_E* 2fak_E* 2fny_E* 2gpl_E* 3d29_E* 3dy3_E* 3dy4_E* 3e47_E* 3gpj_E* 3gpt_E* 3gpw_E* 3hye_E* 3mg0_E* 3mg4_E* 3oeu_E* 3oev_E* 3okj_E* 3shj_E* ... Back     alignment and structure
>1m4y_A ATP-dependent protease HSLV; N-terminal catalytic threonine residue, hydrolase; 2.10A {Thermotoga maritima} SCOP: d.153.1.4 Back     alignment and structure
>1iru_F 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_E* 3une_E 3unf_E* 3unh_E Back     alignment and structure
>1q5q_A Proteasome alpha-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, RH erythropolis, hydrolase; 2.60A {Rhodococcus erythropolis} SCOP: d.153.1.4 PDB: 2h6j_A 1q5r_A Back     alignment and structure
>3mi0_A Proteasome subunit alpha; enzyme inhibitors, lactones, proteasome endopeptidase comple mycobacterium tuberculosis, hydrolase; HET: SA6; 2.20A {Mycobacterium tuberculosis} SCOP: d.153.1.4 PDB: 3h6f_A 3krd_A* 3h6i_A* 3mka_A 2fhh_A* 2fhg_A 3hfa_D 3hf9_A 3mfe_D Back     alignment and structure
>1iru_N 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_M* 3une_M 3unf_M* 3unh_M Back     alignment and structure
>1ryp_N 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_N* 1jd2_M* 1g65_M 1vsy_N 1z7q_N 2f16_M* 2fak_M* 2fny_M* 2gpl_M* 3d29_M* 3dy3_M* 3dy4_M* 3e47_M* 3gpj_M* 3gpt_M* 3gpw_M* 3hye_M* 3l5q_R 3mg0_M* 3mg4_M* ... Back     alignment and structure
>1ryp_A 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_G* 1g65_G 1vsy_A 2f16_G* 2fak_G* 2fny_G* 2gpl_G* 3d29_G* 3dy3_G* 3dy4_G* 3e47_G* 3gpj_G* 3gpt_G* 3gpw_G* 3hye_G* 3l5q_A 3mg0_G* 3mg4_G* 3oeu_G* 3oev_G* ... Back     alignment and structure
>1g0u_M Proteasome component PRE4; ubiquitin, degradation, protease, NTN-hydrolase; 2.40A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 2zcy_M* 3bdm_M* 3mg6_M* 3mg7_M* 3mg8_M* 3nzj_M* 3nzw_M* 3nzx_M* Back     alignment and structure
>1iru_B 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_A* 3une_A 3unf_A* 3unh_A Back     alignment and structure
>1yar_H Proteasome beta subunit; proteasome 20S, PA26 proteasome activator 11S, hydrolase-HYD activator complex; 1.90A {Thermoplasma acidophilum} SCOP: d.153.1.4 PDB: 1ya7_H 1yau_H 3ipm_H 1pma_B 3jrm_H 3c92_H 3c91_H 3jse_H 3jtl_H Back     alignment and structure
>1iru_M 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_L* 3une_L 3unf_L* 3unh_L Back     alignment and structure
>3h4p_A Proteasome subunit alpha; core particle, cytoplasm, hydrolase, protease, threonine protease; 4.10A {Methanocaldococcus jannaschii} Back     alignment and structure
>1ryp_C 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_B* 1g65_B 2f16_B* 2fak_B* 2fny_B* 2gpl_B* 3d29_B* 3dy3_B* 3dy4_B* 3e47_B* 3gpj_B* 3gpt_B* 3gpw_B* 3hye_B* 3mg0_B* 3mg4_B* 3okj_B* 3shj_B* 3tdd_B* 3nzj_B* ... Back     alignment and structure
>1yar_A Proteasome alpha subunit; proteasome 20S, PA26 proteasome activator 11S, hydrolase-HYD activator complex; 1.90A {Thermoplasma acidophilum} SCOP: d.153.1.4 PDB: 1ya7_A 1pma_A 3c91_A 3c92_A 3ipm_A 2ku1_A 2ku2_A 1yau_A 3jrm_A 3jse_A 3jtl_A Back     alignment and structure
>1ryp_D 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_C* 1g65_C 2f16_C* 2fak_C* 2fny_C* 2gpl_C* 3d29_C* 3dy3_C* 3dy4_C* 3e47_C* 3gpj_C* 3gpt_C* 3gpw_C* 3hye_C* 3mg0_C* 3mg4_C* 3oeu_C* 3oev_C* 3okj_C* 3shj_C* ... Back     alignment and structure
>1iru_A 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_G* 3une_G 3unf_G* 3unh_G Back     alignment and structure
>1ryp_M 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_M* 1jd2_L* 1g65_L 1vsy_M 1z7q_M 2f16_L* 2fak_L* 2fny_L* 2gpl_L* 3d29_L* 3dy3_L* 3dy4_L* 3e47_L* 3gpj_L* 3gpt_L* 3gpw_L* 3hye_L* 3l5q_Q 3mg0_L* 3mg4_L* ... Back     alignment and structure
>1ryp_G 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_F* 1g65_F 1vsy_G 2f16_F* 2fak_F* 2fny_F* 2gpl_F* 3d29_F* 3dy3_F* 3dy4_F* 3e47_F* 3gpj_F* 3gpt_F* 3gpw_F* 3hye_F* 3l5q_L 3mg0_F* 3mg4_F* 3okj_F* 3shj_F* ... Back     alignment and structure
>1j2q_H Proteasome beta subunit; ubiquitin, CP, hydrolase; HET: CIB; 2.83A {Archaeoglobus fulgidus} SCOP: d.153.1.4 Back     alignment and structure
>1iru_G 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_F* 3une_F 3unf_F* 3unh_F Back     alignment and structure
>1iru_E 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_D* 3une_D 3unf_D* 3unh_D Back     alignment and structure
>1iru_D 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unf_C* 3une_C* 3unh_C 3unb_C* Back     alignment and structure
>3h4p_a Proteasome subunit beta; core particle, cytoplasm, hydrolase, protease, threonine protease; 4.10A {Methanocaldococcus jannaschii} Back     alignment and structure
>3nzj_F Proteasome component C1; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 1z7q_G* 3nzw_F* 3nzx_F* 3un4_F* 3un8_F* 4b4t_G 4g4s_G* 3bdm_F* 1fnt_G* 2zcy_F* Back     alignment and structure
>1j2p_A Alpha-ring, proteasome alpha subunit; hydrolase; 2.60A {Archaeoglobus fulgidus} SCOP: d.153.1.4 PDB: 1j2q_A* Back     alignment and structure
>1ryp_F 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_E* 1g65_E 2f16_E* 2fak_E* 2fny_E* 2gpl_E* 3d29_E* 3dy3_E* 3dy4_E* 3e47_E* 3gpj_E* 3gpt_E* 3gpw_E* 3hye_E* 3mg0_E* 3mg4_E* 3oeu_E* 3oev_E* 3okj_E* 3shj_E* ... Back     alignment and structure
>1iru_C 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_B* 3une_B 3unf_B* 3unh_B Back     alignment and structure
>3unf_N Proteasome subunit beta type-9; antigen presentation, drug development, protein degradation, hydrolase-hydrolase inhibitor complex; HET: 04C; 2.90A {Mus musculus} PDB: 3unh_N Back     alignment and structure
>1iru_J 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_I* 3une_I 3unf_I* 3unh_I Back     alignment and structure
>1iru_L 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_K* 3une_K 3unf_K* 3unh_K Back     alignment and structure
>1ryp_J 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_I* 1g65_I 1vsy_J 2f16_I* 2fak_I* 2fny_I* 2gpl_I* 3d29_I* 3dy3_I* 3dy4_I* 3e47_I* 3gpj_I* 3gpt_I* 3gpw_I* 3hye_I* 3l5q_N 3mg0_I* 3mg4_I* 3oeu_I* 3oev_I* ... Back     alignment and structure
>3nzj_K Proteasome component PRE2; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 3nzw_K* 3nzx_K* 4b4t_5 Back     alignment and structure
>3nzj_H Proteasome component PUP1; ubiquitin, protein degradation, N-terminal nucleophilic HYDR 19S regulatory particle; HET: TY5 TRO MES; 2.40A {Saccharomyces cerevisiae} PDB: 3nzw_H* 3nzx_H* 4b4t_2 Back     alignment and structure
>1ryp_E 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1jd2_D* 1g65_D 2f16_D* 2fak_D* 2fny_D* 2gpl_D* 3d29_D* 3dy3_D* 3dy4_D* 3e47_D* 3gpj_D* 3gpt_D* 3gpw_D* 3hye_D* 3mg0_D* 3mg4_D* 3okj_D* 3shj_D* 3tdd_D* 2z5c_C ... Back     alignment and structure
>1iru_F 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_E* 3une_E 3unf_E* 3unh_E Back     alignment and structure
>1ryp_H 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 3nzj_N* 3nzw_N* 3nzx_N* 1vsy_H 3l5q_B 1g65_N* 1fnt_H 1g0u_N* 1jd2_N* 1z7q_H 2f16_N* 2fak_N* 2fny_N* 2gpl_N* 2zcy_N* 3bdm_N* 3d29_N* 3dy3_N* 3dy4_N* 3e47_N* ... Back     alignment and structure
>1ryp_B 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_B 1g0u_A* 1jd2_A* 1g65_A 1z7q_B 2f16_A* 2fak_A* 2fny_A* 2gpl_A* 2zcy_A* 3bdm_A* 3d29_A* 3dy3_A* 3dy4_A* 3e47_A* 3gpj_A* 3gpt_A* 3gpw_A* 3hye_A* 3mg0_A* ... Back     alignment and structure
>1iru_K 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_J* 3une_J 3unf_J* 3unh_J Back     alignment and structure
>1ryp_K 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_K 1g0u_J* 1jd2_J* 1g65_J 1vsy_K 1z7q_K 2f16_J* 2fak_J* 2fny_J* 2gpl_J* 2zcy_J* 3bdm_J* 3d29_J* 3dy3_J* 3dy4_J* 3e47_J* 3gpj_J* 3gpt_J* 3gpw_J* 3hye_J* ... Back     alignment and structure
>1ryp_L 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1fnt_L 1vsy_L 1z7q_L 3l5q_P 1g65_K* 1g0u_K* 1jd2_K* 2f16_K* 2fak_K* 2fny_K* 2gpl_K* 2zcy_K* 3bdm_K* 3d29_K* 3dy3_K* 3dy4_K* 3e47_K* 3gpj_K* 3gpt_K* 3gpw_K* ... Back     alignment and structure
>1iru_H 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_N* 3une_N Back     alignment and structure
>3unf_H Proteasome subunit beta type-10; antigen presentation, drug development, protein degradation, hydrolase-hydrolase inhibitor complex; HET: 04C; 2.90A {Mus musculus} PDB: 3unh_H Back     alignment and structure
>1ryp_I 20S proteasome; multicatalytic proteinase, protein degradation, antigen processing, hydrolase, protease; 1.90A {Saccharomyces cerevisiae} SCOP: d.153.1.4 PDB: 1g0u_H* 1jd2_H* 1g65_H 1vsy_I 1z7q_I 2f16_H* 2fak_H* 2fny_H* 2gpl_H* 3d29_H* 3dy3_H* 3dy4_H* 3e47_H* 3gpj_H* 3gpt_H* 3gpw_H* 3hye_H* 3l5q_M 3mg0_H* 3mg4_H* ... Back     alignment and structure
>1q5q_H Proteasome beta-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, RH erythropolis, hydrolase; 2.60A {Rhodococcus erythropolis} SCOP: d.153.1.4 Back     alignment and structure
>3mi0_A Proteasome subunit alpha; enzyme inhibitors, lactones, proteasome endopeptidase comple mycobacterium tuberculosis, hydrolase; HET: SA6; 2.20A {Mycobacterium tuberculosis} SCOP: d.153.1.4 PDB: 3h6f_A 3krd_A* 3h6i_A* 3mka_A 2fhh_A* 2fhg_A 3hfa_D 3hf9_A 3mfe_D Back     alignment and structure
>1q5r_H Proteasome beta-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, hydrolase; 3.10A {Rhodococcus erythropolis} SCOP: d.153.1.4 PDB: 2h6j_H Back     alignment and structure
>1iru_I 20S proteasome; cell cycle, immune response, proteolysis, ubiquitin, hydrolase; 2.75A {Bos taurus} SCOP: d.153.1.4 PDB: 3unb_H* 3une_H Back     alignment and structure
>2jay_A Proteasome; hydrolase; 1.99A {Mycobacterium tuberculosis} PDB: 3mka_C 3mi0_C* 2fhg_H* 2fhh_H 3krd_C* 3mfe_G 3hfa_H* 3h6i_C 3h6f_C 3hf9_H 3mfe_H Back     alignment and structure
>1q5q_A Proteasome alpha-type subunit 1; proteasome assembly, Pro-peptide, inter-subunit contacts, RH erythropolis, hydrolase; 2.60A {Rhodococcus erythropolis} SCOP: d.153.1.4 PDB: 2h6j_A 1q5r_A Back     alignment and structure
>1m4y_A ATP-dependent protease HSLV; N-terminal catalytic threonine residue, hydrolase; 2.10A {Thermotoga maritima} SCOP: d.153.1.4 Back     alignment and structure
>2z3b_A ATP-dependent protease HSLV; N-terminal nucleophIle hydrolase; 2.50A {Bacillus subtilis} SCOP: d.153.1.4 PDB: 2z3a_A 1yyf_D* 3ty6_A Back     alignment and structure
>1g3k_A ATP-dependent protease HSLV; hydrolase; 1.90A {Haemophilus influenzae} SCOP: d.153.1.4 PDB: 1g3i_G 1jjw_A 1kyi_G* 1ofh_G* 1ofi_G* 1e94_A* 1g4a_B* 1g4b_M 1hqy_A* 1ht1_C* 1ht2_A* 1ned_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 279
d1ryp2_ 233 d.153.1.4 (2:) Proteasome beta subunit (catalytic) 8e-21
d1ryp2_233 d.153.1.4 (2:) Proteasome beta subunit (catalytic) 3e-13
d1ryp2_233 d.153.1.4 (2:) Proteasome beta subunit (catalytic) 7e-06
d1iru2_217 d.153.1.4 (2:) Proteasome beta subunit (catalytic) 9e-21
d1iru2_217 d.153.1.4 (2:) Proteasome beta subunit (catalytic) 6e-13
d1iru2_217 d.153.1.4 (2:) Proteasome beta subunit (catalytic) 2e-07
d1rypk_198 d.153.1.4 (K:) Proteasome beta subunit (catalytic) 2e-15
d1rypk_198 d.153.1.4 (K:) Proteasome beta subunit (catalytic) 8e-11
d1rypk_198 d.153.1.4 (K:) Proteasome beta subunit (catalytic) 8e-05
d1rypl_ 212 d.153.1.4 (L:) Proteasome beta subunit (catalytic) 3e-13
d1rypl_212 d.153.1.4 (L:) Proteasome beta subunit (catalytic) 1e-09
d1rypl_212 d.153.1.4 (L:) Proteasome beta subunit (catalytic) 3e-04
d1q5qh_ 224 d.153.1.4 (H:) Proteasome beta subunit (catalytic) 4e-13
d1q5qh_224 d.153.1.4 (H:) Proteasome beta subunit (catalytic) 1e-09
d1q5qh_224 d.153.1.4 (H:) Proteasome beta subunit (catalytic) 0.001
d1irul_201 d.153.1.4 (L:) Proteasome beta subunit (catalytic) 2e-12
d1irul_201 d.153.1.4 (L:) Proteasome beta subunit (catalytic) 5e-10
d1irul_201 d.153.1.4 (L:) Proteasome beta subunit (catalytic) 0.001
d1ryph_205 d.153.1.4 (H:) Proteasome beta subunit (catalytic) 3e-12
d1ryph_205 d.153.1.4 (H:) Proteasome beta subunit (catalytic) 1e-09
d1ryph_205 d.153.1.4 (H:) Proteasome beta subunit (catalytic) 5e-04
d1yarh1203 d.153.1.4 (H:1-203) Proteasome beta subunit (catal 4e-12
d1yarh1203 d.153.1.4 (H:1-203) Proteasome beta subunit (catal 1e-08
d1iruk_199 d.153.1.4 (K:) Proteasome beta subunit (catalytic) 5e-12
d1iruk_199 d.153.1.4 (K:) Proteasome beta subunit (catalytic) 2e-08
d1ryp1_ 222 d.153.1.4 (1:) Proteasome beta subunit (catalytic) 6e-12
d1ryp1_222 d.153.1.4 (1:) Proteasome beta subunit (catalytic) 6e-09
d1ryp1_222 d.153.1.4 (1:) Proteasome beta subunit (catalytic) 0.001
d1iruj_204 d.153.1.4 (J:) Proteasome beta subunit (catalytic) 1e-11
d1iruj_204 d.153.1.4 (J:) Proteasome beta subunit (catalytic) 4e-09
d1irui_ 220 d.153.1.4 (I:) Proteasome beta subunit (catalytic) 4e-11
d1irui_220 d.153.1.4 (I:) Proteasome beta subunit (catalytic) 3e-09
d1irui_220 d.153.1.4 (I:) Proteasome beta subunit (catalytic) 2e-04
d1q5qa_ 227 d.153.1.4 (A:) Proteasome alpha subunit (non-catal 7e-11
d1q5qa_227 d.153.1.4 (A:) Proteasome alpha subunit (non-catal 7e-07
d1iruh_202 d.153.1.4 (H:) Proteasome beta subunit (catalytic) 9e-11
d1iruh_202 d.153.1.4 (H:) Proteasome beta subunit (catalytic) 7e-08
d1iruh_202 d.153.1.4 (H:) Proteasome beta subunit (catalytic) 0.001
d1rypi_ 222 d.153.1.4 (I:) Proteasome beta subunit (catalytic) 2e-10
d1rypi_222 d.153.1.4 (I:) Proteasome beta subunit (catalytic) 6e-09
d1rypi_222 d.153.1.4 (I:) Proteasome beta subunit (catalytic) 3e-04
d1rypj_204 d.153.1.4 (J:) Proteasome beta subunit (catalytic) 3e-10
d1rypj_204 d.153.1.4 (J:) Proteasome beta subunit (catalytic) 6e-07
d1m4ya_171 d.153.1.4 (A:) HslV (ClpQ) protease {Thermotoga ma 3e-10
d1m4ya_171 d.153.1.4 (A:) HslV (ClpQ) protease {Thermotoga ma 2e-09
d1irue_234 d.153.1.4 (E:) Proteasome alpha subunit (non-catal 4e-10
d1irue_234 d.153.1.4 (E:) Proteasome alpha subunit (non-catal 4e-05
d1iru1_213 d.153.1.4 (1:) Proteasome beta subunit (catalytic) 6e-10
d1iru1_213 d.153.1.4 (1:) Proteasome beta subunit (catalytic) 7e-08
d1rypd_241 d.153.1.4 (D:) Proteasome alpha subunit (non-catal 1e-09
d1rypd_241 d.153.1.4 (D:) Proteasome alpha subunit (non-catal 5e-06
d1j2qh_202 d.153.1.4 (H:) Proteasome beta subunit (catalytic) 1e-09
d1j2qh_202 d.153.1.4 (H:) Proteasome beta subunit (catalytic) 1e-07
d1j2qh_202 d.153.1.4 (H:) Proteasome beta subunit (catalytic) 0.004
d1yara1221 d.153.1.4 (A:13-233) Proteasome alpha subunit (non 1e-09
d1yara1221 d.153.1.4 (A:13-233) Proteasome alpha subunit (non 1e-05
d1rypc_244 d.153.1.4 (C:) Proteasome alpha subunit (non-catal 2e-09
d1rypc_244 d.153.1.4 (C:) Proteasome alpha subunit (non-catal 2e-06
d1rypc_244 d.153.1.4 (C:) Proteasome alpha subunit (non-catal 0.001
d1iruc_ 250 d.153.1.4 (C:) Proteasome alpha subunit (non-catal 5e-09
d1iruc_250 d.153.1.4 (C:) Proteasome alpha subunit (non-catal 2e-06
d1rype_242 d.153.1.4 (E:) Proteasome alpha subunit (non-catal 1e-08
d1rype_242 d.153.1.4 (E:) Proteasome alpha subunit (non-catal 2e-06
d1irub_233 d.153.1.4 (B:) Proteasome alpha subunit (non-catal 1e-08
d1irub_233 d.153.1.4 (B:) Proteasome alpha subunit (non-catal 2e-05
d1j2pa_243 d.153.1.4 (A:) Proteasome alpha subunit (non-catal 2e-08
d1j2pa_243 d.153.1.4 (A:) Proteasome alpha subunit (non-catal 6e-05
d1rypg_ 244 d.153.1.4 (G:) Proteasome alpha subunit (non-catal 3e-08
d1rypg_244 d.153.1.4 (G:) Proteasome alpha subunit (non-catal 1e-04
d1rypg_244 d.153.1.4 (G:) Proteasome alpha subunit (non-catal 0.004
d1g3ka_173 d.153.1.4 (A:) HslV (ClpQ) protease {Haemophilus i 5e-08
d1g3ka_173 d.153.1.4 (A:) HslV (ClpQ) protease {Haemophilus i 1e-07
d1rypb_ 250 d.153.1.4 (B:) Proteasome alpha subunit (non-catal 9e-08
d1rypb_250 d.153.1.4 (B:) Proteasome alpha subunit (non-catal 0.002
d1iruf_238 d.153.1.4 (F:) Proteasome alpha subunit (non-catal 1e-07
d1iruf_238 d.153.1.4 (F:) Proteasome alpha subunit (non-catal 0.002
d1irug_245 d.153.1.4 (G:) Proteasome alpha subunit (non-catal 2e-07
d1irug_245 d.153.1.4 (G:) Proteasome alpha subunit (non-catal 3e-04
d1irug_245 d.153.1.4 (G:) Proteasome alpha subunit (non-catal 0.004
d2z3ba1180 d.153.1.4 (A:1-180) HslV (ClpQ) protease {Bacillus 5e-07
d2z3ba1180 d.153.1.4 (A:1-180) HslV (ClpQ) protease {Bacillus 3e-06
d1irud_ 243 d.153.1.4 (D:) Proteasome alpha subunit (non-catal 3e-06
d1irud_243 d.153.1.4 (D:) Proteasome alpha subunit (non-catal 0.001
d1rypf_233 d.153.1.4 (F:) Proteasome alpha subunit (non-catal 4e-05
d1irua_244 d.153.1.4 (A:) Proteasome alpha subunit (non-catal 5e-05
d1irua_244 d.153.1.4 (A:) Proteasome alpha subunit (non-catal 2e-04
d1rypa_243 d.153.1.4 (A:) Proteasome alpha subunit (non-catal 0.004
>d1ryp2_ d.153.1.4 (2:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 233 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: Ntn hydrolase-like
superfamily: N-terminal nucleophile aminohydrolases (Ntn hydrolases)
family: Proteasome subunits
domain: Proteasome beta subunit (catalytic)
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
 Score = 86.3 bits (213), Expect = 8e-21
 Identities = 42/115 (36%), Positives = 70/115 (60%), Gaps = 4/115 (3%)

Query: 163 PLTTGTSVLGLVFNGGVILAADSAGYYGSMMRFNDCPRIMQINKFTILGAGNDYADFQYL 222
           P+ TGTSV+ + ++ GVI+AAD+ G YGS++RFN   R++ +   T++G   D +D Q++
Sbjct: 4   PIVTGTSVISMKYDNGVIIAADNLGSYGSLLRFNGVERLIPVGDNTVVGISGDISDMQHI 63

Query: 223 NDIVKQKI----LDDDLHNDGFVLKPKSLHSWLTRVLYNRRSQFDPLWINAFVAG 273
             ++K  +     D+ L +    L+P  +  +L  V+Y RRS+ +PLW    VAG
Sbjct: 64  ERLLKDLVTENAYDNPLADAEEALEPSYIFEYLATVMYQRRSKMNPLWNAIIVAG 118


>d1ryp2_ d.153.1.4 (2:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 233 Back     information, alignment and structure
>d1ryp2_ d.153.1.4 (2:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 233 Back     information, alignment and structure
>d1iru2_ d.153.1.4 (2:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 217 Back     information, alignment and structure
>d1iru2_ d.153.1.4 (2:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 217 Back     information, alignment and structure
>d1iru2_ d.153.1.4 (2:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 217 Back     information, alignment and structure
>d1rypk_ d.153.1.4 (K:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 198 Back     information, alignment and structure
>d1rypk_ d.153.1.4 (K:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 198 Back     information, alignment and structure
>d1rypk_ d.153.1.4 (K:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 198 Back     information, alignment and structure
>d1rypl_ d.153.1.4 (L:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 212 Back     information, alignment and structure
>d1rypl_ d.153.1.4 (L:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 212 Back     information, alignment and structure
>d1rypl_ d.153.1.4 (L:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 212 Back     information, alignment and structure
>d1q5qh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Rhodococcus erythropolis [TaxId: 1833]} Length = 224 Back     information, alignment and structure
>d1q5qh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Rhodococcus erythropolis [TaxId: 1833]} Length = 224 Back     information, alignment and structure
>d1q5qh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Rhodococcus erythropolis [TaxId: 1833]} Length = 224 Back     information, alignment and structure
>d1irul_ d.153.1.4 (L:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 201 Back     information, alignment and structure
>d1irul_ d.153.1.4 (L:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 201 Back     information, alignment and structure
>d1irul_ d.153.1.4 (L:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 201 Back     information, alignment and structure
>d1ryph_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 205 Back     information, alignment and structure
>d1ryph_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 205 Back     information, alignment and structure
>d1ryph_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 205 Back     information, alignment and structure
>d1yarh1 d.153.1.4 (H:1-203) Proteasome beta subunit (catalytic) {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 203 Back     information, alignment and structure
>d1yarh1 d.153.1.4 (H:1-203) Proteasome beta subunit (catalytic) {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 203 Back     information, alignment and structure
>d1iruk_ d.153.1.4 (K:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 199 Back     information, alignment and structure
>d1iruk_ d.153.1.4 (K:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 199 Back     information, alignment and structure
>d1ryp1_ d.153.1.4 (1:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 222 Back     information, alignment and structure
>d1ryp1_ d.153.1.4 (1:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 222 Back     information, alignment and structure
>d1ryp1_ d.153.1.4 (1:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 222 Back     information, alignment and structure
>d1iruj_ d.153.1.4 (J:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 204 Back     information, alignment and structure
>d1iruj_ d.153.1.4 (J:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 204 Back     information, alignment and structure
>d1irui_ d.153.1.4 (I:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 220 Back     information, alignment and structure
>d1irui_ d.153.1.4 (I:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 220 Back     information, alignment and structure
>d1irui_ d.153.1.4 (I:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 220 Back     information, alignment and structure
>d1q5qa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Rhodococcus erythropolis [TaxId: 1833]} Length = 227 Back     information, alignment and structure
>d1q5qa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Rhodococcus erythropolis [TaxId: 1833]} Length = 227 Back     information, alignment and structure
>d1iruh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 202 Back     information, alignment and structure
>d1iruh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 202 Back     information, alignment and structure
>d1iruh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 202 Back     information, alignment and structure
>d1rypi_ d.153.1.4 (I:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 222 Back     information, alignment and structure
>d1rypi_ d.153.1.4 (I:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 222 Back     information, alignment and structure
>d1rypi_ d.153.1.4 (I:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 222 Back     information, alignment and structure
>d1rypj_ d.153.1.4 (J:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 204 Back     information, alignment and structure
>d1rypj_ d.153.1.4 (J:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 204 Back     information, alignment and structure
>d1m4ya_ d.153.1.4 (A:) HslV (ClpQ) protease {Thermotoga maritima [TaxId: 2336]} Length = 171 Back     information, alignment and structure
>d1m4ya_ d.153.1.4 (A:) HslV (ClpQ) protease {Thermotoga maritima [TaxId: 2336]} Length = 171 Back     information, alignment and structure
>d1irue_ d.153.1.4 (E:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 234 Back     information, alignment and structure
>d1irue_ d.153.1.4 (E:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 234 Back     information, alignment and structure
>d1iru1_ d.153.1.4 (1:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 213 Back     information, alignment and structure
>d1iru1_ d.153.1.4 (1:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 213 Back     information, alignment and structure
>d1rypd_ d.153.1.4 (D:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 241 Back     information, alignment and structure
>d1rypd_ d.153.1.4 (D:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 241 Back     information, alignment and structure
>d1j2qh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 202 Back     information, alignment and structure
>d1j2qh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 202 Back     information, alignment and structure
>d1j2qh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 202 Back     information, alignment and structure
>d1yara1 d.153.1.4 (A:13-233) Proteasome alpha subunit (non-catalytic) {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 221 Back     information, alignment and structure
>d1yara1 d.153.1.4 (A:13-233) Proteasome alpha subunit (non-catalytic) {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 221 Back     information, alignment and structure
>d1rypc_ d.153.1.4 (C:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 244 Back     information, alignment and structure
>d1rypc_ d.153.1.4 (C:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 244 Back     information, alignment and structure
>d1rypc_ d.153.1.4 (C:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 244 Back     information, alignment and structure
>d1iruc_ d.153.1.4 (C:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 250 Back     information, alignment and structure
>d1iruc_ d.153.1.4 (C:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 250 Back     information, alignment and structure
>d1rype_ d.153.1.4 (E:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 242 Back     information, alignment and structure
>d1rype_ d.153.1.4 (E:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 242 Back     information, alignment and structure
>d1irub_ d.153.1.4 (B:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 233 Back     information, alignment and structure
>d1irub_ d.153.1.4 (B:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 233 Back     information, alignment and structure
>d1j2pa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 243 Back     information, alignment and structure
>d1j2pa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 243 Back     information, alignment and structure
>d1rypg_ d.153.1.4 (G:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 244 Back     information, alignment and structure
>d1rypg_ d.153.1.4 (G:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 244 Back     information, alignment and structure
>d1rypg_ d.153.1.4 (G:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 244 Back     information, alignment and structure
>d1g3ka_ d.153.1.4 (A:) HslV (ClpQ) protease {Haemophilus influenzae [TaxId: 727]} Length = 173 Back     information, alignment and structure
>d1g3ka_ d.153.1.4 (A:) HslV (ClpQ) protease {Haemophilus influenzae [TaxId: 727]} Length = 173 Back     information, alignment and structure
>d1rypb_ d.153.1.4 (B:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 250 Back     information, alignment and structure
>d1rypb_ d.153.1.4 (B:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 250 Back     information, alignment and structure
>d1iruf_ d.153.1.4 (F:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 238 Back     information, alignment and structure
>d1iruf_ d.153.1.4 (F:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 238 Back     information, alignment and structure
>d1irug_ d.153.1.4 (G:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 245 Back     information, alignment and structure
>d1irug_ d.153.1.4 (G:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 245 Back     information, alignment and structure
>d1irug_ d.153.1.4 (G:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 245 Back     information, alignment and structure
>d2z3ba1 d.153.1.4 (A:1-180) HslV (ClpQ) protease {Bacillus subtilis [TaxId: 1423]} Length = 180 Back     information, alignment and structure
>d2z3ba1 d.153.1.4 (A:1-180) HslV (ClpQ) protease {Bacillus subtilis [TaxId: 1423]} Length = 180 Back     information, alignment and structure
>d1irud_ d.153.1.4 (D:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 243 Back     information, alignment and structure
>d1irud_ d.153.1.4 (D:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 243 Back     information, alignment and structure
>d1rypf_ d.153.1.4 (F:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 233 Back     information, alignment and structure
>d1irua_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 244 Back     information, alignment and structure
>d1irua_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Length = 244 Back     information, alignment and structure
>d1rypa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 243 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query279
d1ryph_205 Proteasome beta subunit (catalytic) {Baker's yeast 99.91
d1ryp1_222 Proteasome beta subunit (catalytic) {Baker's yeast 99.9
d1rypl_212 Proteasome beta subunit (catalytic) {Baker's yeast 99.9
d1ryp2_233 Proteasome beta subunit (catalytic) {Baker's yeast 99.9
d1iru2_217 Proteasome beta subunit (catalytic) {Cow (Bos taur 99.9
d1irul_201 Proteasome beta subunit (catalytic) {Cow (Bos taur 99.9
d1rypi_222 Proteasome beta subunit (catalytic) {Baker's yeast 99.9
d1irui_220 Proteasome beta subunit (catalytic) {Cow (Bos taur 99.89
d1rypc_244 Proteasome alpha subunit (non-catalytic) {Baker's 99.89
d1yarh1203 Proteasome beta subunit (catalytic) {Archaeon Ther 99.88
d1iruj_204 Proteasome beta subunit (catalytic) {Cow (Bos taur 99.88
d1rypk_198 Proteasome beta subunit (catalytic) {Baker's yeast 99.88
d1iruh_202 Proteasome beta subunit (catalytic) {Cow (Bos taur 99.88
d1iruc_250 Proteasome alpha subunit (non-catalytic) {Cow (Bos 99.88
d1yara1221 Proteasome alpha subunit (non-catalytic) {Archaeon 99.87
d1iru1_213 Proteasome beta subunit (catalytic) {Cow (Bos taur 99.87
d1j2qh_202 Proteasome beta subunit (catalytic) {Archaeon Arch 99.87
d1j2pa_243 Proteasome alpha subunit (non-catalytic) {Archaeon 99.87
d1rypb_250 Proteasome alpha subunit (non-catalytic) {Baker's 99.86
d1rypj_204 Proteasome beta subunit (catalytic) {Baker's yeast 99.86
d1rype_242 Proteasome alpha subunit (non-catalytic) {Baker's 99.86
d1q5qh_224 Proteasome beta subunit (catalytic) {Rhodococcus e 99.85
d1irue_234 Proteasome alpha subunit (non-catalytic) {Cow (Bos 99.85
d1rypg_244 Proteasome alpha subunit (non-catalytic) {Baker's 99.85
d1irub_233 Proteasome alpha subunit (non-catalytic) {Cow (Bos 99.85
d1irug_245 Proteasome alpha subunit (non-catalytic) {Cow (Bos 99.85
d1q5qa_227 Proteasome alpha subunit (non-catalytic) {Rhodococ 99.84
d1iruk_199 Proteasome beta subunit (catalytic) {Cow (Bos taur 99.84
d1rypd_241 Proteasome alpha subunit (non-catalytic) {Baker's 99.83
d1irua_244 Proteasome alpha subunit (non-catalytic) {Cow (Bos 99.83
d1rypa_243 Proteasome alpha subunit (non-catalytic) {Baker's 99.82
d1iruf_238 Proteasome alpha subunit (non-catalytic) {Cow (Bos 99.82
d1irud_243 Proteasome alpha subunit (non-catalytic) {Cow (Bos 99.82
d1ryp2_ 233 Proteasome beta subunit (catalytic) {Baker's yeast 99.79
d2z3ba1180 HslV (ClpQ) protease {Bacillus subtilis [TaxId: 14 99.79
d1rypf_233 Proteasome alpha subunit (non-catalytic) {Baker's 99.79
d1irul_201 Proteasome beta subunit (catalytic) {Cow (Bos taur 99.78
d1iru2_217 Proteasome beta subunit (catalytic) {Cow (Bos taur 99.78
d1m4ya_171 HslV (ClpQ) protease {Thermotoga maritima [TaxId: 99.77
d1iruj_204 Proteasome beta subunit (catalytic) {Cow (Bos taur 99.77
d1yara1221 Proteasome alpha subunit (non-catalytic) {Archaeon 99.76
d1rypk_198 Proteasome beta subunit (catalytic) {Baker's yeast 99.75
d1irug_245 Proteasome alpha subunit (non-catalytic) {Cow (Bos 99.75
d1j2qh_202 Proteasome beta subunit (catalytic) {Archaeon Arch 99.74
d1iruc_ 250 Proteasome alpha subunit (non-catalytic) {Cow (Bos 99.74
d1irui_ 220 Proteasome beta subunit (catalytic) {Cow (Bos taur 99.74
d1rypc_244 Proteasome alpha subunit (non-catalytic) {Baker's 99.74
d1rypd_241 Proteasome alpha subunit (non-catalytic) {Baker's 99.74
d1g3ka_173 HslV (ClpQ) protease {Haemophilus influenzae [TaxI 99.73
d1rypg_ 244 Proteasome alpha subunit (non-catalytic) {Baker's 99.73
d1yarh1203 Proteasome beta subunit (catalytic) {Archaeon Ther 99.73
d1ryph_205 Proteasome beta subunit (catalytic) {Baker's yeast 99.73
d1irud_ 243 Proteasome alpha subunit (non-catalytic) {Cow (Bos 99.73
d1iruh_202 Proteasome beta subunit (catalytic) {Cow (Bos taur 99.73
d1irue_234 Proteasome alpha subunit (non-catalytic) {Cow (Bos 99.72
d1iruf_238 Proteasome alpha subunit (non-catalytic) {Cow (Bos 99.71
d1rypb_ 250 Proteasome alpha subunit (non-catalytic) {Baker's 99.71
d1irua_244 Proteasome alpha subunit (non-catalytic) {Cow (Bos 99.71
d1rypf_233 Proteasome alpha subunit (non-catalytic) {Baker's 99.7
d1rype_242 Proteasome alpha subunit (non-catalytic) {Baker's 99.7
d1j2pa_243 Proteasome alpha subunit (non-catalytic) {Archaeon 99.7
d1rypl_ 212 Proteasome beta subunit (catalytic) {Baker's yeast 99.69
d1ryp1_ 222 Proteasome beta subunit (catalytic) {Baker's yeast 99.69
d1rypi_ 222 Proteasome beta subunit (catalytic) {Baker's yeast 99.69
d1rypa_243 Proteasome alpha subunit (non-catalytic) {Baker's 99.69
d1irub_233 Proteasome alpha subunit (non-catalytic) {Cow (Bos 99.68
d1rypj_204 Proteasome beta subunit (catalytic) {Baker's yeast 99.68
d1iru1_213 Proteasome beta subunit (catalytic) {Cow (Bos taur 99.67
d1q5qa_ 227 Proteasome alpha subunit (non-catalytic) {Rhodococ 99.64
d1iruk_199 Proteasome beta subunit (catalytic) {Cow (Bos taur 99.61
d1q5qh_ 224 Proteasome beta subunit (catalytic) {Rhodococcus e 99.55
d1g3ka_173 HslV (ClpQ) protease {Haemophilus influenzae [TaxI 98.93
d2z3ba1180 HslV (ClpQ) protease {Bacillus subtilis [TaxId: 14 98.86
d1m4ya_171 HslV (ClpQ) protease {Thermotoga maritima [TaxId: 98.85
>d1ryph_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: Ntn hydrolase-like
superfamily: N-terminal nucleophile aminohydrolases (Ntn hydrolases)
family: Proteasome subunits
domain: Proteasome beta subunit (catalytic)
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]
Probab=99.91  E-value=2.5e-25  Score=189.55  Aligned_cols=148  Identities=18%  Similarity=0.209  Sum_probs=130.3

Q ss_pred             CccCCccEEEEEeCCeEEEEEeCCCccCCceeeCCCCceEEecCceEeeecCcccccccchhhhhccc------------
Q psy9489          94 PLTTGTSVLGLVFNGGVILAADSAGYYGSMMRFNDCPRIMQINKFTILGAGNDYADFQYLNDIVKQKI------------  161 (279)
Q Consensus        94 ~~~~G~t~lgi~~~~gVvlaaD~r~~~~~~i~~~~~~Ki~~i~~~~~~~~sG~~aD~~~l~~~l~~~~------------  161 (279)
                      ++++|||+|||+++||||||+|+|.+.+.++.+++.+||++|++|++++++|..+|++.+.+.++.+.            
T Consensus         5 ~v~~GtTivgi~~~dgVvlaaD~r~s~g~~i~~~~~~ki~~i~~~i~~~~sG~~aD~~~l~~~~~~~~~~~~~~~~~~~~   84 (205)
T d1ryph_           5 EVSLGASIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAIADIVQYHLELYTSQYGTPST   84 (205)
T ss_dssp             CCBCCCCEEEEEETTEEEEEECCCEEETTEEEESSCCCEEEEETTEEEEEEEBHHHHHHHHHHHHHHHHHHHHHHSSCCH
T ss_pred             cccCcceEEEEEECCEEEEEECCccccCceeeccccceEEEccCceEEeeccchhHHHHHHHHHHHHHHHHHHHcCCccH
Confidence            57899999999999999999999999999999999999999999999999999999999999988511            


Q ss_pred             ---------------ccccceeeEEEEEeC-CcEEEEEcCCCccCceeeecCCCceEEecccEEEEeccChhhHHHHHHH
Q psy9489         162 ---------------TPLTTGTSVLGLVFN-GGVILAADSAGYYGSMMRFNDCPRIMQINKFTILGAGNDYADFQYLNDI  225 (279)
Q Consensus       162 ---------------~pi~~g~tvlgi~~~-~gvlia~D~~gs~g~li~~~~~~kI~~i~~~~~~~gSG~~aD~~~l~~~  225 (279)
                                     .|...+..+.|++.+ ++.|+..|+.|++              ...++.+.|+|+    .++..+
T Consensus        85 ~~~~~~~~~~~~~~~~p~~~~~lvaG~d~~~~p~Ly~~d~~G~~--------------~~~~~~a~G~g~----~~~~~~  146 (205)
T d1ryph_          85 ETAASVFKELCYENKDNLTAGIIVAGYDDKNKGEVYTIPLGGSV--------------HKLPYAIAGSGS----TFIYGY  146 (205)
T ss_dssp             HHHHHHHHHHHHHTTTTCCEEEEEEEEETTTEEEEEEECTTSCC--------------EEESEEEESGGG----GGGHHH
T ss_pred             HHHHHHHHHHHHhCccCceEEEEEEeecCCCCcEEEEECCCCcE--------------EecCeEEeecCc----HHHHHH
Confidence                           122222333488754 5789999999987              667899999999    999999


Q ss_pred             HHhhcccccccccCCCCCHHHHHHHHHHHHhhcc
Q psy9489         226 VKQKILDDDLHNDGFVLKPKSLHSWLTRVLYNRR  259 (279)
Q Consensus       226 l~~~~~~~~~~ee~~~l~~~~la~~isr~lys~r  259 (279)
                      |++.|+++|+.+|+.++..+++.+++.++.++..
T Consensus       147 Le~~~~~~ms~~ea~~l~~~al~~a~~rD~~sg~  180 (205)
T d1ryph_         147 CDKNFRENMSKEETVDFIKHSLSQAIKWDGSSGG  180 (205)
T ss_dssp             HHHHCCTTCCHHHHHHHHHHHHHHHHHHBTTCCS
T ss_pred             HHhhhhcccCHHHHHHHHHHHHHHHHHhcCcCCC
Confidence            9999999999999999999999999999988754



>d1ryp1_ d.153.1.4 (1:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rypl_ d.153.1.4 (L:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ryp2_ d.153.1.4 (2:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iru2_ d.153.1.4 (2:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1irul_ d.153.1.4 (L:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rypi_ d.153.1.4 (I:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1irui_ d.153.1.4 (I:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rypc_ d.153.1.4 (C:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yarh1 d.153.1.4 (H:1-203) Proteasome beta subunit (catalytic) {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1iruj_ d.153.1.4 (J:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rypk_ d.153.1.4 (K:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iruh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1iruc_ d.153.1.4 (C:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1yara1 d.153.1.4 (A:13-233) Proteasome alpha subunit (non-catalytic) {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1iru1_ d.153.1.4 (1:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1j2qh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1j2pa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1rypb_ d.153.1.4 (B:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rypj_ d.153.1.4 (J:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rype_ d.153.1.4 (E:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1q5qh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Rhodococcus erythropolis [TaxId: 1833]} Back     information, alignment and structure
>d1irue_ d.153.1.4 (E:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rypg_ d.153.1.4 (G:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1irub_ d.153.1.4 (B:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1irug_ d.153.1.4 (G:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1q5qa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Rhodococcus erythropolis [TaxId: 1833]} Back     information, alignment and structure
>d1iruk_ d.153.1.4 (K:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rypd_ d.153.1.4 (D:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1irua_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rypa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iruf_ d.153.1.4 (F:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1irud_ d.153.1.4 (D:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ryp2_ d.153.1.4 (2:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2z3ba1 d.153.1.4 (A:1-180) HslV (ClpQ) protease {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1rypf_ d.153.1.4 (F:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1irul_ d.153.1.4 (L:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1iru2_ d.153.1.4 (2:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1m4ya_ d.153.1.4 (A:) HslV (ClpQ) protease {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1iruj_ d.153.1.4 (J:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1yara1 d.153.1.4 (A:13-233) Proteasome alpha subunit (non-catalytic) {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1rypk_ d.153.1.4 (K:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1irug_ d.153.1.4 (G:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1j2qh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1iruc_ d.153.1.4 (C:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1irui_ d.153.1.4 (I:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rypc_ d.153.1.4 (C:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rypd_ d.153.1.4 (D:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1g3ka_ d.153.1.4 (A:) HslV (ClpQ) protease {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1rypg_ d.153.1.4 (G:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1yarh1 d.153.1.4 (H:1-203) Proteasome beta subunit (catalytic) {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1ryph_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1irud_ d.153.1.4 (D:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1iruh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1irue_ d.153.1.4 (E:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1iruf_ d.153.1.4 (F:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rypb_ d.153.1.4 (B:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1irua_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rypf_ d.153.1.4 (F:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rype_ d.153.1.4 (E:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1j2pa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1rypl_ d.153.1.4 (L:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ryp1_ d.153.1.4 (1:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rypi_ d.153.1.4 (I:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1rypa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1irub_ d.153.1.4 (B:) Proteasome alpha subunit (non-catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1rypj_ d.153.1.4 (J:) Proteasome beta subunit (catalytic) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1iru1_ d.153.1.4 (1:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1q5qa_ d.153.1.4 (A:) Proteasome alpha subunit (non-catalytic) {Rhodococcus erythropolis [TaxId: 1833]} Back     information, alignment and structure
>d1iruk_ d.153.1.4 (K:) Proteasome beta subunit (catalytic) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1q5qh_ d.153.1.4 (H:) Proteasome beta subunit (catalytic) {Rhodococcus erythropolis [TaxId: 1833]} Back     information, alignment and structure
>d1g3ka_ d.153.1.4 (A:) HslV (ClpQ) protease {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2z3ba1 d.153.1.4 (A:1-180) HslV (ClpQ) protease {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1m4ya_ d.153.1.4 (A:) HslV (ClpQ) protease {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure