Psyllid ID: psy9575

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780------
MRASLQLAQEGLNVAILSKVFPTRSHTVAAQGGISASLGNMSKDNWHWHMFDTIKGSDYLGDQDAIEFMCKEAPKVVYELEHFGMPFDRNKNGTIYQRPFGGHSSNFGEKPIARACAVADRTGHALLHTLYQRNLHAKTNFFIEWMAIDLISDSEGDILGVVALEMETGNIMILESKITILATGGGGRIWAASTNAFINTGDGLGMAARAGLPLEDMEFWQFHPTGVAGAGVLITEGVRGEGGILINSNGERFMERYAPILKDLAPRDFVSRAMDQEIKEGRGCGPNKDHVMLDLRHINSETIINRLPSILEIGNKFANVNALKEPIPVIPTIHYQMGGIPTNIYGQVIIPNNDNNKIVNGLYAIGECACVSVHGANRLGTNSLLDLLVFGRSAGNHILSLELKKIHNKKLPINSIDIIIDRLSKLENNKGSESVQSVANDIRKTMQNYCGVFRTDKLMKNGYKKIMILDERRKYISFKDKSKIFNTARIEALELDNLIETAKATISSAISRKESRGAHAHNDFKNRDDINWLKHSIWYSNGNRIEFKPVNLKPLTVKTVHPKKHHDIKPYMQKFLVNLSSNDKMLLDALHRIKYDIDDSLTLRRSCREGVCGSDAMNINGKNGLACITNLNELKQPIIIRPLPGLPVIRDLVVDMTLFFKQFNSIKPFLITNNNPPEKERLQSPSQRKILDGLYECILCGCCSTACPSFWWNSDRFVGPAGLLQAYRFISDSRDEATNFRLDNLEDPYRLFRCRSIMNCVDTCPKGLNPNRSINKIKELMIYRII
cHHcHHHHHccccEEEEEccccccccHHHHccccEEEcccccccccHHHHHcccccccccccHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccccHHHHcccHHHHHHHHHHHHHHHcccEEEEHHHHHHHHHcccccEEEEEEEEcccccEEEEEccEEEEEcccccccccccccccccccHHHHHHHHHcccccccccEEccccccccccEEEcccccccccEEEccccccccccccccccccccHHHHHHHHHHHHHHcccccccccEEEEEcccccHHHHHHHcHHHHHHHHHHcccccccccccccccccccccccccccccEEEEcccccccccccEEEEccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHcccEEEEcHHHHHHHHHHHHHHHHHHcccEEEcccccccHHHHHHHHHHcHHHHHHHHHHHHHHcccccccccccccccccccccccEEEEEEccccEEEEEcccccccccccccccccccccccEEEccccccccHHHHHHHHHHcccccHHHHHHHHHccccccccccccccccccEEEcccccccccEEEcccccccHHHHHHHHHHHHHHHccccccEEEcccccccccccccccHHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHEEcc
HHHHHHHHcccccEEEEccccHHHcHHHHccccEEcccccccccccEEEEEcccccccccccHHHHHHHHHHccHHHHHHHHcccccccccccEEEEccccccccccccccHHHHHHHHcccHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHcccccEEEEEEEEcccccEEEEEccEEEEcccccHHHcccEccccccccHHHHHHHHccccEEccccEEEEccEEcccccEccccccccccEEEcccccEcHHHHccccHHHccHHHHHHHHHHHHHccccccccccEEEEEcccccHHHHHHHcccHHHHHHHHccccccccccccccEEEEccccccccccEEEEEcccccccccEcEEEccccEEcccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccccHHHHHHHHHHHHHHHHccccEcHHHHHHHHHHHHHHHccccEcHHHHHHHHHHHHHHHHHHccEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccEccEcEcccccEEcccccEEEEEEEccccccEEEEEEEEEEEccccccccccccccEEEEEEccccHHHHHHHHHHHHHHcccccccEcccccccccccccHcEccccccHHHccHHHccccEEEcccccccHHHHHHHHHHHHHHHHcccccEEEEcccccHHHHcccHcHHHHHcccHHHEEccccccccccccccccccccHHHHHHHHHHHcccccccccccccccccccEEEEEHHHHHccccccccccccccHHHHHHHHHHHHc
MRASLQLAQEGLNVAILSkvfptrshtvaaqggisaslgnmskdnwhwhmfdtikgsdylgdQDAIEFMCKEAPKVVYELEhfgmpfdrnkngtiyqrpfgghssnfgekpIARACAVADRTGHALLHTLYQRNLHAKTNFFIEWMAIDlisdsegdILGVVALEMETGNIMILESKITILATggggriwaastnafintgdglgmaaraglpledmefwqfhptgvagagvlitegvrgeggilinsngerfMERYapilkdlaprdfVSRAMDQEIkegrgcgpnkdhVMLDLRHINSETIINRLPSILEIGNKFanvnalkepipviptihyqmggiptniygqviipnndnnkivnGLYAIGEcacvsvhganrlgtnSLLDLLVFGRSAGNHILSLELKKihnkklpinsIDIIIDRLSKlennkgsesvQSVANDIRKTMQNYCgvfrtdklmknGYKKIMILDERRKYISFKDKSKIFNTARIEALELDNLIETAKATISSAIsrkesrgahahndfknrddinwLKHSIWysngnriefkpvnlkpltvktvhpkkhhdikpyMQKFLVNLSSNDKMLLDALHRIKydiddsltlrrscregvcgsdamningknGLACITNlnelkqpiiirplpglpviRDLVVDMTLFFKqfnsikpflitnnnppekerlqspsqrkILDGLYecilcgccstacpsfwwnsdrfvgpagLLQAYRFISdsrdeatnfrldnledpyrlfrcrsimncvdtcpkglnpnrsiNKIKELMIYRII
MRASLQLAQEGLNVAILSKVFPTRSHTVAAQGGISASLGNMSKDNWHWHMFDTIKGSDYLGDQDAIEFMCKEAPKVVYELEHFGMPFDRNKNGTIYQRPFGGHSSNFGEKPIARACAVADRTGHALLHTLYQRNLHAKTNFFIEWMAIDLISDSEGDILGVVALEMETGNIMILESKITILATGGGGRIWAASTNAFINTGDGLGMAARAGLPLEDMEFWQFHPTGVAGAGVLITEGVRGEGGILINSNGERFMERYAPILKDLAPRDFVSRAMDQEikegrgcgpnkDHVMLDLRHINSETIINRLPSILEIGNKFANVNALKEPIPVIPTIHYQMGGIPTNIYGQVIIPNNDNNKIVNGLYAIGECACVSVHGANRLGTNSLLDLLVFGRSAGNHILSLElkkihnkklpinSIDIIIDRLSKLENNKGSESVQSVANDIRKTMQNYCgvfrtdklmkngYKKIMilderrkyisfkdkskIFNTARIEALELDNLIETAKATISsaisrkesrgahahndfknrddinWLKHSIWYSNGNRIEFKPVNLKPLTVKTVHPKKHHDIKPYMQKFLVNLSSNDKMLLDALHRIKydiddsltlrrSCREGVcgsdamninGKNGLACITNLNELKQPIIIRPLPGLPVIRDLVVDMTLFFKQFNSIKPFLITNNNPPEKERLQSPSQRKILDGLYECILCGCCSTACPSFWWNSDRFVGPAGLLQAYRFISDSRDEAtnfrldnledpyrLFRCRSIMNcvdtcpkglnpnrsinkikelmiyrii
MRASLQLAQEGLNVAILSKVFPTRSHTVAAQGGISASLGNMSKDNWHWHMFDTIKGSDYLGDQDAIEFMCKEAPKVVYELEHFGMPFDRNKNGTIYQRPFGGHSSNFGEKPIARACAVADRTGHALLHTLYQRNLHAKTNFFIEWMAIDLISDSEGDILGVVALEMETGNIMILESKITILATGGGGRIWAASTNAFINTGDGLGMAARAGLPLEDMEFWQFHPTGVAGAGVLITEGVRGEGGILINSNGERFMERYAPILKDLAPRDFVSRAMDQEIKEGRGCGPNKDHVMLDLRHINSETIINRLPSILEIGNKFANVNALKEPIPVIPTIHYQMGGIPTNIYGQVIIPNNDNNKIVNGLYAIGECACVSVHGANRLGTNSLLDLLVFGRSAGNHILSLELKKIHNKKLPINSIDIIIDRLSKLENNKGSESVQSVANDIRKTMQNYCGVFRTDKLMKNGYKKIMILDERRKYISFKDKSKIFNTARIEALELDNLIETAKATISSAISRKESRGAHAHNDFKNRDDINWLKHSIWYSNGNRIEFKPVNLKPLTVKTVHPKKHHDIKPYMQKFLVNLSSNDKMLLDALHRIKYDIDDSLTLRRSCREGVCGSDAMNINGKNGLACITNLNELKQPIIIRPLPGLPVIRDLVVDMTLFFKQFNSIKPFLITNNNPPEKERLQSPSQRKILDGLYECILCGCCSTACPSFWWNSDRFVGPAGLLQAYRFISDSRDEATNFRLDNLEDPYRLFRCRSIMNCVDTCPKGLNPNRSINKIKELMIYRII
**********GLNVAILSKVFPTRSHTVAAQGGISASLGNMSKDNWHWHMFDTIKGSDYLGDQDAIEFMCKEAPKVVYELEHFGMPFDRNKNGTIYQRPFGGHSSNFGEKPIARACAVADRTGHALLHTLYQRNLHAKTNFFIEWMAIDLISDSEGDILGVVALEMETGNIMILESKITILATGGGGRIWAASTNAFINTGDGLGMAARAGLPLEDMEFWQFHPTGVAGAGVLITEGVRGEGGILINSNGERFMERYAPILKDLAPRDFVSRA*********GCGPNKDHVMLDLRHINSETIINRLPSILEIGNKFANVNALKEPIPVIPTIHYQMGGIPTNIYGQVIIPNNDNNKIVNGLYAIGECACVSVHGANRLGTNSLLDLLVFGRSAGNHILSLELKKIHNKKLPINSIDIIIDRLSK**************NDIRKTMQNYCGVFRTDKLMKNGYKKIMILDERRKYISFKDKSKIFNTARIEALELDNLIETAKATI*****************FKNRDDINWLKHSIWYSNGNRIEFKPVNLKPLTVKTVHPKKHHDIKPYMQKFLVNLSSNDKMLLDALHRIKYDIDDSLTLRRSCREGVCGSDAMNINGKNGLACITNLNELKQPIIIRPLPGLPVIRDLVVDMTLFFKQFNSIKPFLIT****************KILDGLYECILCGCCSTACPSFWWNSDRFVGPAGLLQAYRFI********************************************************
MRASL**AQEGLNVAILSKVFPTRSHTVAAQGGISASLGNMSKDNWHWHMFDTIKGSDYLGDQDAIEFMCKEAPKVVYELEHFGMPFDRNKNGTIYQRPFGGHSSNFGEKPIARACAVADRTGHALLHTLYQRNLHAKTNFFIEWMAIDLISDSEGDILGVVALEMETGNIMILESKITILATGGGGRIWAASTNAFINTGDGLGMAARAGLPLEDMEFWQFHPTGVAGAGVLITEGVRGEGGILINSNGERFMERYAPILKDLAPRDFVSRAMDQEIKEGRGCGPNKDHVMLDLRHINSETIINRLPSILEIGNKFANVNALKEPIPVIPTIHYQMGGIPTNIYGQVIIPNNDNNKIVNGLYAIGECACVSVHGANRLGTNSLLDLLVFGRSAGNHILS******************IIDRLSKLENNKGSESVQSVANDIRKTMQNYCGVFRTDKLMKNGYKKIMILDERRKYISFKDKSKIFNTARIEALELDNLIETAKATISSAISRKESRGAHAHNDFKNRDDINWLKHSIWYSNGNRIEFKPVNLKPLTVKTVHPKKHHDIKPYMQKFLVNLSSNDKMLLDALHRIKYDIDDSLTLRRSCRE*VCGSDAMNINGKNGLACITNLNELKQPIIIRPLPGLPVIRDLVVDMTLFFKQFNSIKPFLIT******************LDGLYECILCGCCSTACPSFWWNSDRFVGPAGLLQAYRFISDSRDEATNFRLDNLEDPYRLFRCRSIMNCVDTCPKGLNPNRSINKIKELMIYRII
MRASLQLAQEGLNVAILSKVFPTRSHTVAAQGGISASLGNMSKDNWHWHMFDTIKGSDYLGDQDAIEFMCKEAPKVVYELEHFGMPFDRNKNGTIYQRPFGGHSSNFGEKPIARACAVADRTGHALLHTLYQRNLHAKTNFFIEWMAIDLISDSEGDILGVVALEMETGNIMILESKITILATGGGGRIWAASTNAFINTGDGLGMAARAGLPLEDMEFWQFHPTGVAGAGVLITEGVRGEGGILINSNGERFMERYAPILKDLAPRDFVSRAMDQEIKEGRGCGPNKDHVMLDLRHINSETIINRLPSILEIGNKFANVNALKEPIPVIPTIHYQMGGIPTNIYGQVIIPNNDNNKIVNGLYAIGECACVSVHGANRLGTNSLLDLLVFGRSAGNHILSLELKKIHNKKLPINSIDIIIDRLSKLEN********SVANDIRKTMQNYCGVFRTDKLMKNGYKKIMILDERRKYISFKDKSKIFNTARIEALELDNLIETAKATISSAI*********AHNDFKNRDDINWLKHSIWYSNGNRIEFKPVNLKPLTVKTVHPKKHHDIKPYMQKFLVNLSSNDKMLLDALHRIKYDIDDSLTLRRSCREGVCGSDAMNINGKNGLACITNLNELKQPIIIRPLPGLPVIRDLVVDMTLFFKQFNSIKPFLITNNNPP********SQRKILDGLYECILCGCCSTACPSFWWNSDRFVGPAGLLQAYRFISDSRDEATNFRLDNLEDPYRLFRCRSIMNCVDTCPKGLNPNRSINKIKELMIYRII
MRASLQLAQEGLNVAILSKVFPTRSHTVAAQGGISASLGNMSKDNWHWHMFDTIKGSDYLGDQDAIEFMCKEAPKVVYELEHFGMPFDRNKNGTIYQRPFGGHSSNFGEKPIARACAVADRTGHALLHTLYQRNLHAKTNFFIEWMAIDLISDSEGDILGVVALEMETGNIMILESKITILATGGGGRIWAASTNAFINTGDGLGMAARAGLPLEDMEFWQFHPTGVAGAGVLITEGVRGEGGILINSNGERFMERYAPILKDLAPRDFVSRAMDQEIKEGRGCGPNKDHVMLDLRHINSETIINRLPSILEIGNKFANVNALKEPIPVIPTIHYQMGGIPTNIYGQVIIPNNDNNKIVNGLYAIGECACVSVHGANRLGTNSLLDLLVFGRSAGNHILSLELKKIHNKKLPINSIDIIIDRLSKLENNKGSESVQSVANDIRKTMQNYCGVFRTDKLMKNGYKKIMILDERRKYISFKDKSKIFNTARIEALELDNLIETAKATISSAISRKESRGAHAHNDFKNRDDINWLKHSIWYSNGNRIEFKPVNLKPLTVKTVHPKKHHDIKPYMQKFLVNLSSNDKMLLDALHRIKYDIDDSLTLRRSCREGVCGSDAMNINGKNGLACITNLNELKQPIIIRPLPGLPVIRDLVVDMTLFFKQFNSIKPFLITNNNPPEKERLQSPSQRKILDGLYECILCGCCSTACPSFWWNSDRFVGPAGLLQAYRFISDSRDEATNFRLDNLEDPYRLFRCRSIMNCVDTCPKGLNPNRSINKIKELMIYRII
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRASLQLAQEGLNVAILSKVFPTRSHTVAAQGGISASLGNMSKDNWHWHMFDTIKGSDYLGDQDAIEFMCKEAPKVVYELEHFGMPFDRNKNGTIYQRPFGGHSSNFGEKPIARACAVADRTGHALLHTLYQRNLHAKTNFFIEWMAIDLISDSEGDILGVVALEMETGNIMILESKITILATGGGGRIWAASTNAFINTGDGLGMAARAGLPLEDMEFWQFHPTGVAGAGVLITEGVRGEGGILINSNGERFMERYAPILKDLAPRDFVSRAMDQEIKEGRGCGPNKDHVMLDLRHINSETIINRLPSILEIGNKFANVNALKEPIPVIPTIHYQMGGIPTNIYGQVIIPNNDNNKIVNGLYAIGECACVSVHGANRLGTNSLLDLLVFGRSAGNHILSLELKKIHNKKLPINSIDIIIDRLSKLENNKGSESVQSVANDIRKTMQNYCGVFRTDKLMKNGYKKIMILDERRKYISFKDKSKIFNTARIEALELDNLIETAKATISSAISRKESRGAHAHNDFKNRDDINWLKHSIWYSNGNRIEFKPVNLKPLTVKTVHPKKHHDIKPYMQKFLVNLSSNDKMLLDALHRIKYDIDDSLTLRRSCREGVCGSDAMNINGKNGLACITNLNELKQPIIIRPLPGLPVIRDLVVDMTLFFKQFNSIKPFLITNNNPPEKERLQSPSQRKILDGLYECILCGCCSTACPSFWWNSDRFVGPAGLLQAYRFISDSRDEATNFRLDNLEDPYRLFRCRSIMNCVDTCPKGLNPNRSINKIKELMIYRII
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query786 2.2.26 [Sep-21-2011]
P51054587 Succinate dehydrogenase f yes N/A 0.694 0.930 0.563 0.0
Q59661600 Succinate dehydrogenase f yes N/A 0.702 0.92 0.536 1e-180
Q68XN9596 Succinate dehydrogenase f yes N/A 0.716 0.944 0.549 1e-178
P31038596 Succinate dehydrogenase f yes N/A 0.706 0.931 0.554 1e-177
Q1RHB9596 Succinate dehydrogenase f yes N/A 0.706 0.931 0.546 1e-177
Q92J97596 Succinate dehydrogenase f yes N/A 0.716 0.944 0.542 1e-177
Q4UJM1596 Succinate dehydrogenase f yes N/A 0.716 0.944 0.541 1e-176
P0AC41588 Succinate dehydrogenase f N/A N/A 0.711 0.950 0.541 1e-172
P0AC42588 Succinate dehydrogenase f yes N/A 0.711 0.950 0.541 1e-172
P0AC43588 Succinate dehydrogenase f N/A N/A 0.711 0.950 0.541 1e-172
>sp|P51054|DHSA_COXBU Succinate dehydrogenase flavoprotein subunit OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=sdhA PE=3 SV=1 Back     alignment and function desciption
 Score =  660 bits (1703), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 312/554 (56%), Positives = 407/554 (73%), Gaps = 8/554 (1%)

Query: 14  VAILSKVFPTRSHTVAAQGGISASLGNMSKDNWHWHMFDTIKGSDYLGDQDAIEFMCKEA 73
           VA++SKVFPTRSHTV+AQGGI+A+LGN+  D   WHMFDT+KGSDYLGDQDAI++MC++A
Sbjct: 35  VAVVSKVFPTRSHTVSAQGGIAAALGNVVPDKPIWHMFDTVKGSDYLGDQDAIQYMCEQA 94

Query: 74  PKVVYELEHFGMPFDRNKNGTIYQRPFGGHSSNFGEKPIARACAVADRTGHALLHTLYQR 133
           P  VYELEH+G+PF R  +G IYQR FGGH+ +FG++   R CA ADRTGHA+LHTLYQ+
Sbjct: 95  PPSVYELEHYGLPFSRLDDGRIYQRAFGGHTRDFGKEMARRTCACADRTGHAMLHTLYQK 154

Query: 134 NLHAKTNFFIEWMAIDLISDSEGDILGVVALEMETGNIMILESKITILATGGGGRIWAAS 193
           N+ A T+F+ EW  IDL+  ++G I G++A+ MET  ++  +S+ TI ATGG GRI+  +
Sbjct: 155 NVEAGTHFYYEWYGIDLVRGAQGGIAGMIAMNMETSELVFFKSRATIFATGGAGRIYETT 214

Query: 194 TNAFINTGDGLGMAARAGLPLEDMEFWQFHPTGVAGAGVLITEGVRGEGGILINSNGERF 253
           +NA+ NTGDG+GM  RAGLP++DMEFWQFHPTG+ G G LITEG RGEGG LIN +GERF
Sbjct: 215 SNAYTNTGDGIGMVLRAGLPVQDMEFWQFHPTGIYGVGCLITEGARGEGGYLINKDGERF 274

Query: 254 MERYAPILKDLAPRDFVSRAMDQEIKEGRGCGPNKDHVMLDLRHINSETIINRLPSILEI 313
           MERY+P LKDL  RD V+R++ QE+  G G GP KDHV+L L H+  + +  RLP I+E+
Sbjct: 275 MERYSPHLKDLDCRDVVARSILQEVMAGGGVGPKKDHVLLKLDHLGEKVLRERLPGIIEL 334

Query: 314 GNKFANVNALKEPIPVIPTIHYQMGGIPTNIYGQVI-IPNNDNNKIVNGLYAIGECACVS 372
             KFANV+  KEPIP++PT HY MGGIPTNI+GQ + +  N  ++I+ GL+A GECACVS
Sbjct: 335 SEKFANVDITKEPIPILPTCHYMMGGIPTNIHGQALTVDENGKDQIIEGLFAAGECACVS 394

Query: 373 VHGANRLGTNSLLDLLVFGRSAGNHI---LSLELKKIHNKKLPINSIDIIIDRLSKLENN 429
           VHGANRLGTNSLLDL+VFGR+ G H+   L  ELK  H  + P + ID  I RL + E  
Sbjct: 395 VHGANRLGTNSLLDLVVFGRAIGLHLEEALKTELK--HRSENP-DDIDAAIARLKRWEKP 451

Query: 430 KGSESVQSVANDIRKTMQNYCGVFRTDKLMKNGYKKIMILDERRKYISFKDKSKIFNTAR 489
              E+   +  ++RK M    GVFR ++ MK G +++  L+ER +     D S+ FN AR
Sbjct: 452 NNVENPALLRQEMRKAMSEDFGVFREEQKMKQGLERLQKLNERLQRAKLTDTSRTFNNAR 511

Query: 490 IEALELDNLIETAKATISSAISRKESRGAHAHNDFKNRDDINWLKHSIWYSNGNRIEFKP 549
           IEALELDNL+E + AT  SA  R ESRGAH+  D+K RDD NWLKH++++ +G+ I ++P
Sbjct: 512 IEALELDNLMEVSYATAVSAQQRTESRGAHSRYDYKERDDANWLKHTVYFRDGH-IAYRP 570

Query: 550 VNLKPLTVKTVHPK 563
           VN+KP  +    PK
Sbjct: 571 VNMKPKGMDPFPPK 584

Coxiella burnetii (strain RSA 493 / Nine Mile phase I) (taxid: 227377)
EC: 1EC: .EC: 3EC: .EC: 9EC: 9EC: .EC: 1
>sp|Q59661|DHSA_PARDE Succinate dehydrogenase flavoprotein subunit OS=Paracoccus denitrificans GN=sdhA PE=3 SV=1 Back     alignment and function description
>sp|Q68XN9|DHSA_RICTY Succinate dehydrogenase flavoprotein subunit OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=sdhA PE=3 SV=1 Back     alignment and function description
>sp|P31038|DHSA_RICPR Succinate dehydrogenase flavoprotein subunit OS=Rickettsia prowazekii (strain Madrid E) GN=sdhA PE=3 SV=1 Back     alignment and function description
>sp|Q1RHB9|DHSA_RICBR Succinate dehydrogenase flavoprotein subunit OS=Rickettsia bellii (strain RML369-C) GN=sdhA PE=3 SV=1 Back     alignment and function description
>sp|Q92J97|DHSA_RICCN Succinate dehydrogenase flavoprotein subunit OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=sdhA PE=3 SV=1 Back     alignment and function description
>sp|Q4UJM1|DHSA_RICFE Succinate dehydrogenase flavoprotein subunit OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=sdhA PE=3 SV=1 Back     alignment and function description
>sp|P0AC41|DHSA_ECOLI Succinate dehydrogenase flavoprotein subunit OS=Escherichia coli (strain K12) GN=sdhA PE=1 SV=1 Back     alignment and function description
>sp|P0AC42|DHSA_ECOL6 Succinate dehydrogenase flavoprotein subunit OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=sdhA PE=3 SV=1 Back     alignment and function description
>sp|P0AC43|DHSA_ECO57 Succinate dehydrogenase flavoprotein subunit OS=Escherichia coli O157:H7 GN=sdhA PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query786
340786938610 succinate dehydrogenase flavoprotein sub 0.716 0.922 0.808 0.0
329903475592 Succinate dehydrogenase flavoprotein sub 0.716 0.951 0.799 0.0
152980484592 succinate dehydrogenase flavoprotein sub 0.716 0.951 0.796 0.0
445498367592 succinate dehydrogenase flavoprotein sub 0.716 0.951 0.796 0.0
399017637603 succinate dehydrogenase, flavoprotein su 0.716 0.933 0.780 0.0
134094982592 succinate dehydrogenase, catalytic and N 0.716 0.951 0.789 0.0
300312277592 succinate dehydrogenase flavoprotein sub 0.716 0.951 0.780 0.0
415949070592 Succinate dehydrogenase, flavoprotein su 0.716 0.951 0.781 0.0
427401392592 succinate dehydrogenase, flavoprotein su 0.716 0.951 0.785 0.0
398833701592 succinate dehydrogenase, flavoprotein su 0.716 0.951 0.776 0.0
>gi|340786938|ref|YP_004752403.1| succinate dehydrogenase flavoprotein subunit [Collimonas fungivorans Ter331] gi|340552205|gb|AEK61580.1| Succinate dehydrogenase flavoprotein subunit [Collimonas fungivorans Ter331] Back     alignment and taxonomy information
 Score =  999 bits (2584), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 456/564 (80%), Positives = 521/564 (92%), Gaps = 1/564 (0%)

Query: 1   MRASLQLAQEGLNVAILSKVFPTRSHTVAAQGGISASLGNMSKDNWHWHMFDTIKGSDYL 60
           MRASLQLA+ GLNVA+LSKVFPTRSHTVAAQGGI ASLGNMS+D+W+WHMFDT+KGSDYL
Sbjct: 43  MRASLQLAEAGLNVAVLSKVFPTRSHTVAAQGGIGASLGNMSEDSWYWHMFDTVKGSDYL 102

Query: 61  GDQDAIEFMCKEAPKVVYELEHFGMPFDRNKNGTIYQRPFGGHSSNFGEKPIARACAVAD 120
           GDQDAIEFMC+EAPK VYELEHFGMPFDRN +GTIYQRPFGGHS+NFGEKP+ARACA AD
Sbjct: 103 GDQDAIEFMCREAPKAVYELEHFGMPFDRNADGTIYQRPFGGHSANFGEKPVARACAAAD 162

Query: 121 RTGHALLHTLYQRNLHAKTNFFIEWMAIDLISDSEGDILGVVALEMETGNIMILESKITI 180
           RTGHALLHTLYQRN+ AKT+FF+EWMAIDL+ D+EGD++GVVALEMETG +MILE+K T+
Sbjct: 163 RTGHALLHTLYQRNVRAKTHFFVEWMAIDLVRDAEGDVIGVVALEMETGEVMILEAKTTV 222

Query: 181 LATGGGGRIWAASTNAFINTGDGLGMAARAGLPLEDMEFWQFHPTGVAGAGVLITEGVRG 240
           +ATGG GRIWAASTNAFINTGDG+GMAARAGLPLEDMEFWQFHPTGVAGAGVLITEGVRG
Sbjct: 223 MATGGAGRIWAASTNAFINTGDGMGMAARAGLPLEDMEFWQFHPTGVAGAGVLITEGVRG 282

Query: 241 EGGILINSNGERFMERYAPILKDLAPRDFVSRAMDQEIKEGRGCGPNKDHVMLDLRHINS 300
           EGGILIN+NGERFMERYAP LKDLAPRDFVSR+MDQEIKEGRGCGP+KDHVMLDLRHI +
Sbjct: 283 EGGILINANGERFMERYAPTLKDLAPRDFVSRSMDQEIKEGRGCGPHKDHVMLDLRHIGA 342

Query: 301 ETIINRLPSILEIGNKFANVNALKEPIPVIPTIHYQMGGIPTNIYGQVIIPNND-NNKIV 359
           ETI+ RLPSILEIG+KFANV+ALKEPIPV+PTIHYQMGGIPTN+YGQV++P N   N +V
Sbjct: 343 ETIMKRLPSILEIGHKFANVDALKEPIPVVPTIHYQMGGIPTNVYGQVVVPKNGIPNAVV 402

Query: 360 NGLYAIGECACVSVHGANRLGTNSLLDLLVFGRSAGNHILSLELKKIHNKKLPINSIDII 419
           NGLYAIGECACVSVHGANRLGTNSLLDL+VFGR+AGNHI+  +LK+  NK LP ++ D+ 
Sbjct: 403 NGLYAIGECACVSVHGANRLGTNSLLDLVVFGRAAGNHIVDSKLKERSNKALPADAADVA 462

Query: 420 IDRLSKLENNKGSESVQSVANDIRKTMQNYCGVFRTDKLMKNGYKKIMILDERRKYISFK 479
           + RL+KLE + GSE VQ VA DIRKTMQ+YCGVFRTD+L++ GYK+IM+LDERRK++SFK
Sbjct: 463 LARLAKLETSTGSERVQDVAGDIRKTMQHYCGVFRTDELLQQGYKEIMVLDERRKHVSFK 522

Query: 480 DKSKIFNTARIEALELDNLIETAKATISSAISRKESRGAHAHNDFKNRDDINWLKHSIWY 539
           DKSK+FNTAR+EALELDNLIETAKATI+SA +RKESRGAHAH D++ RDD NW+KH++WY
Sbjct: 523 DKSKVFNTARVEALELDNLIETAKATITSAAARKESRGAHAHRDYEKRDDENWMKHTLWY 582

Query: 540 SNGNRIEFKPVNLKPLTVKTVHPK 563
           S GNR+++KPV  KPLTV T  PK
Sbjct: 583 SEGNRLDYKPVITKPLTVDTFKPK 606

Source: Collimonas fungivorans Ter331

Species: Collimonas fungivorans

Genus: Collimonas

Family: Oxalobacteraceae

Order: Burkholderiales

Class: Betaproteobacteria

Phylum: Proteobacteria

Superkingdom: Bacteria
>gi|329903475|ref|ZP_08273494.1| Succinate dehydrogenase flavoprotein subunit [Oxalobacteraceae bacterium IMCC9480] gi|327548350|gb|EGF33035.1| Succinate dehydrogenase flavoprotein subunit [Oxalobacteraceae bacterium IMCC9480] Back     alignment and taxonomy information
>gi|152980484|ref|YP_001353198.1| succinate dehydrogenase flavoprotein subunit [Janthinobacterium sp. Marseille] gi|151280561|gb|ABR88971.1| succinate dehydrogenase flavoprotein subunit [Janthinobacterium sp. Marseille] Back     alignment and taxonomy information
>gi|445498367|ref|ZP_21465222.1| succinate dehydrogenase flavoprotein subunit SdhA [Janthinobacterium sp. HH01] gi|444788362|gb|ELX09910.1| succinate dehydrogenase flavoprotein subunit SdhA [Janthinobacterium sp. HH01] Back     alignment and taxonomy information
>gi|399017637|ref|ZP_10719827.1| succinate dehydrogenase, flavoprotein subunit [Herbaspirillum sp. CF444] gi|398102862|gb|EJL93038.1| succinate dehydrogenase, flavoprotein subunit [Herbaspirillum sp. CF444] Back     alignment and taxonomy information
>gi|134094982|ref|YP_001100057.1| succinate dehydrogenase, catalytic and NAD/flavoprotein subunit [Herminiimonas arsenicoxydans] gi|133738885|emb|CAL61932.1| succinate dehydrogenase, flavoprotein subunit [Herminiimonas arsenicoxydans] Back     alignment and taxonomy information
>gi|300312277|ref|YP_003776369.1| succinate dehydrogenase flavoprotein subunit [Herbaspirillum seropedicae SmR1] gi|409406699|ref|ZP_11255161.1| succinate dehydrogenase flavoprotein subunit [Herbaspirillum sp. GW103] gi|300075062|gb|ADJ64461.1| succinate dehydrogenase flavoprotein subunit protein [Herbaspirillum seropedicae SmR1] gi|386435248|gb|EIJ48073.1| succinate dehydrogenase flavoprotein subunit [Herbaspirillum sp. GW103] Back     alignment and taxonomy information
>gi|415949070|ref|ZP_11556831.1| Succinate dehydrogenase, flavoprotein subunit [Herbaspirillum frisingense GSF30] gi|407757797|gb|EKF67716.1| Succinate dehydrogenase, flavoprotein subunit [Herbaspirillum frisingense GSF30] Back     alignment and taxonomy information
>gi|427401392|ref|ZP_18892464.1| succinate dehydrogenase, flavoprotein subunit [Massilia timonae CCUG 45783] gi|425719501|gb|EKU82433.1| succinate dehydrogenase, flavoprotein subunit [Massilia timonae CCUG 45783] Back     alignment and taxonomy information
>gi|398833701|ref|ZP_10591826.1| succinate dehydrogenase, flavoprotein subunit [Herbaspirillum sp. YR522] gi|398221131|gb|EJN07558.1| succinate dehydrogenase, flavoprotein subunit [Herbaspirillum sp. YR522] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query786
TIGR_CMR|CBU_1401587 CBU_1401 "succinate dehydrogen 0.711 0.952 0.558 6.9e-173
UNIPROTKB|Q9KQB1588 VC_2089 "Succinate dehydrogena 0.716 0.957 0.552 9.7e-167
TIGR_CMR|VC_2089588 VC_2089 "succinate dehydrogena 0.716 0.957 0.552 9.7e-167
UNIPROTKB|P0AC41588 sdhA [Escherichia coli K-12 (t 0.716 0.957 0.543 5.4e-166
TIGR_CMR|ECH_0315598 ECH_0315 "succinate dehydrogen 0.715 0.939 0.551 4.3e-164
TIGR_CMR|CPS_2217588 CPS_2217 "succinate dehydrogen 0.713 0.954 0.536 4.5e-162
TIGR_CMR|SPO_0360601 SPO_0360 "succinate dehydrogen 0.709 0.928 0.539 1.9e-161
TIGR_CMR|SO_1928588 SO_1928 "succinate dehydrogena 0.716 0.957 0.539 8.4e-161
UNIPROTKB|Q0BX75595 sdhA "Succinate dehydrogenase, 0.716 0.946 0.532 7.5e-160
TAIR|locus:2173654634 SDH1-1 "succinate dehydrogenas 0.713 0.884 0.528 1.1e-156
TIGR_CMR|CBU_1401 CBU_1401 "succinate dehydrogenase, flavoprotein subunit" [Coxiella burnetii RSA 493 (taxid:227377)] Back     alignment and assigned GO terms
 Score = 1680 (596.4 bits), Expect = 6.9e-173, P = 6.9e-173
 Identities = 317/568 (55%), Positives = 416/568 (73%)

Query:     1 MRASLQLAQEG-LNVAILSKVFPTRSHTVAAQGGISASLGNMSKDNWHWHMFDTIKGSDY 59
             +RA+L++AQ     VA++SKVFPTRSHTV+AQGGI+A+LGN+  D   WHMFDT+KGSDY
Sbjct:    21 LRAALEMAQSRQYKVAVVSKVFPTRSHTVSAQGGIAAALGNVVPDKPIWHMFDTVKGSDY 80

Query:    60 LGDQDAIEFMCKEAPKVVYELEHFGMPFDRNKNGTIYQRPFGGHSSNFGEKPIARACAVA 119
             LGDQDAI++MC++AP  VYELEH+G+PF R  +G IYQR FGGH+ +FG++   R CA A
Sbjct:    81 LGDQDAIQYMCEQAPPSVYELEHYGLPFSRLDDGRIYQRAFGGHTRDFGKEMARRTCACA 140

Query:   120 DRTGHALLHTLYQRNLHAKTNFFIEWMAIDLISDSEGDILGVVALEMETGNIMILESKIT 179
             DRTGHA+LHTLYQ+N+ A T+F+ EW  IDL+  ++G I G++A+ MET  ++  +S+ T
Sbjct:   141 DRTGHAMLHTLYQKNVEAGTHFYYEWYGIDLVRGAQGGIAGMIAMNMETSELVFFKSRAT 200

Query:   180 ILATGGGGRIWAASTNAFINTGDGLGMAARAGLPLEDMEFWQFHPTGVAGAGVLITEGVR 239
             I ATGG GRI+  ++NA+ NTGDG+GM  RAGLP++DMEFWQFHPTG+ G G LITEG R
Sbjct:   201 IFATGGAGRIYETTSNAYTNTGDGIGMVLRAGLPVQDMEFWQFHPTGIYGVGCLITEGAR 260

Query:   240 GEGGILINSNGERFMERYAPILKDLAPRDFVSRAMDQEIKEGRGCGPNKDHVMLDLRHIN 299
             GEGG LIN +GERFMERY+P LKDL  RD V+R++ QE+  G G GP KDHV+L L H+ 
Sbjct:   261 GEGGYLINKDGERFMERYSPHLKDLDCRDVVARSILQEVMAGGGVGPKKDHVLLKLDHLG 320

Query:   300 SETIINRLPSILEIGNKFANVNALKEPIPVIPTIHYQMGGIPTNIYGQVI-IPNNDNNKI 358
              + +  RLP I+E+  KFANV+  KEPIP++PT HY MGGIPTNI+GQ + +  N  ++I
Sbjct:   321 EKVLRERLPGIIELSEKFANVDITKEPIPILPTCHYMMGGIPTNIHGQALTVDENGKDQI 380

Query:   359 VNGLYAIGECACVSVHGANRLGTNSLLDLLVFGRSAGNHI---LSLELKKIHNKKLPINS 415
             + GL+A GECACVSVHGANRLGTNSLLDL+VFGR+ G H+   L  ELK  H  + P + 
Sbjct:   381 IEGLFAAGECACVSVHGANRLGTNSLLDLVVFGRAIGLHLEEALKTELK--HRSENP-DD 437

Query:   416 IDIIIDRLSKLENNKGSESVQSVANDIRKTMQNYCGVFRTDKLMKNGYKKIMILDERRKY 475
             ID  I RL + E     E+   +  ++RK M    GVFR ++ MK G +++  L+ER + 
Sbjct:   438 IDAAIARLKRWEKPNNVENPALLRQEMRKAMSEDFGVFREEQKMKQGLERLQKLNERLQR 497

Query:   476 ISFKDKSKIFNTARIEALELDNLIETAKATISSAISRKESRGAHAHNDFKNRDDINWLKH 535
                 D S+ FN ARIEALELDNL+E + AT  SA  R ESRGAH+  D+K RDD NWLKH
Sbjct:   498 AKLTDTSRTFNNARIEALELDNLMEVSYATAVSAQQRTESRGAHSRYDYKERDDANWLKH 557

Query:   536 SIWYSNGNRIEFKPVNLKPLTVKTVHPK 563
             ++++ +G+ I ++PVN+KP  +    PK
Sbjct:   558 TVYFRDGH-IAYRPVNMKPKGMDPFPPK 584
GO:0006099 "tricarboxylic acid cycle" evidence=ISS
GO:0009055 "electron carrier activity" evidence=ISS
GO:0045282 "plasma membrane succinate dehydrogenase complex" evidence=ISS
UNIPROTKB|Q9KQB1 VC_2089 "Succinate dehydrogenase, flavoprotein subunit" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_2089 VC_2089 "succinate dehydrogenase, flavoprotein subunit" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms
UNIPROTKB|P0AC41 sdhA [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms
TIGR_CMR|ECH_0315 ECH_0315 "succinate dehydrogenase, flavoprotein subunit" [Ehrlichia chaffeensis str. Arkansas (taxid:205920)] Back     alignment and assigned GO terms
TIGR_CMR|CPS_2217 CPS_2217 "succinate dehydrogenase, flavoprotein subunit" [Colwellia psychrerythraea 34H (taxid:167879)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_0360 SPO_0360 "succinate dehydrogenase, flavoprotein subunit" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
TIGR_CMR|SO_1928 SO_1928 "succinate dehydrogenase, flavoprotein subunit" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
UNIPROTKB|Q0BX75 sdhA "Succinate dehydrogenase, flavoprotein subunit" [Hyphomonas neptunium ATCC 15444 (taxid:228405)] Back     alignment and assigned GO terms
TAIR|locus:2173654 SDH1-1 "succinate dehydrogenase 1-1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q92J97DHSA_RICCN1, ., 3, ., 9, 9, ., 10.54290.71620.9446yesN/A
Q5R616DHSA_PONAB1, ., 3, ., 5, ., 10.52090.69330.8207yesN/A
Q9UTJ7DHSA_SCHPO1, ., 3, ., 5, ., 10.53140.71880.8814yesN/A
P31038DHSA_RICPR1, ., 3, ., 9, 9, ., 10.55430.70610.9312yesN/A
Q68XN9DHSA_RICTY1, ., 3, ., 9, 9, ., 10.54990.71620.9446yesN/A
Q7ZVF3DHSA_DANRE1, ., 3, ., 5, ., 10.51230.69080.8214yesN/A
Q1RHB9DHSA_RICBR1, ., 3, ., 9, 9, ., 10.54670.70610.9312yesN/A
P0AC42DHSA_ECOL61, ., 3, ., 9, 9, ., 10.54180.71110.9506yesN/A
Q60356Y033_METJANo assigned EC number0.38650.60300.8794yesN/A
O06913FRDA_HELPY1, ., 3, ., 9, 9, ., 10.34180.67040.7380yesN/A
O82663DHSA1_ARATH1, ., 3, ., 5, ., 10.52930.70860.8785yesN/A
P31040DHSA_HUMAN1, ., 3, ., 5, ., 10.51740.69330.8207yesN/A
Q920L2DHSA_RAT1, ., 3, ., 5, ., 10.50080.71880.8612yesN/A
Q6ZDY8DHSA_ORYSJ1, ., 3, ., 5, ., 10.53280.70860.8841yesN/A
Q8K2B3DHSA_MOUSE1, ., 3, ., 5, ., 10.51740.69330.8207yesN/A
Q94523DHSA_DROME1, ., 3, ., 5, ., 10.51880.68190.8108yesN/A
Q59661DHSA_PARDE1, ., 3, ., 9, 9, ., 10.53640.70220.92yesN/A
Q9ZMP0FRDA_HELPJ1, ., 3, ., 9, 9, ., 10.34180.67040.7380yesN/A
Q4UJM1DHSA_RICFE1, ., 3, ., 9, 9, ., 10.54110.71620.9446yesN/A
Q00711DHSA_YEAST1, ., 3, ., 5, ., 10.520.69080.8484yesN/A
Q09508DHSA_CAEEL1, ., 3, ., 5, ., 10.49830.71880.8746yesN/A
Q8ZQU3DHSA_SALTY1, ., 3, ., 9, 9, ., 10.53830.71110.9506yesN/A
P51054DHSA_COXBU1, ., 3, ., 9, 9, ., 10.56310.69460.9301yesN/A
Q9YHT1DHSA_CHICK1, ., 3, ., 5, ., 10.49320.71240.8421yesN/A
P31039DHSA_BOVIN1, ., 3, ., 5, ., 10.50.70220.8300yesN/A
P44894FRDA_HAEIN1, ., 3, ., 9, 9, ., 10.39820.66280.8697yesN/A
Q9U3X4DHSA_DICDI1, ., 3, ., 5, ., 10.51220.71500.8977yesN/A
Q0QF01DHSA_PIG1, ., 3, ., 5, ., 10.50870.69330.8207yesN/A

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.4.3LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query786
PRK07057591 PRK07057, sdhA, succinate dehydrogenase flavoprote 0.0
TIGR01816565 TIGR01816, sdhA_forward, succinate dehydrogenase, 0.0
PRK09078598 PRK09078, sdhA, succinate dehydrogenase flavoprote 0.0
PRK05675570 PRK05675, sdhA, succinate dehydrogenase flavoprote 0.0
PRK08958588 PRK08958, sdhA, succinate dehydrogenase flavoprote 0.0
PTZ00139617 PTZ00139, PTZ00139, Succinate dehydrogenase [ubiqu 0.0
TIGR01812541 TIGR01812, sdhA_frdA_Gneg, succinate dehydrogenase 0.0
PRK08205583 PRK08205, sdhA, succinate dehydrogenase flavoprote 0.0
PLN00128635 PLN00128, PLN00128, Succinate dehydrogenase [ubiqu 0.0
COG1053562 COG1053, SdhA, Succinate dehydrogenase/fumarate re 0.0
PRK05945575 PRK05945, sdhA, succinate dehydrogenase flavoprote 0.0
PRK06069577 PRK06069, sdhA, succinate dehydrogenase flavoprote 0.0
PRK09231582 PRK09231, PRK09231, fumarate reductase flavoprotei 1e-173
PRK06452566 PRK06452, sdhA, succinate dehydrogenase flavoprote 1e-172
TIGR01176580 TIGR01176, fum_red_Fp, fumarate reductase, flavopr 1e-162
PRK05950232 PRK05950, sdhB, succinate dehydrogenase iron-sulfu 1e-147
PRK06263543 PRK06263, sdhA, succinate dehydrogenase flavoprote 1e-138
COG0029518 COG0029, NadB, Aspartate oxidase [Coenzyme metabol 1e-129
PRK08626657 PRK08626, PRK08626, fumarate reductase flavoprotei 1e-127
PRK12575235 PRK12575, PRK12575, succinate dehydrogenase iron-s 1e-123
PRK07803626 PRK07803, sdhA, succinate dehydrogenase flavoprote 1e-120
pfam00890401 pfam00890, FAD_binding_2, FAD binding domain 1e-114
PLN02815594 PLN02815, PLN02815, L-aspartate oxidase 1e-111
TIGR00551488 TIGR00551, nadB, L-aspartate oxidase 1e-107
PLN00129276 PLN00129, PLN00129, succinate dehydrogenase [ubiqu 1e-107
PRK07395553 PRK07395, PRK07395, L-aspartate oxidase; Provision 2e-99
COG0479234 COG0479, FrdB, Succinate dehydrogenase/fumarate re 4e-99
PRK08071510 PRK08071, PRK08071, L-aspartate oxidase; Provision 2e-98
PRK07804541 PRK07804, PRK07804, L-aspartate oxidase; Provision 1e-93
PRK09077536 PRK09077, PRK09077, L-aspartate oxidase; Provision 7e-93
TIGR00384220 TIGR00384, dhsB, succinate dehydrogenase and fumar 2e-90
TIGR01811603 TIGR01811, sdhA_Bsu, succinate dehydrogenase or fu 8e-90
PRK07512513 PRK07512, PRK07512, L-aspartate oxidase; Provision 7e-87
PRK08641589 PRK08641, sdhA, succinate dehydrogenase flavoprote 1e-86
PRK06175433 PRK06175, PRK06175, L-aspartate oxidase; Provision 3e-74
PRK08401466 PRK08401, PRK08401, L-aspartate oxidase; Provision 1e-56
PRK07573640 PRK07573, sdhA, succinate dehydrogenase flavoprote 2e-50
PRK12577329 PRK12577, PRK12577, succinate dehydrogenase iron-s 7e-50
PRK12576279 PRK12576, PRK12576, succinate dehydrogenase iron-s 2e-48
pfam02910127 pfam02910, Succ_DH_flav_C, Fumarate reductase flav 2e-46
PRK12385244 PRK12385, PRK12385, fumarate reductase iron-sulfur 8e-45
TIGR01813439 TIGR01813, flavo_cyto_c, flavocytochrome c 5e-43
pfam13085107 pfam13085, Fer2_3, 2Fe-2S iron-sulfur cluster bind 3e-36
PRK13552239 PRK13552, frdB, fumarate reductase iron-sulfur sub 3e-34
PRK06259 486 PRK06259, PRK06259, succinate dehydrogenase/fumara 4e-33
PRK06481506 PRK06481, PRK06481, fumarate reductase flavoprotei 4e-30
PRK08640249 PRK08640, sdhB, succinate dehydrogenase iron-sulfu 9e-27
PRK08275554 PRK08275, PRK08275, putative oxidoreductase; Provi 6e-21
PRK06854608 PRK06854, PRK06854, adenylylsulfate reductase subu 5e-17
PRK12386251 PRK12386, PRK12386, fumarate reductase iron-sulfur 2e-15
PTZ003061167 PTZ00306, PTZ00306, NADH-dependent fumarate reduct 2e-12
PRK13800 897 PRK13800, PRK13800, putative oxidoreductase/HEAT r 2e-11
TIGR02061614 TIGR02061, aprA, adenosine phosphosulphate reducta 2e-11
pfam1353461 pfam13534, Fer4_17, 4Fe-4S dicluster domain 1e-09
PTZ003061167 PTZ00306, PTZ00306, NADH-dependent fumarate reduct 8e-09
pfam1318354 pfam13183, Fer4_8, 4Fe-4S dicluster domain 3e-06
PRK07570250 PRK07570, PRK07570, succinate dehydrogenase/fumara 7e-06
COG0247 388 COG0247, GlpC, Fe-S oxidoreductase [Energy product 3e-05
pfam1353461 pfam13534, Fer4_17, 4Fe-4S dicluster domain 0.003
pfam1318354 pfam13183, Fer4_8, 4Fe-4S dicluster domain 0.004
>gnl|CDD|180814 PRK07057, sdhA, succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information 
 Score = 1034 bits (2676), Expect = 0.0
 Identities = 413/563 (73%), Positives = 490/563 (87%)

Query: 1   MRASLQLAQEGLNVAILSKVFPTRSHTVAAQGGISASLGNMSKDNWHWHMFDTIKGSDYL 60
           MRASLQLA+ GL+VA+LSKVFPTRSHTVAAQGGI ASLGNMS+DNWH+H +DTIKGSD+L
Sbjct: 25  MRASLQLARAGLSVAVLSKVFPTRSHTVAAQGGIGASLGNMSEDNWHYHFYDTIKGSDWL 84

Query: 61  GDQDAIEFMCKEAPKVVYELEHFGMPFDRNKNGTIYQRPFGGHSSNFGEKPIARACAVAD 120
           GDQDAIEFMC+EAP VVYELEHFGMPFDRN +GTIYQRPFGGH++N+GEKP+ RACA AD
Sbjct: 85  GDQDAIEFMCREAPNVVYELEHFGMPFDRNADGTIYQRPFGGHTANYGEKPVQRACAAAD 144

Query: 121 RTGHALLHTLYQRNLHAKTNFFIEWMAIDLISDSEGDILGVVALEMETGNIMILESKITI 180
           RTGHALLHTLYQ+N+ AKT FF+EWMA+DLI D++GD+LGV ALEMETG++ ILE+K T+
Sbjct: 145 RTGHALLHTLYQQNVAAKTQFFVEWMALDLIRDADGDVLGVTALEMETGDVYILEAKTTL 204

Query: 181 LATGGGGRIWAASTNAFINTGDGLGMAARAGLPLEDMEFWQFHPTGVAGAGVLITEGVRG 240
            ATGG GRI+AASTNAFINTGDGLGMAARAG+PL+DMEFWQFHPTGVAGAGVLITEGVRG
Sbjct: 205 FATGGAGRIFAASTNAFINTGDGLGMAARAGIPLQDMEFWQFHPTGVAGAGVLITEGVRG 264

Query: 241 EGGILINSNGERFMERYAPILKDLAPRDFVSRAMDQEIKEGRGCGPNKDHVMLDLRHINS 300
           EGGIL N +GERFMERYAP LKDLAPRDFVSR+MDQEIKEGRGCGPN DHV+LDL H+ +
Sbjct: 265 EGGILRNKDGERFMERYAPTLKDLAPRDFVSRSMDQEIKEGRGCGPNGDHVLLDLTHLGA 324

Query: 301 ETIINRLPSILEIGNKFANVNALKEPIPVIPTIHYQMGGIPTNIYGQVIIPNNDNNKIVN 360
           ETI+ RLPSI EI  KFANV+ +KEPIPV+PTIHYQMGGIPTNI+GQV+  + D+ + VN
Sbjct: 325 ETIMKRLPSIREIALKFANVDCIKEPIPVVPTIHYQMGGIPTNIHGQVVGTSRDHKEPVN 384

Query: 361 GLYAIGECACVSVHGANRLGTNSLLDLLVFGRSAGNHILSLELKKIHNKKLPINSIDIII 420
           G YAIGEC+CVSVHGANRLGTNSLLDL+VFGR+AGNHI+    K+  +K LP ++ D  +
Sbjct: 385 GFYAIGECSCVSVHGANRLGTNSLLDLVVFGRAAGNHIVDHVKKQHEHKPLPADAADFSL 444

Query: 421 DRLSKLENNKGSESVQSVANDIRKTMQNYCGVFRTDKLMKNGYKKIMILDERRKYISFKD 480
            RL+KL+ +   E  Q VANDIR TMQ + GVFRT  L+  G ++I+ L ER + I  KD
Sbjct: 445 ARLAKLDKSTSGEYAQDVANDIRATMQKHAGVFRTQALLDEGVEQILALAERVENIHLKD 504

Query: 481 KSKIFNTARIEALELDNLIETAKATISSAISRKESRGAHAHNDFKNRDDINWLKHSIWYS 540
           KSK+FNTAR+EALE+ NLIE A+AT+ SA +RKESRGAHAH+D+++RDD NWLKH++WYS
Sbjct: 505 KSKVFNTARVEALEVANLIEVARATMVSAAARKESRGAHAHSDYEHRDDENWLKHTLWYS 564

Query: 541 NGNRIEFKPVNLKPLTVKTVHPK 563
            GNR+++KPV +KPLTV++V PK
Sbjct: 565 EGNRLDYKPVQMKPLTVESVPPK 587

Length = 591
>gnl|CDD|130875 TIGR01816, sdhA_forward, succinate dehydrogenase, flavoprotein subunit, E Back     alignment and domain information
>gnl|CDD|236375 PRK09078, sdhA, succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>gnl|CDD|180193 PRK05675, sdhA, succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>gnl|CDD|181594 PRK08958, sdhA, succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>gnl|CDD|240286 PTZ00139, PTZ00139, Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional Back     alignment and domain information
>gnl|CDD|233582 TIGR01812, sdhA_frdA_Gneg, succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup Back     alignment and domain information
>gnl|CDD|236185 PRK08205, sdhA, succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>gnl|CDD|177739 PLN00128, PLN00128, Succinate dehydrogenase [ubiquinone] flavoprotein subunit Back     alignment and domain information
>gnl|CDD|223981 COG1053, SdhA, Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|180319 PRK05945, sdhA, succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>gnl|CDD|235689 PRK06069, sdhA, succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>gnl|CDD|236421 PRK09231, PRK09231, fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>gnl|CDD|180567 PRK06452, sdhA, succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>gnl|CDD|233302 TIGR01176, fum_red_Fp, fumarate reductase, flavoprotein subunit Back     alignment and domain information
>gnl|CDD|235652 PRK05950, sdhB, succinate dehydrogenase iron-sulfur subunit; Reviewed Back     alignment and domain information
>gnl|CDD|235758 PRK06263, sdhA, succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>gnl|CDD|223108 COG0029, NadB, Aspartate oxidase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|181507 PRK08626, PRK08626, fumarate reductase flavoprotein subunit; Provisional Back     alignment and domain information
>gnl|CDD|171592 PRK12575, PRK12575, succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>gnl|CDD|236101 PRK07803, sdhA, succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>gnl|CDD|216176 pfam00890, FAD_binding_2, FAD binding domain Back     alignment and domain information
>gnl|CDD|215436 PLN02815, PLN02815, L-aspartate oxidase Back     alignment and domain information
>gnl|CDD|233018 TIGR00551, nadB, L-aspartate oxidase Back     alignment and domain information
>gnl|CDD|215067 PLN00129, PLN00129, succinate dehydrogenase [ubiquinone] iron-sulfur subunit Back     alignment and domain information
>gnl|CDD|236010 PRK07395, PRK07395, L-aspartate oxidase; Provisional Back     alignment and domain information
>gnl|CDD|223555 COG0479, FrdB, Succinate dehydrogenase/fumarate reductase, Fe-S protein subunit [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|236147 PRK08071, PRK08071, L-aspartate oxidase; Provisional Back     alignment and domain information
>gnl|CDD|236102 PRK07804, PRK07804, L-aspartate oxidase; Provisional Back     alignment and domain information
>gnl|CDD|236374 PRK09077, PRK09077, L-aspartate oxidase; Provisional Back     alignment and domain information
>gnl|CDD|232950 TIGR00384, dhsB, succinate dehydrogenase and fumarate reductase iron-sulfur protein Back     alignment and domain information
>gnl|CDD|130870 TIGR01811, sdhA_Bsu, succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup Back     alignment and domain information
>gnl|CDD|236036 PRK07512, PRK07512, L-aspartate oxidase; Provisional Back     alignment and domain information
>gnl|CDD|236319 PRK08641, sdhA, succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>gnl|CDD|180442 PRK06175, PRK06175, L-aspartate oxidase; Provisional Back     alignment and domain information
>gnl|CDD|236259 PRK08401, PRK08401, L-aspartate oxidase; Provisional Back     alignment and domain information
>gnl|CDD|236054 PRK07573, sdhA, succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>gnl|CDD|183605 PRK12577, PRK12577, succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>gnl|CDD|237143 PRK12576, PRK12576, succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>gnl|CDD|217281 pfam02910, Succ_DH_flav_C, Fumarate reductase flavoprotein C-term Back     alignment and domain information
>gnl|CDD|183490 PRK12385, PRK12385, fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>gnl|CDD|233583 TIGR01813, flavo_cyto_c, flavocytochrome c Back     alignment and domain information
>gnl|CDD|221911 pfam13085, Fer2_3, 2Fe-2S iron-sulfur cluster binding domain Back     alignment and domain information
>gnl|CDD|184136 PRK13552, frdB, fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>gnl|CDD|235756 PRK06259, PRK06259, succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>gnl|CDD|180584 PRK06481, PRK06481, fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>gnl|CDD|181515 PRK08640, sdhB, succinate dehydrogenase iron-sulfur subunit; Reviewed Back     alignment and domain information
>gnl|CDD|181346 PRK08275, PRK08275, putative oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|235879 PRK06854, PRK06854, adenylylsulfate reductase subunit alpha; Validated Back     alignment and domain information
>gnl|CDD|237086 PRK12386, PRK12386, fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>gnl|CDD|140327 PTZ00306, PTZ00306, NADH-dependent fumarate reductase; Provisional Back     alignment and domain information
>gnl|CDD|237512 PRK13800, PRK13800, putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|233702 TIGR02061, aprA, adenosine phosphosulphate reductase, alpha subunit Back     alignment and domain information
>gnl|CDD|222205 pfam13534, Fer4_17, 4Fe-4S dicluster domain Back     alignment and domain information
>gnl|CDD|140327 PTZ00306, PTZ00306, NADH-dependent fumarate reductase; Provisional Back     alignment and domain information
>gnl|CDD|221963 pfam13183, Fer4_8, 4Fe-4S dicluster domain Back     alignment and domain information
>gnl|CDD|181038 PRK07570, PRK07570, succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Validated Back     alignment and domain information
>gnl|CDD|223325 COG0247, GlpC, Fe-S oxidoreductase [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|222205 pfam13534, Fer4_17, 4Fe-4S dicluster domain Back     alignment and domain information
>gnl|CDD|221963 pfam13183, Fer4_8, 4Fe-4S dicluster domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 786
PLN00128635 Succinate dehydrogenase [ubiquinone] flavoprotein 100.0
PRK05675570 sdhA succinate dehydrogenase flavoprotein subunit; 100.0
COG0029518 NadB Aspartate oxidase [Coenzyme metabolism] 100.0
PRK08958588 sdhA succinate dehydrogenase flavoprotein subunit; 100.0
PTZ00139617 Succinate dehydrogenase [ubiquinone] flavoprotein 100.0
TIGR01816565 sdhA_forward succinate dehydrogenase, flavoprotein 100.0
PRK09078598 sdhA succinate dehydrogenase flavoprotein subunit; 100.0
PRK07057591 sdhA succinate dehydrogenase flavoprotein subunit; 100.0
PRK08626657 fumarate reductase flavoprotein subunit; Provision 100.0
PRK06452566 sdhA succinate dehydrogenase flavoprotein subunit; 100.0
PRK08205583 sdhA succinate dehydrogenase flavoprotein subunit; 100.0
TIGR01176580 fum_red_Fp fumarate reductase, flavoprotein subuni 100.0
TIGR01811603 sdhA_Bsu succinate dehydrogenase or fumarate reduc 100.0
PRK05945575 sdhA succinate dehydrogenase flavoprotein subunit; 100.0
PRK08641589 sdhA succinate dehydrogenase flavoprotein subunit; 100.0
PRK09231582 fumarate reductase flavoprotein subunit; Validated 100.0
PRK07573640 sdhA succinate dehydrogenase flavoprotein subunit; 100.0
PRK06069577 sdhA succinate dehydrogenase flavoprotein subunit; 100.0
TIGR01812566 sdhA_frdA_Gneg succinate dehydrogenase or fumarate 100.0
PRK07803626 sdhA succinate dehydrogenase flavoprotein subunit; 100.0
COG1053562 SdhA Succinate dehydrogenase/fumarate reductase, f 100.0
PLN02815594 L-aspartate oxidase 100.0
PRK07395553 L-aspartate oxidase; Provisional 100.0
PRK06263543 sdhA succinate dehydrogenase flavoprotein subunit; 100.0
PRK09077536 L-aspartate oxidase; Provisional 100.0
PRK07804541 L-aspartate oxidase; Provisional 100.0
PRK07512513 L-aspartate oxidase; Provisional 100.0
KOG2403|consensus642 100.0
PRK08071510 L-aspartate oxidase; Provisional 100.0
TIGR00551488 nadB L-aspartate oxidase. L-aspartate oxidase is t 100.0
TIGR02061614 aprA adenosine phosphosulphate reductase, alpha su 100.0
PRK13800 897 putative oxidoreductase/HEAT repeat-containing pro 100.0
PRK08275554 putative oxidoreductase; Provisional 100.0
PRK06854608 adenylylsulfate reductase subunit alpha; Validated 100.0
PRK08401466 L-aspartate oxidase; Provisional 100.0
PRK06175433 L-aspartate oxidase; Provisional 100.0
COG0479234 FrdB Succinate dehydrogenase/fumarate reductase, F 100.0
PRK06481506 fumarate reductase flavoprotein subunit; Validated 100.0
KOG2404|consensus477 100.0
PRK12575235 succinate dehydrogenase iron-sulfur subunit; Provi 100.0
PLN00129276 succinate dehydrogenase [ubiquinone] iron-sulfur s 100.0
PRK13552239 frdB fumarate reductase iron-sulfur subunit; Provi 100.0
PTZ003061167 NADH-dependent fumarate reductase; Provisional 100.0
TIGR01813439 flavo_cyto_c flavocytochrome c. This model describ 100.0
PRK08640249 sdhB succinate dehydrogenase iron-sulfur subunit; 100.0
PF00890417 FAD_binding_2: FAD binding domain of the Pfam fami 100.0
PRK12845564 3-ketosteroid-delta-1-dehydrogenase; Reviewed 100.0
PRK07121492 hypothetical protein; Validated 100.0
PRK12837513 3-ketosteroid-delta-1-dehydrogenase; Provisional 100.0
PRK12385244 fumarate reductase iron-sulfur subunit; Provisiona 100.0
PRK12386251 fumarate reductase iron-sulfur subunit; Provisiona 100.0
PRK05950232 sdhB succinate dehydrogenase iron-sulfur subunit; 100.0
PRK12844557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 100.0
PRK12577329 succinate dehydrogenase iron-sulfur subunit; Provi 100.0
TIGR02485432 CobZ_N-term precorrin 3B synthase CobZ. CobZ is es 100.0
PRK08274466 tricarballylate dehydrogenase; Validated 100.0
PRK12835584 3-ketosteroid-delta-1-dehydrogenase; Reviewed 100.0
PRK12834549 putative FAD-binding dehydrogenase; Reviewed 100.0
TIGR00384220 dhsB succinate dehydrogenase and fumarate reductas 100.0
PRK12576279 succinate dehydrogenase iron-sulfur subunit; Provi 100.0
PRK12839572 hypothetical protein; Provisional 100.0
PRK07570250 succinate dehydrogenase/fumarate reductase iron-su 100.0
PRK12843578 putative FAD-binding dehydrogenase; Reviewed 100.0
PRK07843557 3-ketosteroid-delta-1-dehydrogenase; Reviewed 100.0
KOG3049|consensus288 100.0
PRK12842574 putative succinate dehydrogenase; Reviewed 100.0
PRK06134581 putative FAD-binding dehydrogenase; Reviewed 100.0
PRK06259 486 succinate dehydrogenase/fumarate reductase iron-su 100.0
PF02910129 Succ_DH_flav_C: Fumarate reductase flavoprotein C- 99.96
PF13085110 Fer2_3: 2Fe-2S iron-sulfur cluster binding domain; 99.95
COG2081408 Predicted flavoproteins [General function predicti 99.94
COG3573552 Predicted oxidoreductase [General function predict 99.92
PF03486409 HI0933_like: HI0933-like protein; InterPro: IPR004 99.91
TIGR00275400 flavoprotein, HI0933 family. The model when search 99.9
TIGR03862376 flavo_PP4765 uncharacterized flavoprotein, PP_4765 99.86
COG3383 978 Uncharacterized anaerobic dehydrogenase [General f 99.85
PTZ00305297 NADH:ubiquinone oxidoreductase; Provisional 99.83
PRK08493 819 NADH dehydrogenase subunit G; Validated 99.8
COG1034 693 NuoG NADH dehydrogenase/NADH:ubiquinone oxidoreduc 99.77
PRK09130 687 NADH dehydrogenase subunit G; Validated 99.75
TIGR01973 603 NuoG NADH-quinone oxidoreductase, chain G. This mo 99.72
PRK09129 776 NADH dehydrogenase subunit G; Validated 99.7
PRK07860 797 NADH dehydrogenase subunit G; Validated 99.69
PRK07569234 bidirectional hydrogenase complex protein HoxU; Va 99.67
PRK08166 847 NADH dehydrogenase subunit G; Validated 99.6
COG1139459 Uncharacterized conserved protein containing a fer 99.37
COG1249454 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, 99.3
COG1150195 HdrC Heterodisulfide reductase, subunit C [Energy 99.26
PRK11274 407 glcF glycolate oxidase iron-sulfur subunit; Provis 99.19
TIGR03290144 CoB_CoM_SS_C CoB--CoM heterodisulfide reductase, s 99.16
PF1351082 Fer2_4: 2Fe-2S iron-sulfur cluster binding domain; 99.14
TIGR00273432 iron-sulfur cluster-binding protein. Members of th 99.1
PRK11168 396 glpC sn-glycerol-3-phosphate dehydrogenase subunit 98.92
PRK05329422 anaerobic glycerol-3-phosphate dehydrogenase subun 98.91
PRK04176257 ribulose-1,5-biphosphate synthetase; Provisional 98.89
TIGR00136617 gidA glucose-inhibited division protein A. GidA, t 98.81
TIGR03379 397 glycerol3P_GlpC glycerol-3-phosphate dehydrogenase 98.81
PLN02661357 Putative thiazole synthesis 98.8
PRK12814 652 putative NADPH-dependent glutamate synthase small 98.79
PF1318357 Fer4_8: 4Fe-4S dicluster domain; PDB: 2BS4_B 1E7P_ 98.78
KOG2282|consensus 708 98.76
PRK05192618 tRNA uridine 5-carboxymethylaminomethyl modificati 98.74
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 98.74
TIGR01424446 gluta_reduc_2 glutathione-disulfide reductase, pla 98.73
PLN02546558 glutathione reductase 98.72
PRK06467471 dihydrolipoamide dehydrogenase; Reviewed 98.7
COG1635262 THI4 Ribulose 1,5-bisphosphate synthetase, convert 98.69
COG0247 388 GlpC Fe-S oxidoreductase [Energy production and co 98.69
TIGR01421450 gluta_reduc_1 glutathione-disulfide reductase, ani 98.68
PF01134392 GIDA: Glucose inhibited division protein A; InterP 98.67
PTZ00058561 glutathione reductase; Provisional 98.66
PRK11101546 glpA sn-glycerol-3-phosphate dehydrogenase subunit 98.66
PLN02507499 glutathione reductase 98.64
PRK15055344 anaerobic sulfite reductase subunit A; Provisional 98.63
PRK07845466 flavoprotein disulfide reductase; Reviewed 98.6
TIGR01438484 TGR thioredoxin and glutathione reductase selenopr 98.58
COG2509486 Uncharacterized FAD-dependent dehydrogenases [Gene 98.58
PRK06116450 glutathione reductase; Validated 98.57
PF1353461 Fer4_17: 4Fe-4S dicluster domain; PDB: 1ZOY_B 3AE9 98.57
PRK06115466 dihydrolipoamide dehydrogenase; Reviewed 98.57
TIGR02910334 sulfite_red_A sulfite reductase, subunit A. Member 98.52
TIGR03377516 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase 98.48
TIGR01423486 trypano_reduc trypanothione-disulfide reductase. T 98.46
TIGR01945435 rnfC electron transport complex, RnfABCDGE type, C 98.45
PF01266358 DAO: FAD dependent oxidoreductase; InterPro: IPR00 98.43
PF01946230 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K. 98.43
COG0644396 FixC Dehydrogenases (flavoproteins) [Energy produc 98.42
PRK06912458 acoL dihydrolipoamide dehydrogenase; Validated 98.42
PRK05035 695 electron transport complex protein RnfC; Provision 98.41
PRK05352448 Na(+)-translocating NADH-quinone reductase subunit 98.4
PRK00941 781 acetyl-CoA decarbonylase/synthase complex subunit 98.38
TIGR03329460 Phn_aa_oxid putative aminophosphonate oxidoreducta 98.37
PRK06327475 dihydrolipoamide dehydrogenase; Validated 98.37
KOG0405|consensus478 98.37
PRK06370463 mercuric reductase; Validated 98.35
TIGR01936447 nqrA NADH:ubiquinone oxidoreductase, Na(+)-translo 98.33
PRK07818466 dihydrolipoamide dehydrogenase; Reviewed 98.33
PRK07846451 mycothione reductase; Reviewed 98.32
PRK06416462 dihydrolipoamide dehydrogenase; Reviewed 98.31
COG4656529 RnfC Predicted NADH:ubiquinone oxidoreductase, sub 98.31
PTZ00153659 lipoamide dehydrogenase; Provisional 98.3
TIGR03193148 4hydroxCoAred 4-hydroxybenzoyl-CoA reductase, gamm 98.3
KOG1335|consensus506 98.3
TIGR00314 784 cdhA CO dehydrogenase/acetyl-CoA synthase complex, 98.3
PRK00711416 D-amino acid dehydrogenase small subunit; Validate 98.27
TIGR02352337 thiamin_ThiO glycine oxidase ThiO. This family con 98.26
cd01916 731 ACS_1 Acetyl-CoA synthase (ACS), also known as ace 98.25
PRK05976472 dihydrolipoamide dehydrogenase; Validated 98.24
TIGR03452452 mycothione_red mycothione reductase. Mycothiol, a 98.22
PLN02464627 glycerol-3-phosphate dehydrogenase 98.21
PRK12409410 D-amino acid dehydrogenase small subunit; Provisio 98.21
COG1143172 NuoI Formate hydrogenlyase subunit 6/NADH:ubiquino 98.19
TIGR01373407 soxB sarcosine oxidase, beta subunit family, heter 98.17
KOG4716|consensus503 98.17
TIGR02053463 MerA mercuric reductase. This model represents the 98.17
PRK05249461 soluble pyridine nucleotide transhydrogenase; Prov 98.16
TIGR03197381 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouri 98.16
TIGR01350461 lipoamide_DH dihydrolipoamide dehydrogenase. The m 98.14
PRK10015429 oxidoreductase; Provisional 98.12
PRK14694468 putative mercuric reductase; Provisional 98.1
PF1318755 Fer4_9: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_ 98.09
PRK11433217 aldehyde oxidoreductase 2Fe-2S subunit; Provisiona 98.08
PF1323752 Fer4_10: 4Fe-4S dicluster domain; PDB: 2FGO_A. 98.08
COG0492305 TrxB Thioredoxin reductase [Posttranslational modi 98.07
COG0578532 GlpA Glycerol-3-phosphate dehydrogenase [Energy pr 98.07
PF12831428 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3 98.06
PF1374669 Fer4_18: 4Fe-4S dicluster domain 98.05
PRK06292460 dihydrolipoamide dehydrogenase; Validated 98.05
TIGR01320483 mal_quin_oxido malate:quinone-oxidoreductase. This 98.03
TIGR02484 372 CitB CitB domain protein. CobZ is essential for co 98.02
PRK14727479 putative mercuric reductase; Provisional 98.02
PTZ00052499 thioredoxin reductase; Provisional 98.01
PRK11728393 hydroxyglutarate oxidase; Provisional 98.0
PRK12266508 glpD glycerol-3-phosphate dehydrogenase; Reviewed 98.0
PF1283852 Fer4_7: 4Fe-4S dicluster domain; InterPro: IPR0014 98.0
cd0020784 fer2 2Fe-2S iron-sulfur cluster binding domain. Ir 98.0
COG1152 772 CdhA CO dehydrogenase/acetyl-CoA synthase alpha su 97.99
TIGR03378419 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase 97.98
PRK09908159 xanthine dehydrogenase subunit XdhC; Provisional 97.97
PRK15033 389 tricarballylate utilization protein B; Provisional 97.96
KOG0404|consensus322 97.95
PRK13748561 putative mercuric reductase; Provisional 97.95
TIGR01377380 soxA_mon sarcosine oxidase, monomeric form. Sarcos 97.94
COG2080156 CoxS Aerobic-type carbon monoxide dehydrogenase, s 97.93
TIGR02028398 ChlP geranylgeranyl reductase. This model represen 97.89
PRK13369502 glycerol-3-phosphate dehydrogenase; Provisional 97.88
PF1469759 Fer4_21: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE 97.87
TIGR03364365 HpnW_proposed FAD dependent oxidoreductase TIGR033 97.84
KOG0042|consensus680 97.83
COG0579429 Predicted dehydrogenase [General function predicti 97.8
TIGR03198151 pucE xanthine dehydrogenase E subunit. This gene h 97.8
PF0011178 Fer2: 2Fe-2S iron-sulfur cluster binding domain; I 97.76
PRK07251438 pyridine nucleotide-disulfide oxidoreductase; Prov 97.74
PRK05257494 malate:quinone oxidoreductase; Validated 97.73
PRK01747662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 97.72
TIGR02023388 BchP-ChlP geranylgeranyl reductase. This model rep 97.7
PLN02697529 lycopene epsilon cyclase 97.68
COG0665387 DadA Glycine/D-amino acid oxidases (deaminating) [ 97.68
PRK11259376 solA N-methyltryptophan oxidase; Provisional 97.6
TIGR00403183 ndhI NADH-plastoquinone oxidoreductase subunit I p 97.58
KOG3256|consensus212 97.56
CHL0013499 petF ferredoxin; Validated 97.56
TIGR0200897 fdx_plant ferredoxin [2Fe-2S]. This model represen 97.55
PLN00093450 geranylgeranyl diphosphate reductase; Provisional 97.51
PRK05888164 NADH dehydrogenase subunit I; Provisional 97.47
PRK1071384 2Fe-2S ferredoxin YfaE; Provisional 97.45
TIGR02176 1165 pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxid 97.42
PRK13984 604 putative oxidoreductase; Provisional 97.4
PRK10157428 putative oxidoreductase FixC; Provisional 97.39
PTZ00383497 malate:quinone oxidoreductase; Provisional 97.39
PRK06273165 ferredoxin; Provisional 97.35
PRK13339497 malate:quinone oxidoreductase; Reviewed 97.33
PRK14028312 pyruvate ferredoxin oxidoreductase subunit gamma/d 97.31
TIGR01971122 NuoI NADH-quinone oxidoreductase, chain I. This mo 97.31
COG1453391 Predicted oxidoreductases of the aldo/keto reducta 97.29
CHL0006581 psaC photosystem I subunit VII 97.28
PRK0265181 photosystem I subunit VII; Provisional 97.28
TIGR03140515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 97.27
TIGR0304880 PS_I_psaC photosystem I iron-sulfur protein PsaC. 97.27
PRK08348120 NADH-plastoquinone oxidoreductase subunit; Provisi 97.26
PLN02593117 adrenodoxin-like ferredoxin protein 97.26
TIGR03313 951 Se_sel_red_Mo probable selenate reductase, molybde 97.26
COG0633102 Fdx Ferredoxin [Energy production and conversion] 97.25
TIGR0293691 fdxN_nitrog ferredoxin III, nif-specific. Members 97.25
PRK15317517 alkyl hydroperoxide reductase subunit F; Provision 97.24
PTZ00038191 ferredoxin; Provisional 97.22
CHL00014167 ndhI NADH dehydrogenase subunit I 97.21
PRK08222181 hydrogenase 4 subunit H; Validated 97.2
PRK06991 270 ferredoxin; Provisional 97.19
PRK06126545 hypothetical protein; Provisional 97.19
KOG2844|consensus856 97.18
TIGR01790388 carotene-cycl lycopene cyclase family protein. Thi 97.16
PRK05113191 electron transport complex protein RnfB; Provision 97.15
PLN0007181 photosystem I subunit VII; Provisional 97.12
PRK09477271 napH quinol dehydrogenase membrane component; Prov 97.11
TIGR02007110 fdx_isc ferredoxin, 2Fe-2S type, ISC system. This 97.1
KOG2820|consensus399 97.1
PLN03136148 Ferredoxin; Provisional 97.1
PRK09625133 porD pyruvate flavodoxin oxidoreductase subunit de 97.09
TIGR02494 295 PFLE_PFLC glycyl-radical enzyme activating protein 97.08
COG114668 Ferredoxin [Energy production and conversion] 97.06
TIGR02163255 napH_ ferredoxin-type protein, NapH/MauN family. M 97.06
PLN02463447 lycopene beta cyclase 97.04
TIGR02512 374 Fe_only_hydrog hydrogenases, Fe-only. This model d 97.04
PF1348467 Fer4_16: 4Fe-4S double cluster binding domain 97.04
COG114599 NapF Ferredoxin [Energy production and conversion] 97.01
PRK09626103 oorD 2-oxoglutarate-acceptor oxidoreductase subuni 96.99
PRK09624105 porD pyuvate ferredoxin oxidoreductase subunit del 96.91
PRK12769654 putative oxidoreductase Fe-S binding subunit; Revi 96.91
PRK12387180 formate hydrogenlyase complex iron-sulfur subunit; 96.88
PF1279722 Fer4_2: 4Fe-4S binding domain; InterPro: IPR001450 96.86
PRK13512438 coenzyme A disulfide reductase; Provisional 96.86
PRK09800 956 putative hypoxanthine oxidase; Provisional 96.82
TIGR00402101 napF ferredoxin-type protein NapF. The gene codes 96.81
PF1279815 Fer4_3: 4Fe-4S binding domain; InterPro: IPR001450 96.81
PRK06184502 hypothetical protein; Provisional 96.8
PRK09897534 hypothetical protein; Provisional 96.78
PRK08764135 ferredoxin; Provisional 96.77
TIGR01944165 rnfB electron transport complex, RnfABCDGE type, B 96.75
PRK06185407 hypothetical protein; Provisional 96.74
TIGR02032295 GG-red-SF geranylgeranyl reductase family. This mo 96.72
PRK06834488 hypothetical protein; Provisional 96.71
KOG2415|consensus621 96.65
PF13738203 Pyr_redox_3: Pyridine nucleotide-disulphide oxidor 96.62
TIGR02912314 sulfite_red_C sulfite reductase, subunit C. Member 96.6
PRK09623105 vorD 2-ketoisovalerate ferredoxin oxidoreductase s 96.59
TIGR0217978 PorD_KorD 2-oxoacid:acceptor oxidoreductase, delta 96.57
PRK05713312 hypothetical protein; Provisional 96.56
PLN02985514 squalene monooxygenase 96.55
PF1283724 Fer4_6: 4Fe-4S binding domain; InterPro: IPR001450 96.54
COG1149 284 MinD superfamily P-loop ATPase containing an inser 96.54
PRK10194163 ferredoxin-type protein; Provisional 96.53
COG114491 Pyruvate:ferredoxin oxidoreductase and related 2-o 96.49
TIGR01988385 Ubi-OHases Ubiquinone biosynthesis hydroxylase, Ub 96.45
COG2768354 Uncharacterized Fe-S center protein [General funct 96.43
PRK06847375 hypothetical protein; Provisional 96.42
PRK14989847 nitrite reductase subunit NirD; Provisional 96.41
TIGR03311 848 Se_dep_Molyb_1 selenium-dependent molybdenum hydro 96.39
PRK09326 341 F420H2 dehydrogenase subunit F; Provisional 96.39
PRK08773392 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 96.39
TIGR02060132 aprB adenosine phosphosulphate reductase, beta sub 96.38
TIGR02963 467 xanthine_xdhA xanthine dehydrogenase, small subuni 96.37
TIGR02745 434 ccoG_rdxA_fixG cytochrome c oxidase accessory prot 96.36
KOG2403|consensus642 96.34
PRK08318420 dihydropyrimidine dehydrogenase subunit B; Validat 96.34
KOG1298|consensus509 96.34
PF1280017 Fer4_4: 4Fe-4S binding domain; InterPro: IPR001450 96.32
PRK13977576 myosin-cross-reactive antigen; Provisional 96.3
COG3634520 AhpF Alkyl hydroperoxide reductase, large subunit 96.29
PRK07364415 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 96.29
COG0445621 GidA Flavin-dependent tRNA uridine 5-carboxymethyl 96.25
PRK09898208 hypothetical protein; Provisional 96.24
PRK08244493 hypothetical protein; Provisional 96.24
PF01494356 FAD_binding_3: FAD binding domain; InterPro: IPR00 96.15
TIGR02700234 flavo_MJ0208 archaeoflavoprotein, MJ0208 family. T 96.14
TIGR03224 411 benzo_boxA benzoyl-CoA oxygenase/reductase, BoxA p 96.12
COG0437203 HybA Fe-S-cluster-containing hydrogenase component 96.11
PTZ00490143 Ferredoxin superfamily; Provisional 96.1
PRK12775 1006 putative trifunctional 2-polyprenylphenol hydroxyl 96.09
PRK09564444 coenzyme A disulfide reductase; Reviewed 96.04
COG0654387 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and 95.97
PRK07190487 hypothetical protein; Provisional 95.97
PRK06183538 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Va 95.96
PRK07609 339 CDP-6-deoxy-delta-3,4-glucoseen reductase; Validat 95.95
PRK08243392 4-hydroxybenzoate 3-monooxygenase; Validated 95.9
PRK07608388 ubiquinone biosynthesis hydroxylase family protein 95.89
TIGR03478321 DMSO_red_II_bet DMSO reductase family type II enzy 95.88
PF1280017 Fer4_4: 4Fe-4S binding domain; InterPro: IPR001450 95.87
COG2878198 Predicted NADH:ubiquinone oxidoreductase, subunit 95.85
PRK10882 328 hydrogenase 2 protein HybA; Provisional 95.84
PRK05714405 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 95.84
PRK12778 752 putative bifunctional 2-polyprenylphenol hydroxyla 95.83
PRK07333403 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 95.82
PRK10684332 HCP oxidoreductase, NADH-dependent; Provisional 95.8
TIGR02160352 PA_CoA_Oxy5 phenylacetate-CoA oxygenase/reductase, 95.79
COG1251793 NirB NAD(P)H-nitrite reductase [Energy production 95.76
TIGR03287391 methan_mark_16 putative methanogenesis marker 16 m 95.68
PF1283724 Fer4_6: 4Fe-4S binding domain; InterPro: IPR001450 95.67
TIGR00276282 iron-sulfur cluster binding protein, putative. Thi 95.64
TIGR00397213 mauM_napG MauM/NapG family ferredoxin-type protein 95.61
TIGR01660 492 narH nitrate reductase, beta subunit. The Nitrate 95.58
PF0003724 Fer4: 4Fe-4S binding domain; InterPro: IPR001450 T 95.55
PRK05464 409 Na(+)-translocating NADH-quinone reductase subunit 95.5
COG1148622 HdrA Heterodisulfide reductase, subunit A and rela 95.5
PRK06617374 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 95.47
PLN02172461 flavin-containing monooxygenase FMO GS-OX 95.46
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductas 95.43
TIGR01984382 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase. T 95.43
KOG2853|consensus509 95.4
PRK07538413 hypothetical protein; Provisional 95.38
PF0003724 Fer4: 4Fe-4S binding domain; InterPro: IPR001450 T 95.36
PRK09126392 hypothetical protein; Provisional 95.36
PRK08849384 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hy 95.36
TIGR03336595 IOR_alpha indolepyruvate ferredoxin oxidoreductase 95.33
PRK098531019 putative selenate reductase subunit YgfK; Provisio 95.23
PF1279815 Fer4_3: 4Fe-4S binding domain; InterPro: IPR001450 95.22
PRK11872 340 antC anthranilate dioxygenase reductase; Provision 95.18
TIGR03149225 cyt_nit_nrfC cytochrome c nitrite reductase, Fe-S 95.17
KOG2852|consensus380 95.15
TIGR01941 405 nqrF NADH:ubiquinone oxidoreductase, Na(+)-translo 95.15
PRK08020391 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquin 95.14
COG1142165 HycB Fe-S-cluster-containing hydrogenase component 95.13
PRK12831464 putative oxidoreductase; Provisional 95.1
TIGR01660 492 narH nitrate reductase, beta subunit. The Nitrate 95.08
PRK13795636 hypothetical protein; Provisional 95.07
PRK13984604 putative oxidoreductase; Provisional 95.04
PRK14993244 tetrathionate reductase subunit B; Provisional 95.03
TIGR03478 321 DMSO_red_II_bet DMSO reductase family type II enzy 95.01
PRK08163396 salicylate hydroxylase; Provisional 94.94
PRK10882 328 hydrogenase 2 protein HybA; Provisional 94.91
PRK11445351 putative oxidoreductase; Provisional 94.86
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 94.86
KOG1346|consensus659 94.82
PRK07045388 putative monooxygenase; Reviewed 94.8
COG4231640 Indolepyruvate ferredoxin oxidoreductase, alpha an 94.8
TIGR01582283 FDH-beta formate dehydrogenase, beta subunit, Fe-S 94.79
TIGR01582 283 FDH-beta formate dehydrogenase, beta subunit, Fe-S 94.76
PRK09476254 napG quinol dehydrogenase periplasmic component; P 94.74
TIGR00397213 mauM_napG MauM/NapG family ferredoxin-type protein 94.74
TIGR03294228 FrhG coenzyme F420 hydrogenase, subunit gamma. Thi 94.71
PRK10330181 formate dehydrogenase-H ferredoxin subunit; Provis 94.7
PF1324798 Fer4_11: 4Fe-4S dicluster domain; PDB: 2VPY_F 2VPX 94.69
PRK09476 254 napG quinol dehydrogenase periplasmic component; P 94.68
TIGR01317485 GOGAT_sm_gam glutamate synthases, NADH/NADPH, smal 94.65
PRK07118280 ferredoxin; Validated 94.62
TIGR03149225 cyt_nit_nrfC cytochrome c nitrite reductase, Fe-S 94.58
PRK08132547 FAD-dependent oxidoreductase; Provisional 94.56
TIGR033151012 Se_ygfK putative selenate reductase, YgfK subunit. 94.55
PRK07494388 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisio 94.54
TIGR02360390 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase. 94.52
COG2221317 DsrA Dissimilatory sulfite reductase (desulfovirid 94.49
PRK05335436 tRNA (uracil-5-)-methyltransferase Gid; Reviewed 94.48
KOG1336|consensus478 94.46
PRK10194163 ferredoxin-type protein; Provisional 94.45
COG3894 614 Uncharacterized metal-binding protein [General fun 94.43
PRK08013400 oxidoreductase; Provisional 94.43
PF13454156 NAD_binding_9: FAD-NAD(P)-binding 94.41
PRK07588391 hypothetical protein; Provisional 94.36
PRK10262321 thioredoxin reductase; Provisional 94.31
KOG2960|consensus328 94.29
PF1279722 Fer4_2: 4Fe-4S binding domain; InterPro: IPR001450 94.13
COG1148 622 HdrA Heterodisulfide reductase, subunit A and rela 94.12
TIGR02486314 RDH reductive dehalogenase. This model represents 94.11
PRK07236386 hypothetical protein; Provisional 93.97
TIGR02462544 pyranose_ox pyranose oxidase. Pyranose oxidase (al 93.95
PRK12778752 putative bifunctional 2-polyprenylphenol hydroxyla 93.93
PRK11749457 dihydropyrimidine dehydrogenase subunit A; Provisi 93.9
PRK05732395 2-octaprenyl-6-methoxyphenyl hydroxylase; Validate 93.84
PRK12769 654 putative oxidoreductase Fe-S binding subunit; Revi 93.82
TIGR02951161 DMSO_dmsB DMSO reductase, iron-sulfur subunit. Thi 93.71
PRK10330181 formate dehydrogenase-H ferredoxin subunit; Provis 93.69
TIGR02969 1330 mam_aldehyde_ox aldehyde oxidase. Members of this 93.68
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 93.67
PRK12810471 gltD glutamate synthase subunit beta; Reviewed 93.65
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductas 93.64
TIGR02730493 carot_isom carotene isomerase. Members of this fam 93.63
PRK07118280 ferredoxin; Validated 93.55
PLN00192 1344 aldehyde oxidase 93.53
PF00732296 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR0001 93.43
TIGR02733492 desat_CrtD C-3',4' desaturase CrtD. Members of thi 93.34
cd07030259 RNAP_D D subunit of Archaeal RNA polymerase. The D 93.31
PRK12771564 putative glutamate synthase (NADPH) small subunit; 93.27
PRK08850405 2-octaprenyl-6-methoxyphenol hydroxylase; Validate 93.14
PRK09898208 hypothetical protein; Provisional 93.09
TIGR02731453 phytoene_desat phytoene desaturase. Plants and cya 93.03
PRK00783263 DNA-directed RNA polymerase subunit D; Provisional 92.96
PRK08010441 pyridine nucleotide-disulfide oxidoreductase; Prov 92.95
PRK04965377 NADH:flavorubredoxin oxidoreductase; Provisional 92.78
PRK09754396 phenylpropionate dioxygenase ferredoxin reductase 92.73
PRK12779944 putative bifunctional glutamate synthase subunit b 92.7
PRK12770352 putative glutamate synthase subunit beta; Provisio 92.68
PRK12809 639 putative oxidoreductase Fe-S binding subunit; Revi 92.66
PRK14993244 tetrathionate reductase subunit B; Provisional 92.64
TIGR02745 434 ccoG_rdxA_fixG cytochrome c oxidase accessory prot 92.56
PRK12814652 putative NADPH-dependent glutamate synthase small 92.51
PF06039488 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro 92.33
PRK06475400 salicylate hydroxylase; Provisional 92.27
PRK127751006 putative trifunctional 2-polyprenylphenol hydroxyl 92.22
PRK12809639 putative oxidoreductase Fe-S binding subunit; Revi 92.16
PRK06753373 hypothetical protein; Provisional 92.15
PTZ00367567 squalene epoxidase; Provisional 92.12
COG1600337 Uncharacterized Fe-S protein [Energy production an 92.09
TIGR01318467 gltD_gamma_fam glutamate synthase small subunit fa 92.04
TIGR01810532 betA choline dehydrogenase. This enzyme is a membe 91.97
TIGR02734502 crtI_fam phytoene desaturase. Phytoene is converte 91.96
PRK05868372 hypothetical protein; Validated 91.77
PTZ00318424 NADH dehydrogenase-like protein; Provisional 91.76
TIGR02066341 dsrB sulfite reductase, dissimilatory-type beta su 91.58
TIGR03169364 Nterm_to_SelD pyridine nucleotide-disulfide oxidor 91.56
PRK02106560 choline dehydrogenase; Validated 91.49
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 91.36
TIGR02951161 DMSO_dmsB DMSO reductase, iron-sulfur subunit. Thi 91.24
PLN02927668 antheraxanthin epoxidase/zeaxanthin epoxidase 91.22
PRK05352448 Na(+)-translocating NADH-quinone reductase subunit 90.69
TIGR01372 985 soxA sarcosine oxidase, alpha subunit family, hete 90.66
COG0437203 HybA Fe-S-cluster-containing hydrogenase component 90.62
PF1374669 Fer4_18: 4Fe-4S dicluster domain 90.61
PRK00054250 dihydroorotate dehydrogenase electron transfer sub 90.58
PRK12771564 putative glutamate synthase (NADPH) small subunit; 90.5
COG3075421 GlpB Anaerobic glycerol-3-phosphate dehydrogenase 90.45
KOG3256|consensus212 90.4
PRK098531019 putative selenate reductase subunit YgfK; Provisio 90.19
TIGR01936447 nqrA NADH:ubiquinone oxidoreductase, Na(+)-translo 90.15
PRK06996398 hypothetical protein; Provisional 90.03
PLN02612567 phytoene desaturase 89.88
TIGR02374785 nitri_red_nirB nitrite reductase [NAD(P)H], large 89.81
PF1324798 Fer4_11: 4Fe-4S dicluster domain; PDB: 2VPY_F 2VPX 89.8
COG1143172 NuoI Formate hydrogenlyase subunit 6/NADH:ubiquino 89.66
PLN02906 1319 xanthine dehydrogenase 89.65
PRK07208479 hypothetical protein; Provisional 89.63
PF1318755 Fer4_9: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_ 89.42
COG3075421 GlpB Anaerobic glycerol-3-phosphate dehydrogenase 89.39
COG1142165 HycB Fe-S-cluster-containing hydrogenase component 89.38
TIGR01989437 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6. T 89.15
KOG2311|consensus679 88.83
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 88.74
COG1233487 Phytoene dehydrogenase and related proteins [Secon 88.68
PF1469759 Fer4_21: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE 88.63
PLN02852491 ferredoxin-NADP+ reductase 88.28
PRK08294634 phenol 2-monooxygenase; Provisional 88.2
PF1323752 Fer4_10: 4Fe-4S dicluster domain; PDB: 2FGO_A. 88.01
PF00743531 FMO-like: Flavin-binding monooxygenase-like; Inter 87.7
TIGR03219414 salicylate_mono salicylate 1-monooxygenase. Member 87.6
PF07992201 Pyr_redox_2: Pyridine nucleotide-disulphide oxidor 87.22
KOG2495|consensus491 87.22
PLN02785587 Protein HOTHEAD 87.2
COG2871 410 NqrF Na+-transporting NADH:ubiquinone oxidoreducta 87.1
KOG4254|consensus561 86.97
PRK12387180 formate hydrogenlyase complex iron-sulfur subunit; 86.76
TIGR03385427 CoA_CoA_reduc CoA-disulfide reductase. Members of 86.71
PRK1544995 ferredoxin-like protein FixX; Provisional 86.52
TIGR033151012 Se_ygfK putative selenate reductase, YgfK subunit. 86.49
PRK13030 1159 2-oxoacid ferredoxin oxidoreductase; Provisional 86.29
PF04820454 Trp_halogenase: Tryptophan halogenase; InterPro: I 86.01
PF1353461 Fer4_17: 4Fe-4S dicluster domain; PDB: 1ZOY_B 3AE9 85.73
COG1941247 FrhG Coenzyme F420-reducing hydrogenase, gamma sub 85.71
PRK13029 1186 2-oxoacid ferredoxin oxidoreductase; Provisional 85.55
TIGR01292300 TRX_reduct thioredoxin-disulfide reductase. This m 85.48
PTZ00363443 rab-GDP dissociation inhibitor; Provisional 85.05
PLN02487569 zeta-carotene desaturase 85.05
TIGR02163255 napH_ ferredoxin-type protein, NapH/MauN family. M 84.92
PRK09193 1165 indolepyruvate ferredoxin oxidoreductase; Validate 84.81
PF1283852 Fer4_7: 4Fe-4S dicluster domain; InterPro: IPR0014 84.78
COG3383 978 Uncharacterized anaerobic dehydrogenase [General f 84.59
TIGR02732474 zeta_caro_desat carotene 7,8-desaturase. Carotene 84.44
COG244099 FixX Ferredoxin-like protein [Energy production an 84.26
PF1348467 Fer4_16: 4Fe-4S double cluster binding domain 83.59
KOG0430|consensus 1257 83.57
PRK07233434 hypothetical protein; Provisional 83.52
COG2072443 TrkA Predicted flavoprotein involved in K+ transpo 83.44
PRK08255765 salicylyl-CoA 5-hydroxylase; Reviewed 83.28
PRK08222181 hydrogenase 4 subunit H; Validated 82.7
COG1150 195 HdrC Heterodisulfide reductase, subunit C [Energy 82.49
TIGR01316449 gltA glutamate synthase (NADPH), homotetrameric. T 82.32
COG4656 529 RnfC Predicted NADH:ubiquinone oxidoreductase, sub 82.16
cd06219248 DHOD_e_trans_like1 FAD/NAD binding domain in the e 82.05
PF1318357 Fer4_8: 4Fe-4S dicluster domain; PDB: 2BS4_B 1E7P_ 82.04
PRK05035 695 electron transport complex protein RnfC; Provision 82.0
PRK12831464 putative oxidoreductase; Provisional 81.74
TIGR00292254 thiazole biosynthesis enzyme. This enzyme is invol 81.36
>PLN00128 Succinate dehydrogenase [ubiquinone] flavoprotein subunit Back     alignment and domain information 
Probab=100.00  E-value=1.3e-99  Score=871.65  Aligned_cols=565  Identities=53%  Similarity=0.894  Sum_probs=494.1

Q ss_pred             ChHhhhcHhCCCCEEEEEecCCCCChhhhcccCeeeccCCCCCCCHHHHHHHHHHhcCCCCcHHHHHHHHHHHHHHHHHH
Q psy9575           1 MRASLQLAQEGLNVAILSKVFPTRSHTVAAQGGISASLGNMSKDNWHWHMFDTIKGSDYLGDQDAIEFMCKEAPKVVYEL   80 (786)
Q Consensus         1 L~AA~~aa~~G~~V~vvek~~~~~g~s~~a~Ggi~a~~~~~~~d~~~~~~~d~~~~~~~~~~~~~v~~~~~~~~~~i~~l   80 (786)
                      |+||++|+++|++|+||||....+|+|.+++||++++....++|+++.|++|+++.+.+++|+++++.+++++++.++||
T Consensus        63 l~AAl~Aae~G~~VilveK~~~~~g~s~~a~Ggi~a~~~~~~~Ds~e~~~~Dt~~~g~~~~d~~lv~~l~~~s~~~i~~L  142 (635)
T PLN00128         63 LRAAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMTEDDWRWHMYDTVKGSDWLGDQDAIQYMCREAPKAVIEL  142 (635)
T ss_pred             HHHHHHHHhcCCcEEEEEcCCCCCCchHHhhcCceeecCCCCCCCHHHHHHHHHHhhCCCCCHHHHHHHHHhHHHHHHHH
Confidence            58999999999999999999988899999999999877643489999999999999999999999999999999999999


Q ss_pred             HHcCCCccccCCCcccccCCCCccCCCC-CCCcceEEEecCCcHHHHHHHHHHHHhcCCceEEeceEEEeeeecCCCCEE
Q psy9575          81 EHFGMPFDRNKNGTIYQRPFGGHSSNFG-EKPIARACAVADRTGHALLHTLYQRNLHAKTNFFIEWMAIDLISDSEGDIL  159 (786)
Q Consensus        81 ~~~Gv~~~~~~~g~~~~~~~gg~~~~~~-~~~~~r~~~~~~~~g~~i~~~L~~~~~~~Gv~i~~~~~v~~L~~~~~g~v~  159 (786)
                      ++||++|+++.+|.+..+.+++|+..++ ....+|+.+..+.+|..++..|.+.+.+.||+|++++.+++|+.+++|+|+
T Consensus       143 ~~~Gv~F~~~~~g~~~~~~~gg~s~~~~~~g~~~r~~~~~d~tG~~i~~~L~~~a~~~gv~i~~~~~~~~Li~~~~g~v~  222 (635)
T PLN00128        143 ENYGLPFSRTEDGKIYQRAFGGQSLDFGKGGQAYRCACAADRTGHAMLHTLYGQAMKHNTQFFVEYFALDLIMDSDGACQ  222 (635)
T ss_pred             HhCCCccccCCCCceeeccccccccccCCCcceeeeeccCCCCHHHHHHHHHHHHHhCCCEEEEeeEEEEEEEcCCCEEE
Confidence            9999999998888887778888843221 113568888889999999999999999899999999999999987448999


Q ss_pred             EEEEEEcCCCcEEEEEeCeEEEcCCCCCccCccCcccCCCchHHHHHHHHCCCCccCCCccccccccccCCCCccccccc
Q psy9575         160 GVVALEMETGNIMILESKITILATGGGGRIWAASTNAFINTGDGLGMAARAGLPLEDMEFWQFHPTGVAGAGVLITEGVR  239 (786)
Q Consensus       160 G~~~~~~~~g~~~~i~AkaVVlATGG~~~~~~~~~~~~~~tGdg~~~a~~aGa~l~~~e~~q~~p~~~~~~~~~~~~~~~  239 (786)
                      |+++++..+|+.+.|.||+|||||||++++|..++++..+||||++||+++||.+.||||+||||+.+.+.+++++++++
T Consensus       223 Gv~~~~~~~g~~~~i~AkaVILATGG~g~~~~~tt~~~~~tGDG~~mA~~aGA~l~~mefvqfhPt~~~~~~~l~~ea~r  302 (635)
T PLN00128        223 GVIALNMEDGTLHRFRAHSTILATGGYGRAYFSATSAHTCTGDGNAMVARAGLPLQDLEFVQFHPTGIYGAGCLITEGSR  302 (635)
T ss_pred             EEEEEEcCCCeEEEEEcCeEEECCCCCccccccccCCCCCCCHHHHHHHHcCCCCcCCcceEEecccccCCCeEEeeecc
Confidence            99998877898889999999999999999999999999999999999999999999999999999988888888899999


Q ss_pred             cCCcEEEcCCCCccccccCCccCCCCchhHHHHHHHHHHHhcCCCCCCCCeEEEeCCCCChhHHHhHchhHHHHHHhhcC
Q psy9575         240 GEGGILINSNGERFMERYAPILKDLAPRDFVSRAMDQEIKEGRGCGPNKDHVMLDLRHINSETIINRLPSILEIGNKFAN  319 (786)
Q Consensus       240 ~~g~~~vn~~G~rf~~~~~p~~~~~~~~~~~~~~i~~~~~~g~g~~~~~~~v~ld~~~~~~~~~~~~~~~~~~~~~~~~g  319 (786)
                      ++|++++|.+|+|||++|+|..+++++||+++++|+.++.+++++.|.++.+|+|+++++++.+++++|.+++.+..+.|
T Consensus       303 g~g~~lvN~~GeRF~~~y~~~~~el~~rd~v~~ai~~e~~~~~g~~~~~~~v~ld~~~l~~e~l~~~~~~~~~~~~~~~G  382 (635)
T PLN00128        303 GEGGILRNSEGERFMERYAPTAKDLASRDVVSRSMTMEIREGRGVGPEKDHIYLHLNHLPPEVLKERLPGISETAAIFAG  382 (635)
T ss_pred             CCCcEEECCCCCCcccccCcccccccchhHHHHHHHHHHHhcCCCCCCCCEEEEEcCCCCHHHHHHHHHHHHHHHHHHcC
Confidence            99999999999999999999888999999999999999999887534345699999999999999999999998887679


Q ss_pred             CCCCCCCeeeeecccccccCcccCCCCcccccCC-CCCcccCceeeecccCCccCCCCCccChhhhHHHHHHHHHHHHHH
Q psy9575         320 VNALKEPIPVIPTIHYQMGGIPTNIYGQVIIPNN-DNNKIVNGLYAIGECACVSVHGANRLGTNSLLDLLVFGRSAGNHI  398 (786)
Q Consensus       320 ~d~~~~~i~v~p~~~~t~GGi~vd~~~~vl~~~~-~~~t~IpGLyAaGe~a~gg~~Ga~rlgg~~l~~a~v~G~~Ag~~a  398 (786)
                      +|+.++|+||.|++||+||||.||.++||++.++ +.+|+|||||||||++|+|+||+||+|||+|++|+|||++||++|
T Consensus       383 ~D~~~~pi~v~P~~hyt~GGi~vd~~g~vl~~~g~~~~t~IpGLYAaGE~a~~g~hGanRlggnsL~~a~vfGr~Ag~~a  462 (635)
T PLN00128        383 VDVTKEPIPVLPTVHYNMGGIPTNYHGEVVTIKGDDPDAVVPGLMAAGEAACASVHGANRLGANSLLDIVVFGRACANRV  462 (635)
T ss_pred             CCCCCCceEeeccceEecCCcccCCCCeEecccCcccCCccCceEeeeccccccCCCCCCCchhhHHHHHHHHHHHHHHH
Confidence            9999999999999999999999999999998875 345899999999999988999999999999999999999999999


Q ss_pred             HHHhhhccCCCCCCcccHHHHHHHHhhhhhCCCCCCHHHHHHHHHHHHHhccccccCHHHHHHHHHHHHHHHHHhccccc
Q psy9575         399 LSLELKKIHNKKLPINSIDIIIDRLSKLENNKGSESVQSVANDIRKTMQNYCGVFRTDKLMKNGYKKIMILDERRKYISF  478 (786)
Q Consensus       399 a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~m~~~~g~~r~~~~l~~~l~~l~~l~~~~~~~~~  478 (786)
                      +++++......+...+..+...+.+..+...+++.+|.+++++||++||+++||+|++++|++++.+|++|++++..+.+
T Consensus       463 a~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~Lq~~m~~~~gi~R~~~~L~~al~~l~~l~~~~~~~~~  542 (635)
T PLN00128        463 AEIAKPGEKQKPLPKDAGEKTIAWLDKLRNANGSLPTSKIRLNMQRVMQNNAAVFRTQETLEEGCKLIDEAWDSFHDVKV  542 (635)
T ss_pred             HHhhcccccccccchhhHHHHHHHHHHhhcccCCCChHHHHHHHHHHHhCceeEEECHHHHHHHHHHHHHHHHHHHhccc
Confidence            99864321111122222222223333333333457889999999999999999999999999999999999988888777


Q ss_pred             cCCCcccchHHHHHHhHhhHHHHHHHHHHHHhhcccCCcccccCCCCCCCcccccceEEEEec--CceeeeccCcCCCCc
Q psy9575         479 KDKSKIFNTARIEALELDNLIETAKATISSAISRKESRGAHAHNDFKNRDDINWLKHSIWYSN--GNRIEFKPVNLKPLT  556 (786)
Q Consensus       479 ~~~~~~~~~~l~~~~e~~~~~~~a~~~~~aal~R~ESRG~h~R~D~p~~d~~~~~~~~~~~~~--~~~~~~~~~~~~~~~  556 (786)
                      .+....+|++|.+++|++||+++|+++++|||+|+||||+|||.|||++||++|++|+++.++  ++++.++|++..|.+
T Consensus       543 ~~~~~~~~~~~~~~~e~~n~l~~a~~~~~aal~R~ESRG~H~R~D~P~~~d~~w~~~~~~~~~~~~~~~~~~~~~~~~~~  622 (635)
T PLN00128        543 TDRSLIWNSDLIETLELENLLINACITMHSAEARKESRGAHAREDFTKRDDENWMKHTLGYWEEGKVRLDYRPVHMNTLD  622 (635)
T ss_pred             cccccccchhHHHHHHHHHHHHHHHHHHHHHHhCcCcccccccCCCCCCCccccccEEEEEecCCcceEEeccccccccc
Confidence            777777899999999999999999999999999999999999999999999999999987654  357888888754443


Q ss_pred             --ccccCCCCc
Q psy9575         557 --VKTVHPKKH  565 (786)
Q Consensus       557 --v~~~~p~~r  565 (786)
                        +..++|..|
T Consensus       623 ~~~~~~~p~~~  633 (635)
T PLN00128        623 DEVETFPPKAR  633 (635)
T ss_pred             ccccccCCCCC
Confidence              445666543

>PRK05675 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>COG0029 NadB Aspartate oxidase [Coenzyme metabolism] Back     alignment and domain information
>PRK08958 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PTZ00139 Succinate dehydrogenase [ubiquinone] flavoprotein subunit; Provisional Back     alignment and domain information
>TIGR01816 sdhA_forward succinate dehydrogenase, flavoprotein subunit, E Back     alignment and domain information
>PRK09078 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK07057 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08626 fumarate reductase flavoprotein subunit; Provisional Back     alignment and domain information
>PRK06452 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08205 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR01176 fum_red_Fp fumarate reductase, flavoprotein subunit Back     alignment and domain information
>TIGR01811 sdhA_Bsu succinate dehydrogenase or fumarate reductase, flavoprotein subunit, Bacillus subtilis subgroup Back     alignment and domain information
>PRK05945 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK08641 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK09231 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>PRK07573 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK06069 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>TIGR01812 sdhA_frdA_Gneg succinate dehydrogenase or fumarate reductase, flavoprotein subunitGram-negative/mitochondrial subgroup Back     alignment and domain information
>PRK07803 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>COG1053 SdhA Succinate dehydrogenase/fumarate reductase, flavoprotein subunit [Energy production and conversion] Back     alignment and domain information
>PLN02815 L-aspartate oxidase Back     alignment and domain information
>PRK07395 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK06263 sdhA succinate dehydrogenase flavoprotein subunit; Reviewed Back     alignment and domain information
>PRK09077 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK07804 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK07512 L-aspartate oxidase; Provisional Back     alignment and domain information
>KOG2403|consensus Back     alignment and domain information
>PRK08071 L-aspartate oxidase; Provisional Back     alignment and domain information
>TIGR00551 nadB L-aspartate oxidase Back     alignment and domain information
>TIGR02061 aprA adenosine phosphosulphate reductase, alpha subunit Back     alignment and domain information
>PRK13800 putative oxidoreductase/HEAT repeat-containing protein; Provisional Back     alignment and domain information
>PRK08275 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK06854 adenylylsulfate reductase subunit alpha; Validated Back     alignment and domain information
>PRK08401 L-aspartate oxidase; Provisional Back     alignment and domain information
>PRK06175 L-aspartate oxidase; Provisional Back     alignment and domain information
>COG0479 FrdB Succinate dehydrogenase/fumarate reductase, Fe-S protein subunit [Energy production and conversion] Back     alignment and domain information
>PRK06481 fumarate reductase flavoprotein subunit; Validated Back     alignment and domain information
>KOG2404|consensus Back     alignment and domain information
>PRK12575 succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>PLN00129 succinate dehydrogenase [ubiquinone] iron-sulfur subunit Back     alignment and domain information
>PRK13552 frdB fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>PTZ00306 NADH-dependent fumarate reductase; Provisional Back     alignment and domain information
>TIGR01813 flavo_cyto_c flavocytochrome c Back     alignment and domain information
>PRK08640 sdhB succinate dehydrogenase iron-sulfur subunit; Reviewed Back     alignment and domain information
>PF00890 FAD_binding_2: FAD binding domain of the Pfam family Back     alignment and domain information
>PRK12845 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK07121 hypothetical protein; Validated Back     alignment and domain information
>PRK12837 3-ketosteroid-delta-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK12385 fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK12386 fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK05950 sdhB succinate dehydrogenase iron-sulfur subunit; Reviewed Back     alignment and domain information
>PRK12844 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK12577 succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>TIGR02485 CobZ_N-term precorrin 3B synthase CobZ Back     alignment and domain information
>PRK08274 tricarballylate dehydrogenase; Validated Back     alignment and domain information
>PRK12835 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>PRK12834 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>TIGR00384 dhsB succinate dehydrogenase and fumarate reductase iron-sulfur protein Back     alignment and domain information
>PRK12576 succinate dehydrogenase iron-sulfur subunit; Provisional Back     alignment and domain information
>PRK12839 hypothetical protein; Provisional Back     alignment and domain information
>PRK07570 succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Validated Back     alignment and domain information
>PRK12843 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK07843 3-ketosteroid-delta-1-dehydrogenase; Reviewed Back     alignment and domain information
>KOG3049|consensus Back     alignment and domain information
>PRK12842 putative succinate dehydrogenase; Reviewed Back     alignment and domain information
>PRK06134 putative FAD-binding dehydrogenase; Reviewed Back     alignment and domain information
>PRK06259 succinate dehydrogenase/fumarate reductase iron-sulfur subunit; Provisional Back     alignment and domain information
>PF02910 Succ_DH_flav_C: Fumarate reductase flavoprotein C-term; InterPro: IPR004112 In bacteria two distinct, membrane-bound, enzyme complexes are responsible for the interconversion of fumarate and succinate (1 Back     alignment and domain information
>PF13085 Fer2_3: 2Fe-2S iron-sulfur cluster binding domain; PDB: 3P4Q_N 1KFY_N 3CIR_N 3P4R_B 2B76_N 1KF6_B 3P4P_N 3P4S_B 1L0V_B 1ZOY_B Back     alignment and domain information
>COG2081 Predicted flavoproteins [General function prediction only] Back     alignment and domain information
>COG3573 Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>PF03486 HI0933_like: HI0933-like protein; InterPro: IPR004792 This is a family of conserved hypothetical proteins that may include proteins with a dinucleotide-binding motif (Rossman fold), including oxidoreductases and dehydrogenases Back     alignment and domain information
>TIGR00275 flavoprotein, HI0933 family Back     alignment and domain information
>TIGR03862 flavo_PP4765 uncharacterized flavoprotein, PP_4765 family Back     alignment and domain information
>COG3383 Uncharacterized anaerobic dehydrogenase [General function prediction only] Back     alignment and domain information
>PTZ00305 NADH:ubiquinone oxidoreductase; Provisional Back     alignment and domain information
>PRK08493 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>COG1034 NuoG NADH dehydrogenase/NADH:ubiquinone oxidoreductase 75 kD subunit (chain G) [Energy production and conversion] Back     alignment and domain information
>PRK09130 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>TIGR01973 NuoG NADH-quinone oxidoreductase, chain G Back     alignment and domain information
>PRK09129 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>PRK07860 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>PRK07569 bidirectional hydrogenase complex protein HoxU; Validated Back     alignment and domain information
>PRK08166 NADH dehydrogenase subunit G; Validated Back     alignment and domain information
>COG1139 Uncharacterized conserved protein containing a ferredoxin-like domain [Energy production and conversion] Back     alignment and domain information
>COG1249 Lpd Pyruvate/2-oxoglutarate dehydrogenase complex, dihydrolipoamide dehydrogenase (E3) component, and related enzymes [Energy production and conversion] Back     alignment and domain information
>COG1150 HdrC Heterodisulfide reductase, subunit C [Energy production and conversion] Back     alignment and domain information
>PRK11274 glcF glycolate oxidase iron-sulfur subunit; Provisional Back     alignment and domain information
>TIGR03290 CoB_CoM_SS_C CoB--CoM heterodisulfide reductase, subunit C Back     alignment and domain information
>PF13510 Fer2_4: 2Fe-2S iron-sulfur cluster binding domain; PDB: 1Y56_A 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>TIGR00273 iron-sulfur cluster-binding protein Back     alignment and domain information
>PRK11168 glpC sn-glycerol-3-phosphate dehydrogenase subunit C; Provisional Back     alignment and domain information
>PRK05329 anaerobic glycerol-3-phosphate dehydrogenase subunit B; Validated Back     alignment and domain information
>PRK04176 ribulose-1,5-biphosphate synthetase; Provisional Back     alignment and domain information
>TIGR00136 gidA glucose-inhibited division protein A Back     alignment and domain information
>TIGR03379 glycerol3P_GlpC glycerol-3-phosphate dehydrogenase, anaerobic, C subunit Back     alignment and domain information
>PLN02661 Putative thiazole synthesis Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>PF13183 Fer4_8: 4Fe-4S dicluster domain; PDB: 2BS4_B 1E7P_B 2BS3_B 1QLB_B 2BS2_B 3P4Q_N 1KFY_N 3CIR_N 3P4R_B 2B76_N Back     alignment and domain information
>KOG2282|consensus Back     alignment and domain information
>PRK05192 tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA; Validated Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information
>TIGR01424 gluta_reduc_2 glutathione-disulfide reductase, plant Back     alignment and domain information
>PLN02546 glutathione reductase Back     alignment and domain information
>PRK06467 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>COG1635 THI4 Ribulose 1,5-bisphosphate synthetase, converts PRPP to RuBP, flavoprotein [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG0247 GlpC Fe-S oxidoreductase [Energy production and conversion] Back     alignment and domain information
>TIGR01421 gluta_reduc_1 glutathione-disulfide reductase, animal/bacterial Back     alignment and domain information
>PF01134 GIDA: Glucose inhibited division protein A; InterPro: IPR002218 GidA is a tRNA modification enzyme found in bacteria and mitochondria Back     alignment and domain information
>PTZ00058 glutathione reductase; Provisional Back     alignment and domain information
>PRK11101 glpA sn-glycerol-3-phosphate dehydrogenase subunit A; Provisional Back     alignment and domain information
>PLN02507 glutathione reductase Back     alignment and domain information
>PRK15055 anaerobic sulfite reductase subunit A; Provisional Back     alignment and domain information
>PRK07845 flavoprotein disulfide reductase; Reviewed Back     alignment and domain information
>TIGR01438 TGR thioredoxin and glutathione reductase selenoprotein Back     alignment and domain information
>COG2509 Uncharacterized FAD-dependent dehydrogenases [General function prediction only] Back     alignment and domain information
>PRK06116 glutathione reductase; Validated Back     alignment and domain information
>PF13534 Fer4_17: 4Fe-4S dicluster domain; PDB: 1ZOY_B 3AE9_B 3AED_B 3AEA_B 3AE1_B 3SFD_B 3ABV_B 3AEF_B 3AEB_B 3AE3_B Back     alignment and domain information
>PRK06115 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>TIGR02910 sulfite_red_A sulfite reductase, subunit A Back     alignment and domain information
>TIGR03377 glycerol3P_GlpA glycerol-3-phosphate dehydrogenase, anaerobic, A subunit Back     alignment and domain information
>TIGR01423 trypano_reduc trypanothione-disulfide reductase Back     alignment and domain information
>TIGR01945 rnfC electron transport complex, RnfABCDGE type, C subunit Back     alignment and domain information
>PF01266 DAO: FAD dependent oxidoreductase; InterPro: IPR006076 This entry includes various FAD dependent oxidoreductases: Glycerol-3-phosphate dehydrogenase (1 Back     alignment and domain information
>PF01946 Thi4: Thi4 family; PDB: 1RP0_A 3FPZ_B 3JSK_K Back     alignment and domain information
>COG0644 FixC Dehydrogenases (flavoproteins) [Energy production and conversion] Back     alignment and domain information
>PRK06912 acoL dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>PRK05035 electron transport complex protein RnfC; Provisional Back     alignment and domain information
>PRK05352 Na(+)-translocating NADH-quinone reductase subunit A; Provisional Back     alignment and domain information
>PRK00941 acetyl-CoA decarbonylase/synthase complex subunit alpha; Validated Back     alignment and domain information
>TIGR03329 Phn_aa_oxid putative aminophosphonate oxidoreductase Back     alignment and domain information
>PRK06327 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>KOG0405|consensus Back     alignment and domain information
>PRK06370 mercuric reductase; Validated Back     alignment and domain information
>TIGR01936 nqrA NADH:ubiquinone oxidoreductase, Na(+)-translocating, A subunit Back     alignment and domain information
>PRK07818 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>PRK07846 mycothione reductase; Reviewed Back     alignment and domain information
>PRK06416 dihydrolipoamide dehydrogenase; Reviewed Back     alignment and domain information
>COG4656 RnfC Predicted NADH:ubiquinone oxidoreductase, subunit RnfC [Energy production and conversion] Back     alignment and domain information
>PTZ00153 lipoamide dehydrogenase; Provisional Back     alignment and domain information
>TIGR03193 4hydroxCoAred 4-hydroxybenzoyl-CoA reductase, gamma subunit Back     alignment and domain information
>KOG1335|consensus Back     alignment and domain information
>TIGR00314 cdhA CO dehydrogenase/acetyl-CoA synthase complex, epsilon subunit Back     alignment and domain information
>PRK00711 D-amino acid dehydrogenase small subunit; Validated Back     alignment and domain information
>TIGR02352 thiamin_ThiO glycine oxidase ThiO Back     alignment and domain information
>cd01916 ACS_1 Acetyl-CoA synthase (ACS), also known as acetyl-CoA decarbonylase, is found in acetogenic and methanogenic organisms and is responsible for the synthesis and breakdown of acetyl-CoA Back     alignment and domain information
>PRK05976 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR03452 mycothione_red mycothione reductase Back     alignment and domain information
>PLN02464 glycerol-3-phosphate dehydrogenase Back     alignment and domain information
>PRK12409 D-amino acid dehydrogenase small subunit; Provisional Back     alignment and domain information
>COG1143 NuoI Formate hydrogenlyase subunit 6/NADH:ubiquinone oxidoreductase 23 kD subunit (chain I) [Energy production and conversion] Back     alignment and domain information
>TIGR01373 soxB sarcosine oxidase, beta subunit family, heterotetrameric form Back     alignment and domain information
>KOG4716|consensus Back     alignment and domain information
>TIGR02053 MerA mercuric reductase Back     alignment and domain information
>PRK05249 soluble pyridine nucleotide transhydrogenase; Provisional Back     alignment and domain information
>TIGR03197 MnmC_Cterm tRNA U-34 5-methylaminomethyl-2-thiouridine biosynthesis protein MnmC, C-terminal domain Back     alignment and domain information
>TIGR01350 lipoamide_DH dihydrolipoamide dehydrogenase Back     alignment and domain information
>PRK10015 oxidoreductase; Provisional Back     alignment and domain information
>PRK14694 putative mercuric reductase; Provisional Back     alignment and domain information
>PF13187 Fer4_9: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_C 2O01_C 2WSC_C 3LW5_C 2VKR_C 1KQG_B 1KQF_B 3GYX_J Back     alignment and domain information
>PRK11433 aldehyde oxidoreductase 2Fe-2S subunit; Provisional Back     alignment and domain information
>PF13237 Fer4_10: 4Fe-4S dicluster domain; PDB: 2FGO_A Back     alignment and domain information
>COG0492 TrxB Thioredoxin reductase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0578 GlpA Glycerol-3-phosphate dehydrogenase [Energy production and conversion] Back     alignment and domain information
>PF12831 FAD_oxidored: FAD dependent oxidoreductase; PDB: 3ADA_A 1VRQ_A 1X31_A 3AD9_A 3AD8_A 3AD7_A 2GAG_A 2GAH_A Back     alignment and domain information
>PF13746 Fer4_18: 4Fe-4S dicluster domain Back     alignment and domain information
>PRK06292 dihydrolipoamide dehydrogenase; Validated Back     alignment and domain information
>TIGR01320 mal_quin_oxido malate:quinone-oxidoreductase Back     alignment and domain information
>TIGR02484 CitB CitB domain protein Back     alignment and domain information
>PRK14727 putative mercuric reductase; Provisional Back     alignment and domain information
>PTZ00052 thioredoxin reductase; Provisional Back     alignment and domain information
>PRK11728 hydroxyglutarate oxidase; Provisional Back     alignment and domain information
>PRK12266 glpD glycerol-3-phosphate dehydrogenase; Reviewed Back     alignment and domain information
>PF12838 Fer4_7: 4Fe-4S dicluster domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters Back     alignment and domain information
>cd00207 fer2 2Fe-2S iron-sulfur cluster binding domain Back     alignment and domain information
>COG1152 CdhA CO dehydrogenase/acetyl-CoA synthase alpha subunit [Energy production and conversion] Back     alignment and domain information
>TIGR03378 glycerol3P_GlpB glycerol-3-phosphate dehydrogenase, anaerobic, B subunit Back     alignment and domain information
>PRK09908 xanthine dehydrogenase subunit XdhC; Provisional Back     alignment and domain information
>PRK15033 tricarballylate utilization protein B; Provisional Back     alignment and domain information
>KOG0404|consensus Back     alignment and domain information
>PRK13748 putative mercuric reductase; Provisional Back     alignment and domain information
>TIGR01377 soxA_mon sarcosine oxidase, monomeric form Back     alignment and domain information
>COG2080 CoxS Aerobic-type carbon monoxide dehydrogenase, small subunit CoxS/CutS homologs [Energy production and conversion] Back     alignment and domain information
>TIGR02028 ChlP geranylgeranyl reductase Back     alignment and domain information
>PRK13369 glycerol-3-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PF14697 Fer4_21: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_C 2O01_C 2WSC_C 3LW5_C 1H7X_C 1H7W_A 1GT8_A 1GTE_B 1GTH_B Back     alignment and domain information
>TIGR03364 HpnW_proposed FAD dependent oxidoreductase TIGR03364 Back     alignment and domain information
>KOG0042|consensus Back     alignment and domain information
>COG0579 Predicted dehydrogenase [General function prediction only] Back     alignment and domain information
>TIGR03198 pucE xanthine dehydrogenase E subunit Back     alignment and domain information
>PF00111 Fer2: 2Fe-2S iron-sulfur cluster binding domain; InterPro: IPR001041 The ferredoxin protein family are electron carrier proteins with an iron-sulphur cofactor that act in a wide variety of metabolic reactions Back     alignment and domain information
>PRK07251 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK05257 malate:quinone oxidoreductase; Validated Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>TIGR02023 BchP-ChlP geranylgeranyl reductase Back     alignment and domain information
>PLN02697 lycopene epsilon cyclase Back     alignment and domain information
>COG0665 DadA Glycine/D-amino acid oxidases (deaminating) [Amino acid transport and metabolism] Back     alignment and domain information
>PRK11259 solA N-methyltryptophan oxidase; Provisional Back     alignment and domain information
>TIGR00403 ndhI NADH-plastoquinone oxidoreductase subunit I protein Back     alignment and domain information
>KOG3256|consensus Back     alignment and domain information
>CHL00134 petF ferredoxin; Validated Back     alignment and domain information
>TIGR02008 fdx_plant ferredoxin [2Fe-2S] Back     alignment and domain information
>PLN00093 geranylgeranyl diphosphate reductase; Provisional Back     alignment and domain information
>PRK05888 NADH dehydrogenase subunit I; Provisional Back     alignment and domain information
>PRK10713 2Fe-2S ferredoxin YfaE; Provisional Back     alignment and domain information
>TIGR02176 pyruv_ox_red pyruvate:ferredoxin (flavodoxin) oxidoreductase, homodimeric Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK10157 putative oxidoreductase FixC; Provisional Back     alignment and domain information
>PTZ00383 malate:quinone oxidoreductase; Provisional Back     alignment and domain information
>PRK06273 ferredoxin; Provisional Back     alignment and domain information
>PRK13339 malate:quinone oxidoreductase; Reviewed Back     alignment and domain information
>PRK14028 pyruvate ferredoxin oxidoreductase subunit gamma/delta; Provisional Back     alignment and domain information
>TIGR01971 NuoI NADH-quinone oxidoreductase, chain I Back     alignment and domain information
>COG1453 Predicted oxidoreductases of the aldo/keto reductase family [General function prediction only] Back     alignment and domain information
>CHL00065 psaC photosystem I subunit VII Back     alignment and domain information
>PRK02651 photosystem I subunit VII; Provisional Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>TIGR03048 PS_I_psaC photosystem I iron-sulfur protein PsaC Back     alignment and domain information
>PRK08348 NADH-plastoquinone oxidoreductase subunit; Provisional Back     alignment and domain information
>PLN02593 adrenodoxin-like ferredoxin protein Back     alignment and domain information
>TIGR03313 Se_sel_red_Mo probable selenate reductase, molybdenum-binding subunit Back     alignment and domain information
>COG0633 Fdx Ferredoxin [Energy production and conversion] Back     alignment and domain information
>TIGR02936 fdxN_nitrog ferredoxin III, nif-specific Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>PTZ00038 ferredoxin; Provisional Back     alignment and domain information
>CHL00014 ndhI NADH dehydrogenase subunit I Back     alignment and domain information
>PRK08222 hydrogenase 4 subunit H; Validated Back     alignment and domain information
>PRK06991 ferredoxin; Provisional Back     alignment and domain information
>PRK06126 hypothetical protein; Provisional Back     alignment and domain information
>KOG2844|consensus Back     alignment and domain information
>TIGR01790 carotene-cycl lycopene cyclase family protein Back     alignment and domain information
>PRK05113 electron transport complex protein RnfB; Provisional Back     alignment and domain information
>PLN00071 photosystem I subunit VII; Provisional Back     alignment and domain information
>PRK09477 napH quinol dehydrogenase membrane component; Provisional Back     alignment and domain information
>TIGR02007 fdx_isc ferredoxin, 2Fe-2S type, ISC system Back     alignment and domain information
>KOG2820|consensus Back     alignment and domain information
>PLN03136 Ferredoxin; Provisional Back     alignment and domain information
>PRK09625 porD pyruvate flavodoxin oxidoreductase subunit delta; Reviewed Back     alignment and domain information
>TIGR02494 PFLE_PFLC glycyl-radical enzyme activating protein family Back     alignment and domain information
>COG1146 Ferredoxin [Energy production and conversion] Back     alignment and domain information
>TIGR02163 napH_ ferredoxin-type protein, NapH/MauN family Back     alignment and domain information
>PLN02463 lycopene beta cyclase Back     alignment and domain information
>TIGR02512 Fe_only_hydrog hydrogenases, Fe-only Back     alignment and domain information
>PF13484 Fer4_16: 4Fe-4S double cluster binding domain Back     alignment and domain information
>COG1145 NapF Ferredoxin [Energy production and conversion] Back     alignment and domain information
>PRK09626 oorD 2-oxoglutarate-acceptor oxidoreductase subunit OorD; Reviewed Back     alignment and domain information
>PRK09624 porD pyuvate ferredoxin oxidoreductase subunit delta; Reviewed Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK12387 formate hydrogenlyase complex iron-sulfur subunit; Provisional Back     alignment and domain information
>PF12797 Fer4_2: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters Back     alignment and domain information
>PRK13512 coenzyme A disulfide reductase; Provisional Back     alignment and domain information
>PRK09800 putative hypoxanthine oxidase; Provisional Back     alignment and domain information
>TIGR00402 napF ferredoxin-type protein NapF Back     alignment and domain information
>PF12798 Fer4_3: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters Back     alignment and domain information
>PRK06184 hypothetical protein; Provisional Back     alignment and domain information
>PRK09897 hypothetical protein; Provisional Back     alignment and domain information
>PRK08764 ferredoxin; Provisional Back     alignment and domain information
>TIGR01944 rnfB electron transport complex, RnfABCDGE type, B subunit Back     alignment and domain information
>PRK06185 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02032 GG-red-SF geranylgeranyl reductase family Back     alignment and domain information
>PRK06834 hypothetical protein; Provisional Back     alignment and domain information
>KOG2415|consensus Back     alignment and domain information
>PF13738 Pyr_redox_3: Pyridine nucleotide-disulphide oxidoreductase; PDB: 3D1C_A 4A9W_B 2YLX_A 2YM2_A 2YLW_A 2YLR_A 2YM1_A 2YLS_A 1W4X_A 2YLT_A Back     alignment and domain information
>TIGR02912 sulfite_red_C sulfite reductase, subunit C Back     alignment and domain information
>PRK09623 vorD 2-ketoisovalerate ferredoxin oxidoreductase subunit delta; Reviewed Back     alignment and domain information
>TIGR02179 PorD_KorD 2-oxoacid:acceptor oxidoreductase, delta subunit, pyruvate/2-ketoisovalerate family Back     alignment and domain information
>PRK05713 hypothetical protein; Provisional Back     alignment and domain information
>PLN02985 squalene monooxygenase Back     alignment and domain information
>PF12837 Fer4_6: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters Back     alignment and domain information
>COG1149 MinD superfamily P-loop ATPase containing an inserted ferredoxin domain [Energy production and conversion] Back     alignment and domain information
>PRK10194 ferredoxin-type protein; Provisional Back     alignment and domain information
>COG1144 Pyruvate:ferredoxin oxidoreductase and related 2-oxoacid:ferredoxin oxidoreductases, delta subunit [Energy production and conversion] Back     alignment and domain information
>TIGR01988 Ubi-OHases Ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family Back     alignment and domain information
>COG2768 Uncharacterized Fe-S center protein [General function prediction only] Back     alignment and domain information
>PRK06847 hypothetical protein; Provisional Back     alignment and domain information
>PRK14989 nitrite reductase subunit NirD; Provisional Back     alignment and domain information
>TIGR03311 Se_dep_Molyb_1 selenium-dependent molybdenum hydroxylase 1 Back     alignment and domain information
>PRK09326 F420H2 dehydrogenase subunit F; Provisional Back     alignment and domain information
>PRK08773 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Validated Back     alignment and domain information
>TIGR02060 aprB adenosine phosphosulphate reductase, beta subunit Back     alignment and domain information
>TIGR02963 xanthine_xdhA xanthine dehydrogenase, small subunit Back     alignment and domain information
>TIGR02745 ccoG_rdxA_fixG cytochrome c oxidase accessory protein FixG Back     alignment and domain information
>KOG2403|consensus Back     alignment and domain information
>PRK08318 dihydropyrimidine dehydrogenase subunit B; Validated Back     alignment and domain information
>KOG1298|consensus Back     alignment and domain information
>PF12800 Fer4_4: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters Back     alignment and domain information
>PRK13977 myosin-cross-reactive antigen; Provisional Back     alignment and domain information
>COG3634 AhpF Alkyl hydroperoxide reductase, large subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK07364 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>COG0445 GidA Flavin-dependent tRNA uridine 5-carboxymethylaminomethyl modification enzyme GidA [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK09898 hypothetical protein; Provisional Back     alignment and domain information
>PRK08244 hypothetical protein; Provisional Back     alignment and domain information
>PF01494 FAD_binding_3: FAD binding domain; InterPro: IPR002938 Monooxygenases incorporate one hydroxyl group into substrates and are found in many metabolic pathways Back     alignment and domain information
>TIGR02700 flavo_MJ0208 archaeoflavoprotein, MJ0208 family Back     alignment and domain information
>TIGR03224 benzo_boxA benzoyl-CoA oxygenase/reductase, BoxA protein Back     alignment and domain information
>COG0437 HybA Fe-S-cluster-containing hydrogenase components 1 [Energy production and conversion] Back     alignment and domain information
>PTZ00490 Ferredoxin superfamily; Provisional Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>PRK09564 coenzyme A disulfide reductase; Reviewed Back     alignment and domain information
>COG0654 UbiH 2-polyprenyl-6-methoxyphenol hydroxylase and related FAD-dependent oxidoreductases [Coenzyme metabolism / Energy production and conversion] Back     alignment and domain information
>PRK07190 hypothetical protein; Provisional Back     alignment and domain information
>PRK06183 mhpA 3-(3-hydroxyphenyl)propionate hydroxylase; Validated Back     alignment and domain information
>PRK07609 CDP-6-deoxy-delta-3,4-glucoseen reductase; Validated Back     alignment and domain information
>PRK08243 4-hydroxybenzoate 3-monooxygenase; Validated Back     alignment and domain information
>PRK07608 ubiquinone biosynthesis hydroxylase family protein; Provisional Back     alignment and domain information
>TIGR03478 DMSO_red_II_bet DMSO reductase family type II enzyme, iron-sulfur subunit Back     alignment and domain information
>PF12800 Fer4_4: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters Back     alignment and domain information
>COG2878 Predicted NADH:ubiquinone oxidoreductase, subunit RnfB [Energy production and conversion] Back     alignment and domain information
>PRK10882 hydrogenase 2 protein HybA; Provisional Back     alignment and domain information
>PRK05714 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK07333 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>PRK10684 HCP oxidoreductase, NADH-dependent; Provisional Back     alignment and domain information
>TIGR02160 PA_CoA_Oxy5 phenylacetate-CoA oxygenase/reductase, PaaK subunit Back     alignment and domain information
>COG1251 NirB NAD(P)H-nitrite reductase [Energy production and conversion] Back     alignment and domain information
>TIGR03287 methan_mark_16 putative methanogenesis marker 16 metalloprotein Back     alignment and domain information
>PF12837 Fer4_6: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters Back     alignment and domain information
>TIGR00276 iron-sulfur cluster binding protein, putative Back     alignment and domain information
>TIGR00397 mauM_napG MauM/NapG family ferredoxin-type protein Back     alignment and domain information
>TIGR01660 narH nitrate reductase, beta subunit Back     alignment and domain information
>PF00037 Fer4: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters Back     alignment and domain information
>PRK05464 Na(+)-translocating NADH-quinone reductase subunit F; Provisional Back     alignment and domain information
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>PRK06617 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PLN02172 flavin-containing monooxygenase FMO GS-OX Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>TIGR01984 UbiH 2-polyprenyl-6-methoxyphenol 4-hydroxylase Back     alignment and domain information
>KOG2853|consensus Back     alignment and domain information
>PRK07538 hypothetical protein; Provisional Back     alignment and domain information
>PF00037 Fer4: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters Back     alignment and domain information
>PRK09126 hypothetical protein; Provisional Back     alignment and domain information
>PRK08849 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Provisional Back     alignment and domain information
>TIGR03336 IOR_alpha indolepyruvate ferredoxin oxidoreductase, alpha subunit Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>PF12798 Fer4_3: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters Back     alignment and domain information
>PRK11872 antC anthranilate dioxygenase reductase; Provisional Back     alignment and domain information
>TIGR03149 cyt_nit_nrfC cytochrome c nitrite reductase, Fe-S protein Back     alignment and domain information
>KOG2852|consensus Back     alignment and domain information
>TIGR01941 nqrF NADH:ubiquinone oxidoreductase, Na(+)-translocating, F subunit Back     alignment and domain information
>PRK08020 ubiF 2-octaprenyl-3-methyl-6-methoxy-1,4-benzoquinol hydroxylase; Reviewed Back     alignment and domain information
>COG1142 HycB Fe-S-cluster-containing hydrogenase components 2 [Energy production and conversion] Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>TIGR01660 narH nitrate reductase, beta subunit Back     alignment and domain information
>PRK13795 hypothetical protein; Provisional Back     alignment and domain information
>PRK13984 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK14993 tetrathionate reductase subunit B; Provisional Back     alignment and domain information
>TIGR03478 DMSO_red_II_bet DMSO reductase family type II enzyme, iron-sulfur subunit Back     alignment and domain information
>PRK08163 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK10882 hydrogenase 2 protein HybA; Provisional Back     alignment and domain information
>PRK11445 putative oxidoreductase; Provisional Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>KOG1346|consensus Back     alignment and domain information
>PRK07045 putative monooxygenase; Reviewed Back     alignment and domain information
>COG4231 Indolepyruvate ferredoxin oxidoreductase, alpha and beta subunits [Energy production and conversion] Back     alignment and domain information
>TIGR01582 FDH-beta formate dehydrogenase, beta subunit, Fe-S containing Back     alignment and domain information
>TIGR01582 FDH-beta formate dehydrogenase, beta subunit, Fe-S containing Back     alignment and domain information
>PRK09476 napG quinol dehydrogenase periplasmic component; Provisional Back     alignment and domain information
>TIGR00397 mauM_napG MauM/NapG family ferredoxin-type protein Back     alignment and domain information
>TIGR03294 FrhG coenzyme F420 hydrogenase, subunit gamma Back     alignment and domain information
>PRK10330 formate dehydrogenase-H ferredoxin subunit; Provisional Back     alignment and domain information
>PF13247 Fer4_11: 4Fe-4S dicluster domain; PDB: 2VPY_F 2VPX_B 2VPZ_B 2VPW_F 3IR7_B 1Y5N_B 1R27_D 3EGW_B 1Y5I_B 1Q16_B Back     alignment and domain information
>PRK09476 napG quinol dehydrogenase periplasmic component; Provisional Back     alignment and domain information
>TIGR01317 GOGAT_sm_gam glutamate synthases, NADH/NADPH, small subunit Back     alignment and domain information
>PRK07118 ferredoxin; Validated Back     alignment and domain information
>TIGR03149 cyt_nit_nrfC cytochrome c nitrite reductase, Fe-S protein Back     alignment and domain information
>PRK08132 FAD-dependent oxidoreductase; Provisional Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>PRK07494 2-octaprenyl-6-methoxyphenyl hydroxylase; Provisional Back     alignment and domain information
>TIGR02360 pbenz_hydroxyl 4-hydroxybenzoate 3-monooxygenase Back     alignment and domain information
>COG2221 DsrA Dissimilatory sulfite reductase (desulfoviridin), alpha and beta subunits [Energy production and conversion] Back     alignment and domain information
>PRK05335 tRNA (uracil-5-)-methyltransferase Gid; Reviewed Back     alignment and domain information
>KOG1336|consensus Back     alignment and domain information
>PRK10194 ferredoxin-type protein; Provisional Back     alignment and domain information
>COG3894 Uncharacterized metal-binding protein [General function prediction only] Back     alignment and domain information
>PRK08013 oxidoreductase; Provisional Back     alignment and domain information
>PF13454 NAD_binding_9: FAD-NAD(P)-binding Back     alignment and domain information
>PRK07588 hypothetical protein; Provisional Back     alignment and domain information
>PRK10262 thioredoxin reductase; Provisional Back     alignment and domain information
>KOG2960|consensus Back     alignment and domain information
>PF12797 Fer4_2: 4Fe-4S binding domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters Back     alignment and domain information
>COG1148 HdrA Heterodisulfide reductase, subunit A and related polyferredoxins [Energy production and conversion] Back     alignment and domain information
>TIGR02486 RDH reductive dehalogenase Back     alignment and domain information
>PRK07236 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02462 pyranose_ox pyranose oxidase Back     alignment and domain information
>PRK12778 putative bifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK11749 dihydropyrimidine dehydrogenase subunit A; Provisional Back     alignment and domain information
>PRK05732 2-octaprenyl-6-methoxyphenyl hydroxylase; Validated Back     alignment and domain information
>PRK12769 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>TIGR02951 DMSO_dmsB DMSO reductase, iron-sulfur subunit Back     alignment and domain information
>PRK10330 formate dehydrogenase-H ferredoxin subunit; Provisional Back     alignment and domain information
>TIGR02969 mam_aldehyde_ox aldehyde oxidase Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>PRK12810 gltD glutamate synthase subunit beta; Reviewed Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>PRK07118 ferredoxin; Validated Back     alignment and domain information
>PLN00192 aldehyde oxidase Back     alignment and domain information
>PF00732 GMC_oxred_N: GMC oxidoreductase; InterPro: IPR000172 The glucose-methanol-choline (GMC) oxidoreductases are FAD flavoproteins oxidoreductases [, ] Back     alignment and domain information
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD Back     alignment and domain information
>cd07030 RNAP_D D subunit of Archaeal RNA polymerase Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>PRK08850 2-octaprenyl-6-methoxyphenol hydroxylase; Validated Back     alignment and domain information
>PRK09898 hypothetical protein; Provisional Back     alignment and domain information
>TIGR02731 phytoene_desat phytoene desaturase Back     alignment and domain information
>PRK00783 DNA-directed RNA polymerase subunit D; Provisional Back     alignment and domain information
>PRK08010 pyridine nucleotide-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK04965 NADH:flavorubredoxin oxidoreductase; Provisional Back     alignment and domain information
>PRK09754 phenylpropionate dioxygenase ferredoxin reductase subunit; Provisional Back     alignment and domain information
>PRK12779 putative bifunctional glutamate synthase subunit beta/2-polyprenylphenol hydroxylase; Provisional Back     alignment and domain information
>PRK12770 putative glutamate synthase subunit beta; Provisional Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK14993 tetrathionate reductase subunit B; Provisional Back     alignment and domain information
>TIGR02745 ccoG_rdxA_fixG cytochrome c oxidase accessory protein FixG Back     alignment and domain information
>PRK12814 putative NADPH-dependent glutamate synthase small subunit; Provisional Back     alignment and domain information
>PF06039 Mqo: Malate:quinone oxidoreductase (Mqo); InterPro: IPR006231 The membrane-associated enzyme, malate:quinone-oxidoreductase, is an alternative to the better-known NAD-dependent malate dehydrogenase as part of the TCA cycle Back     alignment and domain information
>PRK06475 salicylate hydroxylase; Provisional Back     alignment and domain information
>PRK12775 putative trifunctional 2-polyprenylphenol hydroxylase/glutamate synthase subunit beta/ferritin domain-containing protein; Provisional Back     alignment and domain information
>PRK12809 putative oxidoreductase Fe-S binding subunit; Reviewed Back     alignment and domain information
>PRK06753 hypothetical protein; Provisional Back     alignment and domain information
>PTZ00367 squalene epoxidase; Provisional Back     alignment and domain information
>COG1600 Uncharacterized Fe-S protein [Energy production and conversion] Back     alignment and domain information
>TIGR01318 gltD_gamma_fam glutamate synthase small subunit family protein, proteobacterial Back     alignment and domain information
>TIGR01810 betA choline dehydrogenase Back     alignment and domain information
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>PRK05868 hypothetical protein; Validated Back     alignment and domain information
>PTZ00318 NADH dehydrogenase-like protein; Provisional Back     alignment and domain information
>TIGR02066 dsrB sulfite reductase, dissimilatory-type beta subunit Back     alignment and domain information
>TIGR03169 Nterm_to_SelD pyridine nucleotide-disulfide oxidoreductase family protein Back     alignment and domain information
>PRK02106 choline dehydrogenase; Validated Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>TIGR02951 DMSO_dmsB DMSO reductase, iron-sulfur subunit Back     alignment and domain information
>PLN02927 antheraxanthin epoxidase/zeaxanthin epoxidase Back     alignment and domain information
>PRK05352 Na(+)-translocating NADH-quinone reductase subunit A; Provisional Back     alignment and domain information
>TIGR01372 soxA sarcosine oxidase, alpha subunit family, heterotetrameric form Back     alignment and domain information
>COG0437 HybA Fe-S-cluster-containing hydrogenase components 1 [Energy production and conversion] Back     alignment and domain information
>PF13746 Fer4_18: 4Fe-4S dicluster domain Back     alignment and domain information
>PRK00054 dihydroorotate dehydrogenase electron transfer subunit; Reviewed Back     alignment and domain information
>PRK12771 putative glutamate synthase (NADPH) small subunit; Provisional Back     alignment and domain information
>COG3075 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG3256|consensus Back     alignment and domain information
>PRK09853 putative selenate reductase subunit YgfK; Provisional Back     alignment and domain information
>TIGR01936 nqrA NADH:ubiquinone oxidoreductase, Na(+)-translocating, A subunit Back     alignment and domain information
>PRK06996 hypothetical protein; Provisional Back     alignment and domain information
>PLN02612 phytoene desaturase Back     alignment and domain information
>TIGR02374 nitri_red_nirB nitrite reductase [NAD(P)H], large subunit Back     alignment and domain information
>PF13247 Fer4_11: 4Fe-4S dicluster domain; PDB: 2VPY_F 2VPX_B 2VPZ_B 2VPW_F 3IR7_B 1Y5N_B 1R27_D 3EGW_B 1Y5I_B 1Q16_B Back     alignment and domain information
>COG1143 NuoI Formate hydrogenlyase subunit 6/NADH:ubiquinone oxidoreductase 23 kD subunit (chain I) [Energy production and conversion] Back     alignment and domain information
>PLN02906 xanthine dehydrogenase Back     alignment and domain information
>PRK07208 hypothetical protein; Provisional Back     alignment and domain information
>PF13187 Fer4_9: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_C 2O01_C 2WSC_C 3LW5_C 2VKR_C 1KQG_B 1KQF_B 3GYX_J Back     alignment and domain information
>COG3075 GlpB Anaerobic glycerol-3-phosphate dehydrogenase [Amino acid transport and metabolism] Back     alignment and domain information
>COG1142 HycB Fe-S-cluster-containing hydrogenase components 2 [Energy production and conversion] Back     alignment and domain information
>TIGR01989 COQ6 Ubiquinone biosynthesis mono0xygenase COQ6 Back     alignment and domain information
>KOG2311|consensus Back     alignment and domain information
>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PF14697 Fer4_21: 4Fe-4S dicluster domain; PDB: 2WSF_C 2WSE_C 2O01_C 2WSC_C 3LW5_C 1H7X_C 1H7W_A 1GT8_A 1GTE_B 1GTH_B Back     alignment and domain information
>PLN02852 ferredoxin-NADP+ reductase Back     alignment and domain information
>PRK08294 phenol 2-monooxygenase; Provisional Back     alignment and domain information
>PF13237 Fer4_10: 4Fe-4S dicluster domain; PDB: 2FGO_A Back     alignment and domain information
>PF00743 FMO-like: Flavin-binding monooxygenase-like; InterPro: IPR020946 Flavin-containing monooxygenases (FMOs) constitute a family of xenobiotic-metabolising enzymes [] Back     alignment and domain information
>TIGR03219 salicylate_mono salicylate 1-monooxygenase Back     alignment and domain information
>PF07992 Pyr_redox_2: Pyridine nucleotide-disulphide oxidoreductase; InterPro: IPR023753 FAD flavoproteins belonging to the family of pyridine nucleotide-disulphide oxidoreductases (glutathione reductase, trypanothione reductase, lipoamide dehydrogenase, mercuric reductase, thioredoxin reductase, alkyl hydroperoxide reductase) share sequence similarity with a number of other flavoprotein oxidoreductases, in particular with ferredoxin-NAD+ reductases involved in oxidative metabolism of a variety of hydrocarbons (rubredoxin reductase, putidaredoxin reductase, terpredoxin reductase, ferredoxin-NAD+ reductase components of benzene 1,2-dioxygenase, toluene 1,2-dioxygenase, chlorobenzene dioxygenase, biphenyl dioxygenase), NADH oxidase and NADH peroxidase [, , ] Back     alignment and domain information
>KOG2495|consensus Back     alignment and domain information
>PLN02785 Protein HOTHEAD Back     alignment and domain information
>COG2871 NqrF Na+-transporting NADH:ubiquinone oxidoreductase, subunit NqrF [Energy production and conversion] Back     alignment and domain information
>KOG4254|consensus Back     alignment and domain information
>PRK12387 formate hydrogenlyase complex iron-sulfur subunit; Provisional Back     alignment and domain information
>TIGR03385 CoA_CoA_reduc CoA-disulfide reductase Back     alignment and domain information
>PRK15449 ferredoxin-like protein FixX; Provisional Back     alignment and domain information
>TIGR03315 Se_ygfK putative selenate reductase, YgfK subunit Back     alignment and domain information
>PRK13030 2-oxoacid ferredoxin oxidoreductase; Provisional Back     alignment and domain information
>PF04820 Trp_halogenase: Tryptophan halogenase; InterPro: IPR006905 Tryptophan halogenase catalyses the chlorination of tryptophan to form 7-chlorotryptophan Back     alignment and domain information
>PF13534 Fer4_17: 4Fe-4S dicluster domain; PDB: 1ZOY_B 3AE9_B 3AED_B 3AEA_B 3AE1_B 3SFD_B 3ABV_B 3AEF_B 3AEB_B 3AE3_B Back     alignment and domain information
>COG1941 FrhG Coenzyme F420-reducing hydrogenase, gamma subunit [Energy production and conversion] Back     alignment and domain information
>PRK13029 2-oxoacid ferredoxin oxidoreductase; Provisional Back     alignment and domain information
>TIGR01292 TRX_reduct thioredoxin-disulfide reductase Back     alignment and domain information
>PTZ00363 rab-GDP dissociation inhibitor; Provisional Back     alignment and domain information
>PLN02487 zeta-carotene desaturase Back     alignment and domain information
>TIGR02163 napH_ ferredoxin-type protein, NapH/MauN family Back     alignment and domain information
>PRK09193 indolepyruvate ferredoxin oxidoreductase; Validated Back     alignment and domain information
>PF12838 Fer4_7: 4Fe-4S dicluster domain; InterPro: IPR001450 This superfamily includes proteins containing domains which bind to iron-sulphur clusters Back     alignment and domain information
>COG3383 Uncharacterized anaerobic dehydrogenase [General function prediction only] Back     alignment and domain information
>TIGR02732 zeta_caro_desat carotene 7,8-desaturase Back     alignment and domain information
>COG2440 FixX Ferredoxin-like protein [Energy production and conversion] Back     alignment and domain information
>PF13484 Fer4_16: 4Fe-4S double cluster binding domain Back     alignment and domain information
>KOG0430|consensus Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>COG2072 TrkA Predicted flavoprotein involved in K+ transport [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK08255 salicylyl-CoA 5-hydroxylase; Reviewed Back     alignment and domain information
>PRK08222 hydrogenase 4 subunit H; Validated Back     alignment and domain information
>COG1150 HdrC Heterodisulfide reductase, subunit C [Energy production and conversion] Back     alignment and domain information
>TIGR01316 gltA glutamate synthase (NADPH), homotetrameric Back     alignment and domain information
>COG4656 RnfC Predicted NADH:ubiquinone oxidoreductase, subunit RnfC [Energy production and conversion] Back     alignment and domain information
>cd06219 DHOD_e_trans_like1 FAD/NAD binding domain in the electron transfer subunit of dihydroorotate dehydrogenase-like proteins Back     alignment and domain information
>PF13183 Fer4_8: 4Fe-4S dicluster domain; PDB: 2BS4_B 1E7P_B 2BS3_B 1QLB_B 2BS2_B 3P4Q_N 1KFY_N 3CIR_N 3P4R_B 2B76_N Back     alignment and domain information
>PRK05035 electron transport complex protein RnfC; Provisional Back     alignment and domain information
>PRK12831 putative oxidoreductase; Provisional Back     alignment and domain information
>TIGR00292 thiazole biosynthesis enzyme Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query786
1nek_A588 Complex Ii (Succinate Dehydrogenase) From E. Coli W 1e-173
1zoy_A622 Crystal Structure Of Mitochondrial Respiratory Comp 1e-162
1yq3_A621 Avian Respiratory Complex Ii With Oxaloacetate And 1e-161
3vr8_A645 Mitochondrial Rhodoquinol-Fumarate Reductase From T 1e-156
2b76_A602 E. Coli Quinol Fumarate Reductase Frda E49q Mutatio 1e-108
3p4r_A577 Crystal Structure Of Menaquinol:fumarate Oxidoreduc 1e-108
1kf6_A602 E. Coli Quinol-Fumarate Reductase With Bound Inhibi 1e-108
3cir_A602 E. Coli Quinol Fumarate Reductase Frda T234a Mutati 1e-107
2bs2_A660 Quinol:fumarate Reductase From Wolinella Succinogen 7e-82
1qlb_A656 Respiratory Complex Ii-Like Fumarate Reductase From 8e-82
1e7p_A656 Quinol:fumarate Reductase From Wolinella Succinogen 9e-82
1nek_B238 Complex Ii (Succinate Dehydrogenase) From E. Coli W 2e-78
2wp9_B238 Crystal Structure Of The E. Coli Succinate:quinone 3e-78
1yq3_B252 Avian Respiratory Complex Ii With Oxaloacetate And 5e-68
1zoy_B252 Crystal Structure Of Mitochondrial Respiratory Comp 3e-67
3abv_B252 Crystal Structure Of Porcine Heart Mitochondrial Co 3e-67
3vr8_B282 Mitochondrial Rhodoquinol-Fumarate Reductase From T 4e-64
1chu_A540 Structure Of L-Aspartate Oxidase: Implications For 7e-56
1knp_A540 E. Coli L-aspartate Oxidase: Mutant R386l In Comple 6e-55
2e5v_A472 Crystal Structure Of L-Aspartate Oxidase From Hyper 3e-40
1kf6_B243 E. Coli Quinol-Fumarate Reductase With Bound Inhibi 4e-31
1ksu_A571 Crystal Structure Of His505tyr Mutant Flavocytochro 2e-27
1q9i_A571 The A251c:s430c Double Mutant Of Flavocytochrome C3 5e-27
1p2h_A571 H61m Mutant Of Flavocytochrome C3 Length = 571 8e-27
1p2e_A571 H61a Mutant Of Flavocytochrome C3 Length = 571 8e-27
1qjd_A571 Flavocytochrome C3 From Shewanella Frigidimarina Le 8e-27
1jry_A571 Crystal Structure Of Arg402lys Mutant Flavocytochro 8e-27
1jrx_A571 Crystal Structure Of Arg402ala Mutant Flavocytochro 9e-27
1jrz_A571 Crystal Structure Of Arg402tyr Mutant Flavocytochro 9e-27
1kss_A571 Crystal Structure Of His505ala Mutant Flavocytochro 2e-26
2b7s_A571 R381k Mutant Of Flavocytochrome C3 Length = 571 2e-26
2b7r_A571 Structure Of E378d Mutant Flavocytochrome C3 Length 2e-26
1m64_A571 Crystal Structure Of Q363f Mutant Flavocytochrome C 1e-25
1lj1_A571 Crystal Structure Of Q363fR402A MUTANT FLAVOCYTOCHR 1e-25
1e39_A571 Flavocytochrome C3 From Shewanella Frigidimarina Hi 1e-25
1qo8_A566 The Structure Of The Open Conformation Of A Flavocy 2e-24
1d4c_A572 Crystal Structure Of The Uncomplexed Form Of The Fl 4e-21
2bs2_B241 Quinol:fumarate Reductase From Wolinella Succinogen 5e-21
1qlb_B239 Respiratory Complex Ii-Like Fumarate Reductase From 6e-21
1d4d_A572 Crystal Structure Of The Succinate Complexed Form O 1e-20
1jnr_A643 Structure Of Adenylylsulfate Reductase From The Hyp 4e-07
2fja_A643 Adenosine 5'-Phosphosulfate Reductase In Complex Wi 4e-07
>pdb|1NEK|A Chain A, Complex Ii (Succinate Dehydrogenase) From E. Coli With Ubiquinone Bound Length = 588 Back     alignment and structure 
Iteration: 1

 Score =  605 bits (1561), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 304/561 (54%), Positives = 396/561 (70%), Gaps = 2/561 (0%)
Query: 5   LQLAQEGLNVAILSKVFPTRSHTVAAQGGISASLGNMSKDNWHWHMFDTIKGSDYLGDQD 64
           LQ++Q G   A+LSKVFPTRSHTV+AQGGI+ +LGN  +DNW WHM+DT+KGSDY+GDQD
Sbjct: 24  LQISQSGQTCALLSKVFPTRSHTVSAQGGITVALGNTHEDNWEWHMYDTVKGSDYIGDQD 83
Query: 65  AIEFMCKEAPKVVYELEHFGMPFDRNKNGTIYQRPFGGHSSNFGEKPIARACAVADRTGH 124
           AIE+MCK  P+ + ELEH G+PF R  +G IYQRPFGG S NFG +  AR  A ADRTGH
Sbjct: 84  AIEYMCKTGPEAILELEHMGLPFSRLDDGRIYQRPFGGQSKNFGGEQAARTAAAADRTGH 143
Query: 125 ALLHTLYQRNLHAKTNFFIEWMAIDLISDSEGDILGVVALEMETGNIMILESKITILATG 184
           ALLHTLYQ+NL   T  F EW A+DL+ + +G ++G  AL +ETG ++  +++ T+LATG
Sbjct: 144 ALLHTLYQQNLKNHTTIFSEWYALDLVKNQDGAVVGCTALCIETGEVVYFKARATVLATG 203
Query: 185 GGGRIWAASTNAFINTGDGLGMAARAGLPLEDMEFWQFHPTGVAGAGVLITEGVRGEGGI 244
           G GRI+ ++TNA INTGDG+GMA RAG+P++DME WQFHPTG+AGAGVL+TEG RGEGG 
Sbjct: 204 GAGRIYQSTTNAHINTGDGVGMAIRAGVPVQDMEMWQFHPTGIAGAGVLVTEGCRGEGGY 263
Query: 245 LINSNGERFMERYAPILKDLAPRDFVSRAMDQEIKEGRGC-GPNKDHVMLDLRHINSETI 303
           L+N +GERFMERYAP  KDLA RD V+R++  EI+EGRGC GP   H  L L H+  E +
Sbjct: 264 LLNKHGERFMERYAPNAKDLAGRDVVARSIMIEIREGRGCDGPWGPHAKLKLDHLGKEVL 323
Query: 304 INRLPSILEIGNKFANVNALKEPIPVIPTIHYQMGGIPTNIYGQVIIPNND-NNKIVNGL 362
            +RLP ILE+   FA+V+ +KEPIPVIPT HY MGGIPT + GQ +  N    + +V GL
Sbjct: 324 ESRLPGILELSRTFAHVDPVKEPIPVIPTCHYMMGGIPTKVTGQALTVNEKGEDVVVPGL 383
Query: 363 YAIGECACVSVHGANRLGTNSLLDLLVFGRSAGNHILSLELKKIHNKKLPINSIDIIIDR 422
           +A+GE ACVSVHGANRLG NSLLDL+VFGR+AG H+     ++   +    + ++  +DR
Sbjct: 384 FAVGEIACVSVHGANRLGGNSLLDLVVFGRAAGLHLQESIAEQGALRDASESDVEASLDR 443
Query: 423 LSKLENNKGSESVQSVANDIRKTMQNYCGVFRTDKLMKNGYKKIMILDERRKYISFKDKS 482
           L++  NN+  E   ++   +++ MQ+   VFR    M  G +++ ++ ER K     D S
Sbjct: 444 LNRWNNNRNGEDPVAIRKALQECMQHNFSVFREGDAMAKGLEQLKVIRERLKNARLDDTS 503
Query: 483 KIFNTARIEALELDNLIETAKATISSAISRKESRGAHAHNDFKNRDDINWLKHSIWYSNG 542
             FNT R+E LELDNL+ETA AT  SA  R ESRGAH+  DF +RDD NWL HS++    
Sbjct: 504 SEFNTQRVECLELDNLMETAYATAVSANFRTESRGAHSRFDFPDRDDENWLCHSLYLPES 563
Query: 543 NRIEFKPVNLKPLTVKTVHPK 563
             +  + VN++P       PK
Sbjct: 564 ESMTRRSVNMEPKLRPAFPPK 584
>pdb|1ZOY|A Chain A, Crystal Structure Of Mitochondrial Respiratory Complex Ii From Porcine Heart At 2.4 Angstroms Length = 622 Back     alignment and structure
>pdb|1YQ3|A Chain A, Avian Respiratory Complex Ii With Oxaloacetate And Ubiquinone Length = 621 Back     alignment and structure
>pdb|3VR8|A Chain A, Mitochondrial Rhodoquinol-Fumarate Reductase From The Parasitic Nematode Ascaris Suum Length = 645 Back     alignment and structure
>pdb|2B76|A Chain A, E. Coli Quinol Fumarate Reductase Frda E49q Mutation Length = 602 Back     alignment and structure
>pdb|3P4R|A Chain A, Crystal Structure Of Menaquinol:fumarate Oxidoreductase In Complex With Glutarate Length = 577 Back     alignment and structure
>pdb|1KF6|A Chain A, E. Coli Quinol-Fumarate Reductase With Bound Inhibitor Hqno Length = 602 Back     alignment and structure
>pdb|3CIR|A Chain A, E. Coli Quinol Fumarate Reductase Frda T234a Mutation Length = 602 Back     alignment and structure
>pdb|2BS2|A Chain A, Quinol:fumarate Reductase From Wolinella Succinogenes Length = 660 Back     alignment and structure
>pdb|1QLB|A Chain A, Respiratory Complex Ii-Like Fumarate Reductase From Wolinella Succinogenes Length = 656 Back     alignment and structure
>pdb|1E7P|A Chain A, Quinol:fumarate Reductase From Wolinella Succinogenes Length = 656 Back     alignment and structure
>pdb|1NEK|B Chain B, Complex Ii (Succinate Dehydrogenase) From E. Coli With Ubiquinone Bound Length = 238 Back     alignment and structure
>pdb|2WP9|B Chain B, Crystal Structure Of The E. Coli Succinate:quinone Oxidoreductase (Sqr) Sdhb His207thr Mutant Length = 238 Back     alignment and structure
>pdb|1YQ3|B Chain B, Avian Respiratory Complex Ii With Oxaloacetate And Ubiquinone Length = 252 Back     alignment and structure
>pdb|1ZOY|B Chain B, Crystal Structure Of Mitochondrial Respiratory Complex Ii From Porcine Heart At 2.4 Angstroms Length = 252 Back     alignment and structure
>pdb|3ABV|B Chain B, Crystal Structure Of Porcine Heart Mitochondrial Complex Ii Bound With N-Biphenyl-3-Yl-2-Trifluoromethyl-Benzamide Length = 252 Back     alignment and structure
>pdb|3VR8|B Chain B, Mitochondrial Rhodoquinol-Fumarate Reductase From The Parasitic Nematode Ascaris Suum Length = 282 Back     alignment and structure
>pdb|1CHU|A Chain A, Structure Of L-Aspartate Oxidase: Implications For The Succinate Dehydrogenase FUMARATE REDUCATSE FAMILY Length = 540 Back     alignment and structure
>pdb|1KNP|A Chain A, E. Coli L-aspartate Oxidase: Mutant R386l In Complex With Succinate Length = 540 Back     alignment and structure
>pdb|2E5V|A Chain A, Crystal Structure Of L-Aspartate Oxidase From Hyperthermophilic Archaeon Sulfolobus Tokodaii Length = 472 Back     alignment and structure
>pdb|1KF6|B Chain B, E. Coli Quinol-Fumarate Reductase With Bound Inhibitor Hqno Length = 243 Back     alignment and structure
>pdb|1KSU|A Chain A, Crystal Structure Of His505tyr Mutant Flavocytochrome C3 From Shewanella Frigidimarina Length = 571 Back     alignment and structure
>pdb|1Q9I|A Chain A, The A251c:s430c Double Mutant Of Flavocytochrome C3 From Shewanella Frigidimarina Length = 571 Back     alignment and structure
>pdb|1P2H|A Chain A, H61m Mutant Of Flavocytochrome C3 Length = 571 Back     alignment and structure
>pdb|1P2E|A Chain A, H61a Mutant Of Flavocytochrome C3 Length = 571 Back     alignment and structure
>pdb|1QJD|A Chain A, Flavocytochrome C3 From Shewanella Frigidimarina Length = 571 Back     alignment and structure
>pdb|1JRY|A Chain A, Crystal Structure Of Arg402lys Mutant Flavocytochrome C3 From Shewanella Frigidimarina Length = 571 Back     alignment and structure
>pdb|1JRX|A Chain A, Crystal Structure Of Arg402ala Mutant Flavocytochrome C3 From Shewanella Frigidimarina Length = 571 Back     alignment and structure
>pdb|1JRZ|A Chain A, Crystal Structure Of Arg402tyr Mutant Flavocytochrome C3 From Shewanella Frigidimarina Length = 571 Back     alignment and structure
>pdb|1KSS|A Chain A, Crystal Structure Of His505ala Mutant Flavocytochrome C3 From Shewanella Frigidimarina Length = 571 Back     alignment and structure
>pdb|2B7S|A Chain A, R381k Mutant Of Flavocytochrome C3 Length = 571 Back     alignment and structure
>pdb|2B7R|A Chain A, Structure Of E378d Mutant Flavocytochrome C3 Length = 571 Back     alignment and structure
>pdb|1M64|A Chain A, Crystal Structure Of Q363f Mutant Flavocytochrome C3 Length = 571 Back     alignment and structure
>pdb|1LJ1|A Chain A, Crystal Structure Of Q363fR402A MUTANT FLAVOCYTOCHROME C3 Length = 571 Back     alignment and structure
>pdb|1E39|A Chain A, Flavocytochrome C3 From Shewanella Frigidimarina Histidine 365 Mutated To Alanine Length = 571 Back     alignment and structure
>pdb|1QO8|A Chain A, The Structure Of The Open Conformation Of A Flavocytochrome C3 Fumarate Reductase Length = 566 Back     alignment and structure
>pdb|1D4C|A Chain A, Crystal Structure Of The Uncomplexed Form Of The Flavocytochrome C Fumarate Reductase Of Shewanella Putrefaciens Strain Mr-1 Length = 572 Back     alignment and structure
>pdb|2BS2|B Chain B, Quinol:fumarate Reductase From Wolinella Succinogenes Length = 241 Back     alignment and structure
>pdb|1QLB|B Chain B, Respiratory Complex Ii-Like Fumarate Reductase From Wolinella Succinogenes Length = 239 Back     alignment and structure
>pdb|1D4D|A Chain A, Crystal Structure Of The Succinate Complexed Form Of The Flavocytochrome C Fumarate Reductase Of Shewanella Putrefaciens Strain Mr-1 Length = 572 Back     alignment and structure
>pdb|1JNR|A Chain A, Structure Of Adenylylsulfate Reductase From The Hyperthermophilic Archaeoglobus Fulgidus At 1.6 Resolution Length = 643 Back     alignment and structure
>pdb|2FJA|A Chain A, Adenosine 5'-Phosphosulfate Reductase In Complex With Substrate Length = 643 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query786
2wdq_A588 Succinate dehydrogenase flavoprotein subunit; succ 0.0
2h88_A621 Succinate dehydrogenase flavoprotein subunit; comp 0.0
2bs2_A660 Quinol-fumarate reductase flavoprotein subunit A; 0.0
1kf6_A602 Fumarate reductase flavoprotein; respiration, fuma 0.0
1jnr_A643 Adenylylsulfate reductase; oxidoreductase; HET: FA 0.0
3gyx_A662 Adenylylsulfate reductase; oxidoreductase; HET: FA 0.0
2e5v_A472 L-aspartate oxidase; archaea, oxidoreductase; HET: 1e-157
1chu_A540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 1e-156
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 1e-148
1kf6_B243 Fumarate reductase iron-sulfur protein; respiratio 1e-125
2wdq_B238 Succinate dehydrogenase iron-sulfur subunit; succi 1e-123
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 1e-122
2bs2_B241 Quinol-fumarate reductase iron-sulfur subunit B; 2 1e-120
3vr8_B282 Iron-sulfur subunit of succinate dehydrogenase; me 1e-116
2h88_B252 Succinate dehydrogenase IP subunit; complex II, me 1e-114
1qo8_A566 Flavocytochrome C3 fumarate reductase; oxidoreduct 2e-78
3kwl_A 514 Uncharacterized protein; putative oxidoreductase, 2e-50
4at0_A510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 5e-47
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-06
2lfc_A160 Fumarate reductase, flavoprotein subunit; structur 8e-07
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Length = 588 Back     alignment and structure
 Score =  962 bits (2490), Expect = 0.0
 Identities = 307/566 (54%), Positives = 400/566 (70%), Gaps = 2/566 (0%)

Query: 1   MRASLQLAQEGLNVAILSKVFPTRSHTVAAQGGISASLGNMSKDNWHWHMFDTIKGSDYL 60
           MRA+LQ++Q G   A+LSKVFPTRSHTV+AQGGI+ +LGN  +DNW WHM+DT+KGSDY+
Sbjct: 20  MRAALQISQSGQTCALLSKVFPTRSHTVSAQGGITVALGNTHEDNWEWHMYDTVKGSDYI 79

Query: 61  GDQDAIEFMCKEAPKVVYELEHFGMPFDRNKNGTIYQRPFGGHSSNFGEKPIARACAVAD 120
           GDQDAIE+MCK  P+ + ELEH G+PF R  +G IYQRPFGG S NFG +  AR  A AD
Sbjct: 80  GDQDAIEYMCKTGPEAILELEHMGLPFSRLDDGRIYQRPFGGQSKNFGGEQAARTAAAAD 139

Query: 121 RTGHALLHTLYQRNLHAKTNFFIEWMAIDLISDSEGDILGVVALEMETGNIMILESKITI 180
           RTGHALLHTLYQ+NL   T  F EW A+DL+ + +G ++G  AL +ETG ++  +++ T+
Sbjct: 140 RTGHALLHTLYQQNLKNHTTIFSEWYALDLVKNQDGAVVGCTALCIETGEVVYFKARATV 199

Query: 181 LATGGGGRIWAASTNAFINTGDGLGMAARAGLPLEDMEFWQFHPTGVAGAGVLITEGVRG 240
           LATGG GRI+ ++TNA INTGDG+GMA RAG+P++DME WQFHPTG+AGAGVL+TEG RG
Sbjct: 200 LATGGAGRIYQSTTNAHINTGDGVGMAIRAGVPVQDMEMWQFHPTGIAGAGVLVTEGCRG 259

Query: 241 EGGILINSNGERFMERYAPILKDLAPRDFVSRAMDQEIKEGRGC-GPNKDHVMLDLRHIN 299
           EGG L+N +GERFMERYAP  KDLA RD V+R++  EI+EGRGC GP   H  L L H+ 
Sbjct: 260 EGGYLLNKHGERFMERYAPNAKDLAGRDVVARSIMIEIREGRGCDGPWGPHAKLKLDHLG 319

Query: 300 SETIINRLPSILEIGNKFANVNALKEPIPVIPTIHYQMGGIPTNIYGQVIIPN-NDNNKI 358
            E + +RLP ILE+   FA+V+ +KEPIPVIPT HY MGGIPT + GQ +  N    + +
Sbjct: 320 KEVLESRLPGILELSRTFAHVDPVKEPIPVIPTCHYMMGGIPTKVTGQALTVNEKGEDVV 379

Query: 359 VNGLYAIGECACVSVHGANRLGTNSLLDLLVFGRSAGNHILSLELKKIHNKKLPINSIDI 418
           V GL+A+GE ACVSVHGANRLG NSLLDL+VFGR+AG H+     ++   +    + ++ 
Sbjct: 380 VPGLFAVGEIACVSVHGANRLGGNSLLDLVVFGRAAGLHLQESIAEQGALRDASESDVEA 439

Query: 419 IIDRLSKLENNKGSESVQSVANDIRKTMQNYCGVFRTDKLMKNGYKKIMILDERRKYISF 478
            +DRL++  NN+  E   ++   +++ MQ+   VFR    M  G +++ ++ ER K    
Sbjct: 440 SLDRLNRWNNNRNGEDPVAIRKALQECMQHNFSVFREGDAMAKGLEQLKVIRERLKNARL 499

Query: 479 KDKSKIFNTARIEALELDNLIETAKATISSAISRKESRGAHAHNDFKNRDDINWLKHSIW 538
            D S  FNT R+E LELDNL+ETA AT  SA  R ESRGAH+  DF +RDD NWL HS++
Sbjct: 500 DDTSSEFNTQRVECLELDNLMETAYATAVSANFRTESRGAHSRFDFPDRDDENWLCHSLY 559

Query: 539 YSNGNRIEFKPVNLKPLTVKTVHPKK 564
                 +  + VN++P       PK 
Sbjct: 560 LPESESMTRRSVNMEPKLRPAFPPKI 585
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Length = 621 Back     alignment and structure
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Length = 660 Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Length = 602 Back     alignment and structure
>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* Length = 643 Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Length = 662 Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Length = 472 Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Length = 540 Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Length = 571 Back     alignment and structure
>1kf6_B Fumarate reductase iron-sulfur protein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.1.2.1 d.15.4.2 PDB: 1kfy_B* 1l0v_B* 2b76_B* 3cir_B* 3p4p_B* 3p4q_B* 3p4r_B* 3p4s_B* Length = 243 Back     alignment and structure
>2wdq_B Succinate dehydrogenase iron-sulfur subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_B* 2acz_B* 1nek_B* 2wdr_B* 2wdv_B* 2ws3_B* 2wu2_B* 2wu5_B* 2wp9_B* Length = 238 Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Length = 572 Back     alignment and structure
>2bs2_B Quinol-fumarate reductase iron-sulfur subunit B; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.1.2.1 d.15.4.2 PDB: 2bs3_B* 1e7p_B* 1qlb_B* 2bs4_B* Length = 241 Back     alignment and structure
>3vr8_B Iron-sulfur subunit of succinate dehydrogenase; membrane protein, reductase, mitochondria MEMB oxidoreductase; HET: FAD HEM RQX EPH; 2.81A {Ascaris suum} PDB: 3vrb_B* Length = 282 Back     alignment and structure
>2h88_B Succinate dehydrogenase IP subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_B* 1yq3_B* 2fbw_B* 2h89_B* 2wqy_B* 3aef_B* 3abv_B* 3ae1_B* 3ae3_B* 3ae2_B* 3ae5_B* 3ae6_B* 3ae7_B* 3ae8_B* 3ae9_B* 3aea_B* 3aeb_B* 3aec_B* 3aed_B* 3aee_B* ... Length = 252 Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Length = 566 Back     alignment and structure
>3kwl_A Uncharacterized protein; putative oxidoreductase, multidomain, unknown function; 1.94A {Helicobacter pylori} Length = 514 Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Length = 510 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2lfc_A Fumarate reductase, flavoprotein subunit; structural genomics, northeast structural genomics consortiu PSI-biology; NMR {Lactobacillus plantarum} Length = 160 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query786
2h88_A621 Succinate dehydrogenase flavoprotein subunit; comp 100.0
2bs2_A660 Quinol-fumarate reductase flavoprotein subunit A; 100.0
2wdq_A588 Succinate dehydrogenase flavoprotein subunit; succ 100.0
1kf6_A602 Fumarate reductase flavoprotein; respiration, fuma 100.0
1chu_A540 Protein (L-aspartate oxidase); flavoenzyme, NAD bi 100.0
3gyx_A662 Adenylylsulfate reductase; oxidoreductase; HET: FA 100.0
1jnr_A643 Adenylylsulfate reductase; oxidoreductase; HET: FA 100.0
2e5v_A472 L-aspartate oxidase; archaea, oxidoreductase; HET: 100.0
1y0p_A571 Fumarate reductase flavoprotein subunit; flavocyto 100.0
1d4d_A572 Flavocytochrome C fumarate reductase; oxidoreducta 100.0
1qo8_A566 Flavocytochrome C3 fumarate reductase; oxidoreduct 100.0
4at0_A510 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidore 100.0
3vr8_B282 Iron-sulfur subunit of succinate dehydrogenase; me 100.0
2h88_B252 Succinate dehydrogenase IP subunit; complex II, me 100.0
2bs2_B241 Quinol-fumarate reductase iron-sulfur subunit B; 2 100.0
2wdq_B238 Succinate dehydrogenase iron-sulfur subunit; succi 100.0
1kf6_B243 Fumarate reductase iron-sulfur protein; respiratio 100.0
2i0z_A447 NAD(FAD)-utilizing dehydrogenases; structural geno 99.97
3kwl_A 514 Uncharacterized protein; putative oxidoreductase, 99.96
2gqf_A401 Hypothetical protein HI0933; structural genomics, 99.87
3v76_A417 Flavoprotein; structural genomics, PSI-biology, NE 99.81
3i9v_3 783 NADH-quinone oxidoreductase subunit 3; electron tr 99.66
1rm6_C161 4-hydroxybenzoyl-COA reductase gamma subunit; xant 99.62
1t3q_A168 Quinoline 2-oxidoreductase small subunit; QOR, mol 99.61
3c8y_A 574 Iron hydrogenase 1; dithiomethylether, H-cluster, 99.58
3cp8_A641 TRNA uridine 5-carboxymethylaminomethyl modificati 99.45
3nlc_A549 Uncharacterized protein VP0956; FAD-binding protei 99.25
1ffv_A163 CUTS, iron-sulfur protein of carbon monoxide dehyd 99.22
1n62_A166 Carbon monoxide dehydrogenase small chain; CODH, m 99.18
2zxi_A637 TRNA uridine 5-carboxymethylaminomethyl modificat 99.17
3ces_A651 MNMG, tRNA uridine 5-carboxymethylaminomethyl modi 99.11
4b1b_A542 TRXR, thioredoxin reductase; oxidoreductase, FAD, 98.74
3hrd_D160 Nicotinate dehydrogenase small FES subunit; seleni 98.71
3cf4_A 807 Acetyl-COA decarboxylase/synthase alpha subunit; m 98.66
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 98.65
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 98.64
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 98.6
3oz2_A397 Digeranylgeranylglycerophospholipid reductase; str 98.54
4fk1_A304 Putative thioredoxin reductase; structural genomic 98.53
3qfa_A519 Thioredoxin reductase 1, cytoplasmic; protein-prot 98.53
3dme_A369 Conserved exported protein; structural genomics, P 98.53
1y56_B382 Sarcosine oxidase; dehydrogenase, protein-protein 98.52
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 98.51
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 98.49
1ojt_A482 Surface protein; redox-active center, glycolysis, 98.49
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 98.47
3ps9_A676 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 98.47
3da1_A561 Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9 98.44
3lad_A476 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 98.43
2gag_B405 Heterotetrameric sarcosine oxidase beta-subunit; f 98.42
1rp0_A284 ARA6, thiazole biosynthetic enzyme; protein ligand 98.42
3jsk_A344 Cypbp37 protein; octameric thiazole synthase, bios 98.4
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 98.38
2a8x_A464 Dihydrolipoyl dehydrogenase, E3 component of alpha 98.36
2rgh_A571 Alpha-glycerophosphate oxidase; flavoprotein oxida 98.34
1ebd_A455 E3BD, dihydrolipoamide dehydrogenase; redox-active 98.33
1vlb_A 907 Aldehyde oxidoreductase; iron-sulphur cluster; HET 98.33
3pvc_A689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 98.32
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 98.3
4dna_A463 Probable glutathione reductase; structural genomic 98.29
1ryi_A382 Glycine oxidase; flavoprotein, protein-inhibitor c 98.29
3dje_A438 Fructosyl amine: oxygen oxidoreductase; fructosyl- 98.28
2qae_A468 Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystin 98.27
4a9w_A357 Monooxygenase; baeyer-villiger, FAD, oxidoreductas 98.25
1frr_A95 Ferredoxin I; electron transfer(iron-sulfur protei 98.25
3nyc_A381 D-arginine dehydrogenase; FAD, imino-arginine, oxi 98.24
3axb_A448 Putative oxidoreductase; dinucleotide-binding fold 98.24
2qcu_A501 Aerobic glycerol-3-phosphate dehydrogenase; glycer 98.22
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 98.21
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 98.21
1frd_A98 Heterocyst [2Fe-2S] ferredoxin; electron transport 98.2
1dgj_A 907 Aldehyde oxidoreductase; beta half-barrel, four-he 98.2
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 98.2
2gjc_A326 Thiazole biosynthetic enzyme, mitochondrial; gluta 98.18
3l8k_A466 Dihydrolipoyl dehydrogenase; redox-active center, 98.16
3nix_A421 Flavoprotein/dehydrogenase; structural genomics, P 98.14
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 98.14
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 98.14
2w3s_A 462 Xanthine dehydrogenase; XO, XDH, GOUT, iron, 2Fe-2 98.09
1onf_A500 GR, grase, glutathione reductase; oxidoreductase; 98.09
1xdi_A499 RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno fun 98.06
1awd_A94 Ferredoxin; electron transport, eukaryotic, green 98.06
1pj5_A830 N,N-dimethylglycine oxidase; channelling, FAD bind 98.05
2gf3_A389 MSOX, monomeric sarcosine oxidase; flavoprotein ox 98.05
3ic9_A492 Dihydrolipoamide dehydrogenase; APC62701, colwelli 98.04
1fec_A490 Trypanothione reductase; redox-active center, oxid 98.03
2oln_A397 NIKD protein; flavoprotein, rossmann fold, oxidore 98.02
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 98.0
2uzz_A372 N-methyl-L-tryptophan oxidase; N-methyltryptophan 98.0
1a70_A97 Ferredoxin; iron-sulfur protein, photosynthesis, e 98.0
1iue_A98 Ferredoxin; electron transport, iron-sulfur; 1.70A 97.99
2eq6_A464 Pyruvate dehydrogenase complex, dihydrolipoamide d 97.99
1czp_A98 Ferredoxin I; [2Fe-2S] protein, crystal reduced wi 97.96
3c4n_A405 Uncharacterized protein DR_0571; alpha-beta protei 97.95
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 97.95
2r9z_A463 Glutathione amide reductase; NAD, FAD, substrate s 97.95
3qvp_A583 Glucose oxidase; oxidoreductase; HET: NAG BMA MAN 97.92
1jq4_A98 Methane monooxygenase component C; [2Fe-2S] ferred 97.92
3atr_A453 Conserved archaeal protein; saturating double bond 97.89
3cgv_A397 Geranylgeranyl reductase related protein; NP_39399 97.89
1l5p_A93 Ferredoxin; [2Fe-2S] cluster, electron transfer, i 97.86
3e1t_A512 Halogenase; flavoprotein; HET: FAD; 2.05A {Chondro 97.86
3nvw_A164 Xanthine dehydrogenase/oxidase; hydroxylase, homod 97.83
1ges_A450 Glutathione reductase; oxidoreductase(flavoenzyme) 97.76
2wlb_A103 ETP1-FD, electron transfer protein 1, mitochondria 97.74
2gmh_A584 Electron transfer flavoprotein-ubiquinone oxidored 97.74
1wri_A93 Ferredoxin II, ferredoxin; electron transport; 1.2 97.72
3q9t_A577 Choline dehydrogenase and related flavoproteins; g 97.65
2yqu_A455 2-oxoglutarate dehydrogenase E3 component; lipoami 97.64
3g3e_A351 D-amino-acid oxidase; FAD, flavoprotein, oxidoredu 97.61
1xlq_A106 Putidaredoxin, PDX; [2Fe-2S], ferredoxin, oxidored 97.61
3lxf_A104 Ferredoxin; iron, iron-sulfur, metal-binding, meta 97.54
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 97.54
3ah7_A113 [2Fe-2S]ferredoxin; [2Fe-2S] cluster, iron-sulfur 97.54
1b9r_A105 Protein (terpredoxin); structure from molmol, ferr 97.54
2fdn_A55 Ferredoxin; electron transport, iron-sulfur, 4Fe-4 97.52
4eqs_A437 Coenzyme A disulfide reductase; oxidoreductase; HE 97.51
1i7h_A111 Ferredoxin; 2Fe-2S,electron transport; 1.70A {Esch 97.5
2bt6_A108 Adrenodoxin 1; ruthenium(II) bipyridyl complex, in 97.5
1zk7_A467 HGII, reductase, mercuric reductase; mercuric ION 97.49
1jb0_C80 Photosystem I iron-sulfur center; membrane protein 97.49
1doi_A128 2Fe-2S ferredoxin; halophilic protein, redox prote 97.49
1rgv_A80 Ferredoxin; electron transport; 2.90A {Thauera aro 97.44
3hui_A126 Ferredoxin; cytochrome P450, electron transfer, ir 97.43
3i9v_9182 NADH-quinone oxidoreductase subunit 9; electron tr 97.43
1uwm_A106 Ferredoxin VI, FDVI; electron transport, metal-bin 97.42
1c0p_A363 D-amino acid oxidase; alpha-beta-alpha motif, flav 97.41
2y5c_A109 Adrenodoxin-like protein, mitochondrial; electron 97.41
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 97.4
2zvs_A85 Uncharacterized ferredoxin-like protein YFHL; elec 97.4
1xer_A103 Ferredoxin; electron transport, iron-sulfur, dupli 97.39
2fgo_A82 Ferredoxin; allochromatium vinosum, [4Fe-4S] clust 97.38
3ihg_A535 RDME; flavoenzyme, anthracycline, polyketide biosy 97.34
3i3l_A591 Alkylhalidase CMLS; flavin-dependent halogenase, c 97.32
1rof_A60 Ferredoxin; electron transport, iron-sulfur; NMR { 97.32
2ywl_A180 Thioredoxin reductase related protein; uncharacter 97.28
1bc6_A77 7-Fe ferredoxin; electron transport, iron-sulfur; 97.27
1hfe_L 421 Protein (Fe-only hydrogenase (E.C.1.18.99.1) (larg 97.25
3ka7_A425 Oxidoreductase; structural genomics, PSI-2, protei 97.25
3eun_A82 Ferredoxin; electron transport, [4Fe-4S] cluster, 97.23
1krh_A338 Benzoate 1,2-dioxygenase reductase; alpha-beta, FA 97.23
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 97.23
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 97.23
3fim_B566 ARYL-alcohol oxidase; AAO, lignin degradation, oxi 97.22
7fd1_A106 FD1, protein (7-Fe ferredoxin I); electron transpo 97.2
3fmw_A570 Oxygenase; mithramycin, baeyer-villiger, flavin bi 97.12
1dwl_A59 Ferredoxin I; electron transfer, model, heteronucl 97.09
2bry_A497 NEDD9 interacting protein with calponin homology a 97.08
3ics_A588 Coenzyme A-disulfide reductase; pyridine nucleotid 97.05
1k0i_A394 P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, h 97.02
1f2g_A58 Ferredoxin II; electron transport, FDII desulfovib 97.0
4a5l_A314 Thioredoxin reductase; oxidoreductase, redox metab 96.98
1dax_A64 Ferredoxin I; electron transport, electron-transfe 96.95
1h98_A78 Ferredoxin; electron transport, thermophilic, iron 96.93
2x3n_A399 Probable FAD-dependent monooxygenase; oxidoreducta 96.88
2c42_A 1231 Pyruvate-ferredoxin oxidoreductase; 4Fe-4S, iron, 96.87
2qa2_A499 CABE, polyketide oxygenase CABE; FAD, angucycline, 96.85
3c96_A410 Flavin-containing monooxygenase; FAD, oxidoreducta 96.84
3n9z_C123 Adrenodoxin; cytochrome P450, 22-hydroxycholestero 96.81
2v2k_A105 Ferredoxin; iron, transport, iron-sulfur, mycobact 96.79
2weu_A511 Tryptophan 5-halogenase; regioselectivity, antifun 96.75
2r0c_A549 REBC; flavin adenine dinucleotide, monooxygenase, 96.73
1iqz_A81 Ferredoxin; iron-sulfer protein, ultlahigh resolut 96.73
3fpz_A326 Thiazole biosynthetic enzyme; FAD, mitochondrion, 96.72
3nrn_A421 Uncharacterized protein PF1083; alpha-beta protein 96.72
3gyx_B166 Adenylylsulfate reductase; oxidoreductase; HET: FA 96.71
2qa1_A500 PGAE, polyketide oxygenase PGAE; FAD, angucycline, 96.7
1jnr_B150 Adenylylsulfate reductase; oxidoreductase; HET: FA 96.68
2lfc_A160 Fumarate reductase, flavoprotein subunit; structur 96.62
3iwa_A472 FAD-dependent pyridine nucleotide-disulphide oxido 96.62
2aqj_A538 Tryptophan halogenase, pRNA; flavin-dependent halo 96.6
1sj1_A66 Ferredoxin; thermostability, iron-sulfur cluster, 96.56
2e4g_A550 Tryptophan halogenase; flavin-binding, rebeccamyci 96.43
2pyx_A526 Tryptophan halogenase; structural genomics, JOI fo 96.29
1yvv_A336 Amine oxidase, flavin-containing; oxidoreductase, 96.24
2vou_A397 2,6-dihydroxypyridine hydroxylase; oxidoreductase, 96.17
3qj4_A342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 96.12
3alj_A379 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; 96.09
2dkh_A639 3-hydroxybenzoate hydroxylase; flavoprotein, monoo 95.99
1ti6_B274 Pyrogallol hydroxytransferase small subunit; molyb 95.96
2ivf_B352 Ethylbenzene dehydrogenase beta-subunit; anaerobic 95.96
3r9u_A315 Thioredoxin reductase; structural genomics, center 95.95
1q16_B 512 Respiratory nitrate reductase 1 beta chain; membra 95.89
3rp8_A407 Flavoprotein monooxygenase; FAD-binding protein, o 95.88
2pia_A321 Phthalate dioxygenase reductase; HET: FMN; 2.00A { 95.86
3t37_A526 Probable dehydrogenase; BET alpha beta fold, ADP b 95.62
2ivf_B 352 Ethylbenzene dehydrogenase beta-subunit; anaerobic 95.54
1kqf_B294 FDH-N beta S, formate dehydrogenase, nitrate-induc 95.51
2xve_A464 Flavin-containing monooxygenase; oxidoreductase; H 95.46
1gte_A 1025 Dihydropyrimidine dehydrogenase; electron transfer 95.42
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 95.41
4dgk_A501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 95.37
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 95.34
1y56_A 493 Hypothetical protein PH1363; dehydrogenase, protei 95.32
3zyy_X 631 Iron-sulfur cluster binding protein; iron-sulfur-b 95.3
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 95.2
3gwf_A540 Cyclohexanone monooxygenase; flavoprotein biocatal 95.17
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 95.1
2vpz_B195 NRFC protein; oxidoreductase, molybdopterin guanin 95.02
1n4w_A504 CHOD, cholesterol oxidase; flavoenzyme, steroid me 95.01
2cul_A232 Glucose-inhibited division protein A-related PROT 94.87
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 94.77
1gpe_A587 Protein (glucose oxidase); oxidoreductase(flavopro 94.73
2xdo_A398 TETX2 protein; tetracycline degradation, tigecycli 94.7
2vpz_B195 NRFC protein; oxidoreductase, molybdopterin guanin 94.65
2vdc_G456 Glutamate synthase [NADPH] small chain; oxidoreduc 94.63
2jbv_A546 Choline oxidase; alcohol oxidation, flavoenyzme ox 94.6
4ap3_A549 Steroid monooxygenase; oxidoreductase, baeyer-vill 94.56
1q16_B 512 Respiratory nitrate reductase 1 beta chain; membra 94.55
1h0h_B214 Formate dehydrogenase (small subunit); tungsten se 94.47
3p1w_A475 Rabgdi protein; GDI RAB, malaria, structural genom 94.41
1coy_A507 Cholesterol oxidase; oxidoreductase(oxygen recepto 94.4
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 94.39
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 94.34
1kqf_B 294 FDH-N beta S, formate dehydrogenase, nitrate-induc 94.28
2a87_A335 TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TL 94.24
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 94.14
3kd9_A449 Coenzyme A disulfide reductase; PSI-II, NYSGXRC, o 94.09
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 94.07
3fbs_A297 Oxidoreductase; structural genomics, PSI2, MCSG, p 94.06
3unc_A 1332 Xanthine dehydrogenase/oxidase; oxidoreductase; HE 94.04
1w4x_A542 Phenylacetone monooxygenase; baeyer-villiger, FAD; 93.86
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 93.82
3uox_A545 Otemo; baeyer-villiger monooxygenase, oxidoreducta 93.77
4gcm_A312 TRXR, thioredoxin reductase; FAD/NAD-linked reduct 93.68
1trb_A320 Thioredoxin reductase; oxidoreductase(flavoenzyme) 93.66
3cty_A319 Thioredoxin reductase; FAD, oxidoreductase, flavin 93.55
4gut_A776 Lysine-specific histone demethylase 1B; histone de 93.28
1ti6_B 274 Pyrogallol hydroxytransferase small subunit; molyb 93.2
1ju2_A536 HydroxynitrIle lyase; flavin, GMC oxidoreductase, 93.14
1kdg_A546 CDH, cellobiose dehydrogenase; GMC oxidoreductase, 93.11
3k7m_X431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 93.1
3g5s_A443 Methylenetetrahydrofolate--tRNA-(uracil-5-)- methy 92.89
3klj_A385 NAD(FAD)-dependent dehydrogenase, NIRB-family (N- 92.85
1cjc_A460 Protein (adrenodoxin reductase); flavoenzyme, MAD 92.76
3itj_A338 Thioredoxin reductase 1; disulfide B flavoprotein, 92.72
1xhc_A367 NADH oxidase /nitrite reductase; southe collaborat 92.42
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 92.27
1fl2_A310 Alkyl hydroperoxide reductase subunit F; reactive 92.21
3sx6_A437 Sulfide-quinone reductase, putative; sulfide:quino 92.13
1pn0_A665 Phenol 2-monooxygenase; two dimers, TLS refinement 92.03
3pl8_A623 Pyranose 2-oxidase; substrate complex, H167A mutan 91.86
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 91.84
3vrd_B401 FCCB subunit, flavocytochrome C flavin subunit; su 91.68
3zyv_A 1335 AOH1; oxidoreductase, molybdenum cofactor; HET: MT 91.68
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 91.58
3fg2_P404 Putative rubredoxin reductase; ferredoxin reductas 91.41
3h28_A430 Sulfide-quinone reductase; monotopic membrane prot 91.38
2bcg_G453 Secretory pathway GDP dissociation inhibitor; RABG 91.07
4gde_A513 UDP-galactopyranose mutase; flavin adenine dinucle 90.78
2gmh_A584 Electron transfer flavoprotein-ubiquinone oxidored 90.75
1d5t_A433 Guanine nucleotide dissociation inhibitor; ultra-h 90.71
2x8g_A598 Thioredoxin glutathione reductase; redox-active ce 90.69
1lqt_A456 FPRA; NADP+ derivative, oxidoreductase, structural 90.68
3ntd_A565 FAD-dependent pyridine nucleotide-disulphide oxido 90.6
1h0h_B214 Formate dehydrogenase (small subunit); tungsten se 90.53
2gqw_A408 Ferredoxin reductase; flavoprotein, oxidoreductase 90.48
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 90.46
3cgb_A480 Pyridine nucleotide-disulfide oxidoreductase, CLA; 90.45
2bc0_A490 NADH oxidase; flavoprotein, pyridine nucleotide di 90.09
3h8l_A409 NADH oxidase; membrane protein, complete form, ros 90.04
2v3a_A384 Rubredoxin reductase; alkane degradation, NADH oxi 89.95
1mo9_A523 ORF3; nucleotide binding motifs, nucleotide bindin 89.84
3r9u_A315 Thioredoxin reductase; structural genomics, center 89.5
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 89.46
3mm5_A418 Sulfite reductase, dissimilatory-type subunit ALP; 89.2
3mm5_B366 Sulfite reductase, dissimilatory-type subunit BET; 89.18
4hb9_A412 Similarities with probable monooxygenase; flavin, 88.95
3hyw_A430 Sulfide-quinone reductase; monotopic membrane prot 88.92
1gte_A1025 Dihydropyrimidine dehydrogenase; electron transfer 88.85
3ab1_A360 Ferredoxin--NADP reductase; oxidoreductase, electr 88.81
1m6i_A493 Programmed cell death protein 8; apoptosis, AIF, o 88.65
2zbw_A335 Thioredoxin reductase; redox protein, oxidoreducta 88.23
1nhp_A447 NADH peroxidase; oxidoreductase (H2O2(A)); HET: FA 87.91
2q7v_A325 Thioredoxin reductase; rossman fold, FAD, flavopro 87.89
2cul_A232 Glucose-inhibited division protein A-related PROT 87.7
3dgh_A483 TRXR-1, thioredoxin reductase 1, mitochondrial; ox 87.68
3f8d_A323 Thioredoxin reductase (TRXB-3); redox protein, nuc 87.59
2q0l_A311 TRXR, thioredoxin reductase; bacterial thiredoxin 87.54
1hyu_A521 AHPF, alkyl hydroperoxide reductase subunit F; thi 87.0
1v59_A478 Dihydrolipoamide dehydrogenase; 2-oxoacid dehydrog 86.98
4g6h_A502 Rotenone-insensitive NADH-ubiquinone oxidoreducta 86.79
3lzw_A332 Ferredoxin--NADP reductase 2; ferredoxin reductase 86.44
1vdc_A333 NTR, NADPH dependent thioredoxin reductase; hypoth 86.36
3oc4_A452 Oxidoreductase, pyridine nucleotide-disulfide FAM; 86.32
3dgz_A488 Thioredoxin reductase 2; oxidoreductase, rossmann, 86.13
1lvl_A458 Dihydrolipoamide dehydrogenase; oxidoreductase; HE 85.37
1q1r_A431 Putidaredoxin reductase; glutathione reductase fol 85.31
1vg0_A650 RAB proteins geranylgeranyltransferase component A 85.26
3o0h_A484 Glutathione reductase; ssgcid, structur genomics, 85.05
2gv8_A447 Monooxygenase; FMO, FAD, NADPH, cofactor complex, 84.68
3nks_A477 Protoporphyrinogen oxidase; FAD containing protein 84.6
1zmd_A474 Dihydrolipoyl dehydrogenase; lipoamide dehydrogena 84.54
2hqm_A479 GR, grase, glutathione reductase; glutathione redu 84.52
4dna_A463 Probable glutathione reductase; structural genomic 84.46
3urh_A491 Dihydrolipoyl dehydrogenase; PSI-biology, structur 84.36
1fec_A490 Trypanothione reductase; redox-active center, oxid 84.27
3d1c_A369 Flavin-containing putative monooxygenase; NP_37310 84.26
2fdn_A55 Ferredoxin; electron transport, iron-sulfur, 4Fe-4 84.04
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 83.84
2fgo_A82 Ferredoxin; allochromatium vinosum, [4Fe-4S] clust 83.5
2wpf_A495 Trypanothione reductase; oxidoreductase, trypanoso 83.24
3eun_A82 Ferredoxin; electron transport, [4Fe-4S] cluster, 83.23
2vvm_A495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 83.18
2pa8_D265 DNA-directed RNA polymerase subunit D; ferredoxin- 82.96
3kkj_A336 Amine oxidase, flavin-containing; oxidoreductase, 82.95
1jb0_C80 Photosystem I iron-sulfur center; membrane protein 82.76
1rgv_A80 Ferredoxin; electron transport; 2.90A {Thauera aro 82.65
1f2g_A58 Ferredoxin II; electron transport, FDII desulfovib 82.6
2cdu_A452 NADPH oxidase; flavoenzyme, oxidoreductase; HET: F 82.59
3ef6_A410 Toluene 1,2-dioxygenase system ferredoxin--NAD(+) 82.57
4b63_A501 L-ornithine N5 monooxygenase; oxidoreductase, side 82.39
1rof_A60 Ferredoxin; electron transport, iron-sulfur; NMR { 82.24
2zvs_A85 Uncharacterized ferredoxin-like protein YFHL; elec 82.15
3dk9_A478 Grase, GR, glutathione reductase; flavoenzyme, nic 81.69
2gag_A 965 Heterotetrameric sarcosine oxidase alpha-subunit; 81.56
3lxd_A415 FAD-dependent pyridine nucleotide-disulphide oxido 81.04
1dax_A64 Ferredoxin I; electron transport, electron-transfe 80.88
1xer_A103 Ferredoxin; electron transport, iron-sulfur, dupli 80.73
1dxl_A470 Dihydrolipoamide dehydrogenase; oxidoreductase, mu 80.33
3s5w_A463 L-ornithine 5-monooxygenase; class B flavin depend 80.23
2hj1_A97 Hypothetical protein; structural genomics, PSI, pr 80.17
3or1_A 437 Sulfite reductase alpha; dissimilatory sulfite red 80.09
>2h88_A Succinate dehydrogenase flavoprotein subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_A* 1yq3_A* 2fbw_A* 2h89_A* 2wqy_A* 1zoy_A* 1zp0_A* 3abv_A* 3ae1_A* 3ae2_A* 3ae3_A* 3ae4_A* 3ae5_A* 3ae6_A* 3ae7_A* 3ae8_A* 3ae9_A* 3aea_A* 3aeb_A* 3aec_A* ... Back     alignment and structure
Probab=100.00  E-value=2.5e-99  Score=873.14  Aligned_cols=566  Identities=51%  Similarity=0.844  Sum_probs=509.3

Q ss_pred             ChHhhhcHhCCCCEEEEEecCCCCChhhhcccCeeeccCCCCCCCHHHHHHHHHHhcCCCCcHHHHHHHHHHHHHHHHHH
Q psy9575           1 MRASLQLAQEGLNVAILSKVFPTRSHTVAAQGGISASLGNMSKDNWHWHMFDTIKGSDYLGDQDAIEFMCKEAPKVVYEL   80 (786)
Q Consensus         1 L~AA~~aa~~G~~V~vvek~~~~~g~s~~a~Ggi~a~~~~~~~d~~~~~~~d~~~~~~~~~~~~~v~~~~~~~~~~i~~l   80 (786)
                      |+||++|+++|++|+||||....+|+|.+++||+++..+....|+++.|+.|+++.+.+++|+++++.+++++++.++||
T Consensus        31 l~AAl~aa~~G~~V~vlEK~~~~~g~s~~a~GGi~a~~~~~~~ds~~~~~~dtl~~g~~l~d~~~v~~l~~~s~~~i~~L  110 (621)
T 2h88_A           31 LRAAFGLSEAGFNTACVTKLFPTRSHTVAAQGGINAALGNMEDDNWRWHFYDTVKGSDWLGDQDAIHYMTEQAPAAVIEL  110 (621)
T ss_dssp             HHHHHHHHHTTCCEEEEESSCGGGSGGGGCCSCEECCCCSSSCCCHHHHHHHHHHHTTTCSCHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHCCCcEEEEeccCCCCCCchhhCCCcEecCCCCCCCCHHHHHHHHHHhcCCCCCHHHHHHHHHHHHHHHHHH
Confidence            58999999999999999999888888999999999877654478999999999999999999999999999999999999


Q ss_pred             HHcCCCccccCCCcccccCCCCccCCCCC-CCcceEEEecCCcHHHHHHHHHHHHhcCCceEEeceEEEeeeecCCCCEE
Q psy9575          81 EHFGMPFDRNKNGTIYQRPFGGHSSNFGE-KPIARACAVADRTGHALLHTLYQRNLHAKTNFFIEWMAIDLISDSEGDIL  159 (786)
Q Consensus        81 ~~~Gv~~~~~~~g~~~~~~~gg~~~~~~~-~~~~r~~~~~~~~g~~i~~~L~~~~~~~Gv~i~~~~~v~~L~~~~~g~v~  159 (786)
                      +++|++|.+..+|.+..+.+++|+..|+. ...+|.++..+.+|..++..|.+++++.||+|++++.|++|+.++ |+|.
T Consensus       111 ~~~Gv~f~~~~~g~~~~~~~gg~s~~~g~~~~~~R~~~~~d~tG~~l~~~L~~~~~~~gv~i~~~~~v~~Li~~~-g~v~  189 (621)
T 2h88_A          111 ENYGMPFSRTEEGKIYQRAFGGQSLQFGKGGQAHRCCCVADRTGHSLLHTLYGRSLRYDTSYFVEYFALDLLMEN-GECR  189 (621)
T ss_dssp             HHTTCCCCBCTTSSBCEECCTTCBSTTTTSCBCCCEECSTTCHHHHHHHHHHHHHTTSCCEEEETEEEEEEEEET-TEEE
T ss_pred             HHcCCCcccCCCCceeccccCcccccccCCCcceeEEEecCCCHHHHHHHHHHHHHhCCCEEEEceEEEEEEEEC-CEEE
Confidence            99999999988898888889998443332 123388888888999999999999999999999999999999986 9999


Q ss_pred             EEEEEEcCCCcEEEEEeCeEEEcCCCCCccCccCcccCCCchHHHHHHHHCCCCccCCCccccccccccCCCCccccccc
Q psy9575         160 GVVALEMETGNIMILESKITILATGGGGRIWAASTNAFINTGDGLGMAARAGLPLEDMEFWQFHPTGVAGAGVLITEGVR  239 (786)
Q Consensus       160 G~~~~~~~~g~~~~i~AkaVVlATGG~~~~~~~~~~~~~~tGdg~~~a~~aGa~l~~~e~~q~~p~~~~~~~~~~~~~~~  239 (786)
                      |+++.+..+|+...|+|++|||||||++++|..+++++.+||||++||+++||.+.+|||+||||+++...+++++++++
T Consensus       190 Gv~~~~~~~G~~~~i~A~~VVlATGG~~~~y~~~t~~~~~tGdG~~mA~raGa~l~~me~~q~hPt~~~~~~~l~se~~r  269 (621)
T 2h88_A          190 GVIALCIEDGTIHRFRAKNTVIATGGYGRTYFSCTSAHTSTGDGTAMVTRAGLPCQDLEFVQFHPTGIYGAGCLITEGCR  269 (621)
T ss_dssp             EEEEEETTTCCEEEEEEEEEEECCCCCGGGSSSBSSCTTCCCHHHHHHHHTTCCEECTTCEEEEEEEETTTCCBCCTHHH
T ss_pred             EEEEEEcCCCcEEEEEcCeEEECCCccccccCCcCCCCCCChHHHHHHHHcCCCcccCcceeeecccccCCcceeccccc
Confidence            99998867888888999999999999999999999999999999999999999999999999999999888999999999


Q ss_pred             cCCcEEEcCCCCccccccCCccCCCCchhHHHHHHHHHHHhcCCCCCCCCeEEEeCCCCChhHHHhHchhHHHHHHhhcC
Q psy9575         240 GEGGILINSNGERFMERYAPILKDLAPRDFVSRAMDQEIKEGRGCGPNKDHVMLDLRHINSETIINRLPSILEIGNKFAN  319 (786)
Q Consensus       240 ~~g~~~vn~~G~rf~~~~~p~~~~~~~~~~~~~~i~~~~~~g~g~~~~~~~v~ld~~~~~~~~~~~~~~~~~~~~~~~~g  319 (786)
                      ++|++|+|.+|+|||++|+|..+++++||+++++|..++.+|+++.|..++||+|+++++++.+.+++|.+++.+..+.|
T Consensus       270 g~g~ilvn~~G~RF~~~y~p~~~ela~rdvv~rai~~e~~~g~g~~~~~~~v~ld~~~l~~~~l~~~~~~i~~~~~~~~G  349 (621)
T 2h88_A          270 GEGGILINSQGERFMERYAPVAKDLASRDVVSRSMTIEIREGRGCGPEKDHVYLQLHHLPPQQLATRLPGISETAMIFAG  349 (621)
T ss_dssp             HTTCEEECTTCCCTHHHHSTTTGGGSCHHHHHHHHHHHHHTTCCBTTTTCBEEEECTTSCHHHHHHHCHHHHHHHHHHHC
T ss_pred             CCccEEECCCCCCcccccCcccccccchHHHHHHHHHHHHhcCCcccCCCeEEEEcccCCHHHHHHHHHHHHHHHHHhcC
Confidence            99999999999999999999888999999999999999999888656667899999999999999999999999987669


Q ss_pred             CCCCCCCeeeeecccccccCcccCCCCcccccCCCCCcccCceeeecccCCccCCCCCccChhhhHHHHHHHHHHHHHHH
Q psy9575         320 VNALKEPIPVIPTIHYQMGGIPTNIYGQVIIPNNDNNKIVNGLYAIGECACVSVHGANRLGTNSLLDLLVFGRSAGNHIL  399 (786)
Q Consensus       320 ~d~~~~~i~v~p~~~~t~GGi~vd~~~~vl~~~~~~~t~IpGLyAaGe~a~gg~~Ga~rlgg~~l~~a~v~G~~Ag~~aa  399 (786)
                      +|+.++|+||.|++|||||||+||.++|||+.+....|+|||||||||++|+|+||+|||||+||++|+|||++||++|+
T Consensus       350 ~D~~~~pi~v~p~~h~tmGGi~~d~~~~Vl~~~~~~~t~IpGLyAaGE~a~~g~hGanrlggnsL~~~~vfGr~Ag~~aa  429 (621)
T 2h88_A          350 VDVTKEPIPVLPTVHYNMGGIPTNYKGQVITHVNGEDKVVPGLYACGEAASASVHGANRLGANSLLDLVVFGRACALTIA  429 (621)
T ss_dssp             CCTTTSCEEEEEEEEEESCBEEBCTTSEEEEEETTEEEEEEEEEECGGGEECSSSTTSCCTTSHHHHHHHHHHHHHHHHH
T ss_pred             CCCCCCCEEEEeecccccCcEeECCCCeEeecccCCCcccCceEEccccccccccCCCCCchHhHHHHHHHHHHHHHHHH
Confidence            99999999999999999999999999999983222239999999999999789999999999999999999999999999


Q ss_pred             HHhhhccCCCCCCcccHHHHHHHHhhhhhCCCCCCHHHHHHHHHHHHHhccccccCHHHHHHHHHHHHHHHHHhcccccc
Q psy9575         400 SLELKKIHNKKLPINSIDIIIDRLSKLENNKGSESVQSVANDIRKTMQNYCGVFRTDKLMKNGYKKIMILDERRKYISFK  479 (786)
Q Consensus       400 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~m~~~~g~~r~~~~l~~~l~~l~~l~~~~~~~~~~  479 (786)
                      ++++......+++.+..+...+++..+++.+++.++.+++.+||++||+|+|++|++++|++++++|++|+++++.+.+.
T Consensus       430 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~m~~~~gi~R~~~~L~~a~~~l~~l~~~~~~~~~~  509 (621)
T 2h88_A          430 ETCKPGEPVPSIKPNAGEESVANLDKLRFADGTIRTSEARLNMQKTMQSHAAVFRTGSILQEGCEKLSQIYRDLAHLKTF  509 (621)
T ss_dssp             HHCCTTCCCCCCCTTTTHHHHHHHHHHHTCBSSEEHHHHHHHHHHHHHHHSSSSBCHHHHHHHHHHHHHHHHGGGGEECC
T ss_pred             HhhhccccccccchhHHHHHHHHHHHhhccCCCCCHHHHHHHHHHHhhhceeEecCHHHHHHHHHHHHHHHHHHhhcccc
Confidence            98754322233333444555667777777666788999999999999999999999999999999999999999999999


Q ss_pred             CCCcccchHHHHHHhHhhHHHHHHHHHHHHhhcccCCcccccCCCCCCCcc-----------------cccceEEEEec-
Q psy9575         480 DKSKIFNTARIEALELDNLIETAKATISSAISRKESRGAHAHNDFKNRDDI-----------------NWLKHSIWYSN-  541 (786)
Q Consensus       480 ~~~~~~~~~l~~~~e~~~~~~~a~~~~~aal~R~ESRG~h~R~D~p~~d~~-----------------~~~~~~~~~~~-  541 (786)
                      |.+..||++|.+++|++||+++|+++++|||+|+||||+|||+|||++||+                 +|+||++++.. 
T Consensus       510 ~~~~~~n~~l~~~~e~~~~l~~a~~~~~~al~R~ESRG~H~R~D~p~~dd~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  589 (621)
T 2h88_A          510 DRGIVWNTDLVETLELQNLMLCALQTIYGAEARKESRGAHAREDYKLRIDEFDYSKPLQGQQKRPFEEHWRKHTLSYVDV  589 (621)
T ss_dssp             CCCSTTCHHHHHHHHHHHHHHHHHHHHHHHHHCCSCBTTBCBTTBCSCCCSSCTTSCCTTCCCCCGGGCCCEEEEEEEET
T ss_pred             ccccccchhHHHHHHHHHHHHHHHHHHHHHHhCcccccceecccCcccCccccccCCcccccCCcchhccceeEEEEEcC
Confidence            888889999999999999999999999999999999999999999999999                 99999988752 


Q ss_pred             ---CceeeeccCcCCCCc---ccccCCCCcCC
Q psy9575         542 ---GNRIEFKPVNLKPLT---VKTVHPKKHHD  567 (786)
Q Consensus       542 ---~~~~~~~~~~~~~~~---v~~~~p~~r~~  567 (786)
                         ++++.++||...+|+   +.+|+|..|.|
T Consensus       590 ~~~~~~~~~~~v~~~~~~~~~~~~~~~~~r~y  621 (621)
T 2h88_A          590 KSGKVTLKYRPVIDRTLNEEDCSSVPPAIRSY  621 (621)
T ss_dssp             TTTEEEEEEEECCCCCSCTTTSCCCCCCCCCC
T ss_pred             CCCceEEEecccccccccccccceeCCcCCCC
Confidence               258999999977875   78899988765
>2bs2_A Quinol-fumarate reductase flavoprotein subunit A; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 2bs3_A* 1e7p_A* 2bs4_A* 1qlb_A* Back     alignment and structure
>2wdq_A Succinate dehydrogenase flavoprotein subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_A* 2acz_A* 1nek_A* 2wdr_A* 2wdv_A* 2wp9_A* 2ws3_A* 2wu2_A* 2wu5_A* Back     alignment and structure
>1kf6_A Fumarate reductase flavoprotein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1kfy_A* 1l0v_A* 2b76_A* 3cir_A* 3p4p_A* 3p4q_A* 3p4r_A* 3p4s_A* Back     alignment and structure
>1chu_A Protein (L-aspartate oxidase); flavoenzyme, NAD biosynthesis, FAD, oxidoreductase; 2.20A {Escherichia coli} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1knr_A* 1knp_A* Back     alignment and structure
>3gyx_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Back     alignment and structure
>1jnr_A Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: a.7.3.1 c.3.1.4 d.168.1.1 PDB: 1jnz_A* 2fjb_A* 2fja_A* 2fjd_A* 2fje_A* Back     alignment and structure
>2e5v_A L-aspartate oxidase; archaea, oxidoreductase; HET: FAD; 2.09A {Sulfolobus tokodaii} Back     alignment and structure
>1y0p_A Fumarate reductase flavoprotein subunit; flavocytochrome, mesaconate, oxidoreductase; HET: HEM FAD; 1.50A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1qjd_A* 2b7s_A* 1jry_A* 2b7r_A* 1ksu_A* 1jrz_A* 1jrx_A* 1m64_A* 1p2h_A* 1p2e_A* 1kss_A* 1e39_A* 1q9i_A* 1lj1_A* Back     alignment and structure
>1d4d_A Flavocytochrome C fumarate reductase; oxidoreductase; HET: HEM FAD; 2.50A {Shewanella oneidensis} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 PDB: 1d4e_A* 1d4c_A* Back     alignment and structure
>1qo8_A Flavocytochrome C3 fumarate reductase; oxidoreductase; HET: HEM FAD; 2.15A {Shewanella frigidimarina} SCOP: a.138.1.3 c.3.1.4 d.168.1.1 Back     alignment and structure
>4at0_A 3-ketosteroid-delta4-5alpha-dehydrogenase; oxidoreductase, dehydogenase, steroid catabolism; HET: FAD; 1.60A {Rhodococcus jostii} PDB: 4at2_A* Back     alignment and structure
>3vr8_B Iron-sulfur subunit of succinate dehydrogenase; membrane protein, reductase, mitochondria MEMB oxidoreductase; HET: FAD HEM RQX EPH; 2.81A {Ascaris suum} PDB: 3vrb_B* Back     alignment and structure
>2h88_B Succinate dehydrogenase IP subunit; complex II, membrane protein, heme protein, iron sulfur PROT cytochrome B, oxidoreductase; HET: FAD BHG HEM UNL; 1.74A {Gallus gallus} PDB: 1yq4_B* 1yq3_B* 2fbw_B* 2h89_B* 2wqy_B* 3aef_B* 3abv_B* 3ae1_B* 3ae3_B* 3ae2_B* 3ae5_B* 3ae6_B* 3ae7_B* 3ae8_B* 3ae9_B* 3aea_B* 3aeb_B* 3aec_B* 3aed_B* 3aee_B* ... Back     alignment and structure
>2bs2_B Quinol-fumarate reductase iron-sulfur subunit B; 2Fe-2S, 3Fe-4S, 4Fe-4S, citric acid cycle, dihaem cytochrome B; HET: FAD HEM LMT; 1.78A {Wolinella succinogenes} SCOP: a.1.2.1 d.15.4.2 PDB: 2bs3_B* 1e7p_B* 1qlb_B* 2bs4_B* Back     alignment and structure
>2wdq_B Succinate dehydrogenase iron-sulfur subunit; succinate dehydrogenase activity, cell inner membrane, trica acid cycle; HET: FAD HEM CBE; 2.40A {Escherichia coli} PDB: 1nen_B* 2acz_B* 1nek_B* 2wdr_B* 2wdv_B* 2ws3_B* 2wu2_B* 2wu5_B* 2wp9_B* Back     alignment and structure
>1kf6_B Fumarate reductase iron-sulfur protein; respiration, fumarate reductace, succinate dehydrogenase, CO quinol, quinone, oxidoreductase; HET: FAD HQO CE1 1PE; 2.70A {Escherichia coli} SCOP: a.1.2.1 d.15.4.2 PDB: 1kfy_B* 1l0v_B* 2b76_B* 3cir_B* 3p4p_B* 3p4q_B* 3p4r_B* 3p4s_B* Back     alignment and structure
>2i0z_A NAD(FAD)-utilizing dehydrogenases; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: FAD; 1.84A {Bacillus cereus} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3kwl_A Uncharacterized protein; putative oxidoreductase, multidomain, unknown function; 1.94A {Helicobacter pylori} Back     alignment and structure
>2gqf_A Hypothetical protein HI0933; structural genomics, FAD-utilizing protein, flavoprotein, PS protein structure initiative; HET: FAD; 2.70A {Haemophilus influenzae} SCOP: c.3.1.8 e.74.1.1 Back     alignment and structure
>3v76_A Flavoprotein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: FDA; 2.51A {Sinorhizobium meliloti} Back     alignment and structure
>3i9v_3 NADH-quinone oxidoreductase subunit 3; electron transport, respiratory chain, cell flavoprotein, FMN, iron, iron-sulfur, membrane; HET: FMN; 3.10A {Thermus thermophilus} PDB: 2ybb_3* 2fug_3* 3iam_3* 3ias_3* 3m9s_3* Back     alignment and structure
>1rm6_C 4-hydroxybenzoyl-COA reductase gamma subunit; xanthine oxidase family, dimer heterotrimers, oxidoreductase; HET: PCD FAD SF4 EPE; 1.60A {Thauera aromatica} SCOP: a.56.1.1 d.15.4.2 PDB: 1sb3_C* Back     alignment and structure
>1t3q_A Quinoline 2-oxidoreductase small subunit; QOR, molybdenum, MCD; HET: FAD MCN; 1.80A {Pseudomonas putida} SCOP: a.56.1.1 d.15.4.2 Back     alignment and structure
>3c8y_A Iron hydrogenase 1; dithiomethylether, H-cluster, iron-sulfur binding, oxidoreductase; HET: HCN; 1.39A {Clostridium pasteurianum} SCOP: c.96.1.1 d.15.4.2 d.58.1.5 PDB: 1c4c_A* 1c4a_A* 1feh_A* Back     alignment and structure
>3cp8_A TRNA uridine 5-carboxymethylaminomethyl modification enzyme GIDA; rossmann fold, FAD-binding domain, dinucleotide-binding motif; HET: FAD; 3.20A {Chlorobium tepidum} Back     alignment and structure
>3nlc_A Uncharacterized protein VP0956; FAD-binding protein, NESG, structural genomics, PSI-2, prote structure initiative; HET: FAD; 2.15A {Vibrio parahaemolyticus} Back     alignment and structure
>1ffv_A CUTS, iron-sulfur protein of carbon monoxide dehydrogenase; hydrolase; HET: ARO PCD FAD; 2.25A {Hydrogenophaga pseudoflava} SCOP: a.56.1.1 d.15.4.2 PDB: 1ffu_A* Back     alignment and structure
>1n62_A Carbon monoxide dehydrogenase small chain; CODH, molybdenum, molybdopterin, oxidoreductase; HET: CUB MCN FAD; 1.09A {Oligotropha carboxidovorans} SCOP: a.56.1.1 d.15.4.2 PDB: 1n5w_A* 1n61_A* 1n60_A* 1n63_A* 1zxi_A* Back     alignment and structure
>2zxi_A TRNA uridine 5-carboxymethylaminomethyl modificat MNMG; modification, 5-carboxymethylaminomethyl uridine, WOBB uridine, FAD; HET: FAD; 2.30A {Aquifex aeolicus} PDB: 2zxh_A* 2e57_A* Back     alignment and structure
>3ces_A MNMG, tRNA uridine 5-carboxymethylaminomethyl modificat GIDA, GIDA; tRNA modification, FAD binding domain, structural genomics; 2.41A {Escherichia coli} PDB: 3cp2_A 3g05_A Back     alignment and structure
>4b1b_A TRXR, thioredoxin reductase; oxidoreductase, FAD, NADPH, thiol-mediated redox metabolism, pyridine nucleotide-disulfide oxidoreductase; HET: FAD; 2.90A {Plasmodium falciparum} Back     alignment and structure
>3hrd_D Nicotinate dehydrogenase small FES subunit; selenium ligand, iron, iron-sulfur, metal-binding, oxidoreductase; HET: MCN FAD; 2.20A {Eubacterium barkeri} Back     alignment and structure
>3cf4_A Acetyl-COA decarboxylase/synthase alpha subunit; methanomicrobia, iron-nikel-sulfur, 4Fe-NI-4S, oxidoreductas; 2.00A {Methanosarcina barkeri} Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>3oz2_A Digeranylgeranylglycerophospholipid reductase; structural genomics, joint center for structural genomics; HET: MSE FAD OZ2; 1.60A {Thermoplasma acidophilum} Back     alignment and structure
>4fk1_A Putative thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MSE FAD; 2.40A {Bacillus anthracis} PDB: 4fk1_C* Back     alignment and structure
>3qfa_A Thioredoxin reductase 1, cytoplasmic; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_A* 2j3n_A* 2zzc_A* 2zzb_A* 2zz0_A* 2cfy_A* 1h6v_A* 3ean_A* 3eao_A* Back     alignment and structure
>3dme_A Conserved exported protein; structural genomics, PSI-2, PROT structure initiative, northeast structural genomics consort NESG; HET: FAD TLA; 1.70A {Bordetella pertussis} Back     alignment and structure
>1y56_B Sarcosine oxidase; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>1ojt_A Surface protein; redox-active center, glycolysis, oxidoreductase, NAD, flavop FAD, P64K; HET: FAD; 2.75A {Neisseria meningitidis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1bhy_A* Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>3ps9_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; rossmann fold, oxidase, methyl transferase, FAD; HET: FAD SAM; 2.54A {Escherichia coli} PDB: 3awi_A* Back     alignment and structure
>3da1_A Glycerol-3-phosphate dehydrogenase; NESG BHR167 Q9KDW6 X-RAY, structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.70A {Bacillus halodurans} Back     alignment and structure
>3lad_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD; 2.20A {Azotobacter vinelandii} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1lpf_A* Back     alignment and structure
>2gag_B Heterotetrameric sarcosine oxidase beta-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_B* 1x31_B* 1vrq_B* 3ad7_B* 3ad8_B* 3ad9_B* 3ada_B* Back     alignment and structure
>1rp0_A ARA6, thiazole biosynthetic enzyme; protein ligand complex, biosynthetic protein; HET: AHZ HTO; 1.60A {Arabidopsis thaliana} SCOP: c.3.1.6 Back     alignment and structure
>3jsk_A Cypbp37 protein; octameric thiazole synthase, biosynthetic protein; HET: AHZ; 2.70A {Neurospora crassa} Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>2a8x_A Dihydrolipoyl dehydrogenase, E3 component of alpha; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha keto acid dehydrogenase; HET: FAD; 2.40A {Mycobacterium tuberculosis} PDB: 3ii4_A* Back     alignment and structure
>2rgh_A Alpha-glycerophosphate oxidase; flavoprotein oxidase, oxidoreductase; HET: FAD; 2.30A {Streptococcus SP} PDB: 2rgo_A* Back     alignment and structure
>1ebd_A E3BD, dihydrolipoamide dehydrogenase; redox-active center, glycolysis, oxidoreductase; HET: FAD; 2.60A {Geobacillus stearothermophilus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1vlb_A Aldehyde oxidoreductase; iron-sulphur cluster; HET: PCD; 1.28A {Desulfovibrio gigas} SCOP: a.56.1.1 d.15.4.2 d.41.1.1 d.133.1.1 PDB: 1sij_A* 1zcs_A* 3fah_A* 3fc4_A* 3l4p_A* Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>1ryi_A Glycine oxidase; flavoprotein, protein-inhibitor complex, oxidoreductase; HET: FAD; 1.80A {Bacillus subtilis} SCOP: c.3.1.2 d.16.1.3 PDB: 3if9_A* 1ng4_A* 1ng3_A* Back     alignment and structure
>3dje_A Fructosyl amine: oxygen oxidoreductase; fructosyl-amino acid, amadoriase, deglycation, fructosamine oxidase; HET: MSE FAD FSA EPE; 1.60A {Aspergillus fumigatus} PDB: 3djd_A* Back     alignment and structure
>2qae_A Lipoamide, dihydrolipoyl dehydrogenase; FAD-cystine-oxidoreductase, homodimer; HET: FAD; 1.90A {Trypanosoma cruzi} Back     alignment and structure
>4a9w_A Monooxygenase; baeyer-villiger, FAD, oxidoreductase; HET: FAD; 2.72A {Stenotrophomonas maltophilia} Back     alignment and structure
>1frr_A Ferredoxin I; electron transfer(iron-sulfur protein); 1.80A {Equisetum arvense} SCOP: d.15.4.1 Back     alignment and structure
>3nyc_A D-arginine dehydrogenase; FAD, imino-arginine, oxidoreductas; HET: FAD IAR; 1.06A {Pseudomonas aeruginosa} PDB: 3nye_A* 3nyf_A* 3sm8_A* Back     alignment and structure
>3axb_A Putative oxidoreductase; dinucleotide-binding fold; HET: FAD; 1.92A {Aeropyrum pernix} PDB: 3vqr_A* Back     alignment and structure
>2qcu_A Aerobic glycerol-3-phosphate dehydrogenase; glycerol-3-phoshate dehydrogenase, oxidoreductase; HET: BOG FAD TAM; 1.75A {Escherichia coli} PDB: 2r45_A* 2r46_A* 2r4e_A* 2r4j_A* Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>1frd_A Heterocyst [2Fe-2S] ferredoxin; electron transport; 1.70A {Nostoc SP} SCOP: d.15.4.1 Back     alignment and structure
>1dgj_A Aldehyde oxidoreductase; beta half-barrel, four-helix bundle, beta barrel; HET: MCN; 2.80A {Desulfovibrio desulfuricans} SCOP: a.56.1.1 d.15.4.2 d.41.1.1 d.133.1.1 Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>2gjc_A Thiazole biosynthetic enzyme, mitochondrial; glutathione reductase type II family, thiazole synthase, mitochondria DNA repair; HET: AHZ; 1.82A {Saccharomyces cerevisiae} PDB: 3fpz_A* Back     alignment and structure
>3l8k_A Dihydrolipoyl dehydrogenase; redox-active center, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>3nix_A Flavoprotein/dehydrogenase; structural genomics, PSI-2, NES protein structure initiative, northeast structural genomics consortium; HET: FAD; 2.60A {Cytophaga hutchinsonii} Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>2w3s_A Xanthine dehydrogenase; XO, XDH, GOUT, iron, 2Fe-2S, iron-sulfur, oxidoreductase, purine metabolism, molybdenum cofactor, hypoxanthine; HET: MPN FAD XAN; 2.60A {Rhodobacter capsulatus} PDB: 2w3r_A* 2w54_A* 2w55_A* 1jro_A* 1jrp_A* Back     alignment and structure
>1onf_A GR, grase, glutathione reductase; oxidoreductase; HET: FAD; 2.60A {Plasmodium falciparum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1xdi_A RV3303C-LPDA; reductase, FAD, NAD, NADP, unkno function; HET: FAD; 2.81A {Mycobacterium tuberculosis} SCOP: c.3.1.5 d.87.1.1 Back     alignment and structure
>1awd_A Ferredoxin; electron transport, eukaryotic, green ALGA, electron transfer, metalloprotein; 1.40A {'chlorella' fusca} SCOP: d.15.4.1 Back     alignment and structure
>1pj5_A N,N-dimethylglycine oxidase; channelling, FAD binding, folate binding, amine oxidase, oxidoreductase; HET: FAD; 1.61A {Arthrobacter globiformis} SCOP: b.44.2.1 c.3.1.2 d.16.1.5 d.250.1.1 PDB: 1pj6_A* 1pj7_A* 3gsi_A* Back     alignment and structure
>2gf3_A MSOX, monomeric sarcosine oxidase; flavoprotein oxidase, inhibitor 2-furoic acid, oxidoreductas; HET: FAD; 1.30A {Bacillus SP} SCOP: c.3.1.2 d.16.1.3 PDB: 1el7_A* 1el8_A* 1el9_A* 1eli_A* 1l9e_A* 2a89_A* 2gb0_A* 1el5_A* 3qse_A* 3qsm_A* 3qss_A* 3bhk_A* 3bhf_A* 3m12_A* 3m13_A* 3m0o_A* 1l9c_A* 1l9d_A* 1zov_A* Back     alignment and structure
>3ic9_A Dihydrolipoamide dehydrogenase; APC62701, colwellia psychrer 34H, structural genomics, PSI-2; HET: FAD; 2.15A {Colwellia psychrerythraea} Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>2oln_A NIKD protein; flavoprotein, rossmann fold, oxidoreductase; HET: FAD; 1.15A {Streptomyces tendae} PDB: 2olo_A* 3hzl_A* 2q6u_A* Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>2uzz_A N-methyl-L-tryptophan oxidase; N-methyltryptophan oxidase (MTOX), oxidative demethylation of N-methyl-L-tryptophan, FAD, flavoenzyme; HET: FAD; 3.2A {Escherichia coli} Back     alignment and structure
>1a70_A Ferredoxin; iron-sulfur protein, photosynthesis, electron transport; 1.70A {Spinacia oleracea} SCOP: d.15.4.1 PDB: 1pfd_A Back     alignment and structure
>1iue_A Ferredoxin; electron transport, iron-sulfur; 1.70A {Plasmodium falciparum} SCOP: d.15.4.1 Back     alignment and structure
>2eq6_A Pyruvate dehydrogenase complex, dihydrolipoamide dehydrogenase E3 component; oxidoreductase, homodimer, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2eq8_A* 2eq9_A* Back     alignment and structure
>1czp_A Ferredoxin I; [2Fe-2S] protein, crystal reduced with dithionite, electron; 1.17A {Nostoc SP} SCOP: d.15.4.1 PDB: 1ewy_C* 1fxa_A 1qt9_A 1qog_A 1j7c_A 1j7b_A 1qof_A 1qob_A 1j7a_A 1qoa_A 1rfk_A 3p63_A 4fxc_A 3ab5_A 1roe_A 2cjn_A 2cjo_A 1off_A 1dox_A 1doy_A ... Back     alignment and structure
>3c4n_A Uncharacterized protein DR_0571; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: ADP; 2.40A {Deinococcus radiodurans R1} Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>2r9z_A Glutathione amide reductase; NAD, FAD, substrate specificity, oxidoreductase; HET: FAD; 2.10A {Marichromatium gracile} PDB: 2rab_A* Back     alignment and structure
>3qvp_A Glucose oxidase; oxidoreductase; HET: NAG BMA MAN FAD; 1.20A {Aspergillus niger} PDB: 1gal_A* 1cf3_A* 3qvr_A* Back     alignment and structure
>1jq4_A Methane monooxygenase component C; [2Fe-2S] ferredoxin, oxidoreductase; NMR {Methylococcus capsulatus str} SCOP: d.15.4.2 Back     alignment and structure
>3atr_A Conserved archaeal protein; saturating double bonds, archaeal membrane precursor, like 2 geranylgeranylglyceryl phosphate; HET: FDA; 1.80A {Sulfolobus acidocaldarius} PDB: 3atq_A* Back     alignment and structure
>1l5p_A Ferredoxin; [2Fe-2S] cluster, electron transfer, iron-sulfur protein, metalloprotein, oxidoreductase; 2.20A {Trichomonas vaginalis} SCOP: d.15.4.1 Back     alignment and structure
>3e1t_A Halogenase; flavoprotein; HET: FAD; 2.05A {Chondromyces crocatus} Back     alignment and structure
>3nvw_A Xanthine dehydrogenase/oxidase; hydroxylase, homodimer, xanthine oxidase, guanine, oxidoredu; HET: FAD MTE GUN; 1.60A {Bos taurus} PDB: 3etr_A* 3ns1_A* 3nvv_A* 3nrz_A* 3nvy_A* 3nvz_A* 3rca_A* 3sr6_A* 3eub_A* Back     alignment and structure
>1ges_A Glutathione reductase; oxidoreductase(flavoenzyme); HET: FAD; 1.74A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1geu_A* 1ger_A* 1get_A* Back     alignment and structure
>2wlb_A ETP1-FD, electron transfer protein 1, mitochondrial; iron-sulfur, iron, transport, ferredoxin, adrenodoxin-like, electron transport; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>1wri_A Ferredoxin II, ferredoxin; electron transport; 1.20A {Equisetum arvense} SCOP: d.15.4.1 Back     alignment and structure
>3q9t_A Choline dehydrogenase and related flavoproteins; glucose-methanol-choline oxidoreductase family, formate OXID formyl-FAD, oxidoreductase; HET: FAY; 2.24A {Aspergillus oryzae} Back     alignment and structure
>2yqu_A 2-oxoglutarate dehydrogenase E3 component; lipoamide dehydrogenase, 2-oxoglutarate dehydrogenase comple pyruvate dehydrogenase complex; HET: FAD; 1.70A {Thermus thermophilus} PDB: 2eq7_A* Back     alignment and structure
>3g3e_A D-amino-acid oxidase; FAD, flavoprotein, oxidoreductase, PER; HET: FAD G3E; 2.20A {Homo sapiens} PDB: 3cuk_A* 2e48_A* 2e49_A* 2e4a_A* 2e82_A* 2du8_A* 1ve9_A* 1dao_A* 1ddo_A* 1kif_A* 1an9_A* 1evi_A* Back     alignment and structure
>1xlq_A Putidaredoxin, PDX; [2Fe-2S], ferredoxin, oxidoreductase; 1.45A {Pseudomonas putida} SCOP: d.15.4.1 PDB: 1xlp_A 1oqr_A 1r7s_A 1pdx_A 1yji_A 1yjj_A 1oqq_A 1xln_A 1xlo_A 3lb8_C* 1put_A 1gpx_A Back     alignment and structure
>3lxf_A Ferredoxin; iron, iron-sulfur, metal-binding, metal protein; 2.30A {Novosphingobium aromaticivorans} SCOP: d.15.4.0 Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>3ah7_A [2Fe-2S]ferredoxin; [2Fe-2S] cluster, iron-sulfur cluster biosynthes pseudomonas, metal binding protein; 1.90A {Pseudomonas putida} Back     alignment and structure
>1b9r_A Protein (terpredoxin); structure from molmol, ferredoxin; NMR {Pseudomonas SP} SCOP: d.15.4.1 Back     alignment and structure
>2fdn_A Ferredoxin; electron transport, iron-sulfur, 4Fe-4S; 0.94A {Clostridium acidurici} SCOP: d.58.1.1 PDB: 1fdn_A 1fca_A 1clf_A 1dur_A Back     alignment and structure
>4eqs_A Coenzyme A disulfide reductase; oxidoreductase; HET: COA FAD; 1.50A {Staphylococcus aureus subsp} PDB: 1yqz_A* 4eqw_A* 4em4_A* 4em3_A* 4eqr_A* 4emw_A* 4eqx_A* Back     alignment and structure
>1i7h_A Ferredoxin; 2Fe-2S,electron transport; 1.70A {Escherichia coli} SCOP: d.15.4.1 Back     alignment and structure
>2bt6_A Adrenodoxin 1; ruthenium(II) bipyridyl complex, intramolecular electron TRA electron transport, metal-binding; HET: RUA; 1.50A {Bos taurus} SCOP: d.15.4.1 PDB: 1ayf_A 3n9y_C* 2jqr_B* 3na0_C* Back     alignment and structure
>1zk7_A HGII, reductase, mercuric reductase; mercuric ION reductase, oxidoreductase; HET: FAD; 1.60A {Pseudomonas aeruginosa} PDB: 1zx9_A* Back     alignment and structure
>1jb0_C Photosystem I iron-sulfur center; membrane protein, multiprotein-pigment complex, photosynthes; HET: CL1 PQN BCR LHG LMG; 2.50A {Synechococcus elongatus} SCOP: d.58.1.2 PDB: 3pcq_C* 1k0t_A 2wsc_C* 2wse_C* 2wsf_C* 3lw5_C* 2o01_C* Back     alignment and structure
>1doi_A 2Fe-2S ferredoxin; halophilic protein, redox protein, iron-sulfur, electron transport; 1.90A {Haloarcula marismortui} SCOP: d.15.4.1 PDB: 1e0z_A* 1e10_A Back     alignment and structure
>1rgv_A Ferredoxin; electron transport; 2.90A {Thauera aromatica} SCOP: d.58.1.1 Back     alignment and structure
>3hui_A Ferredoxin; cytochrome P450, electron transfer, iron, iron-sulfur, metal-binding, electron transport; 2.01A {Rhodopseudomonas palustris} Back     alignment and structure
>3i9v_9 NADH-quinone oxidoreductase subunit 9; electron transport, respiratory chain, cell flavoprotein, FMN, iron, iron-sulfur, membrane; HET: FMN; 3.10A {Thermus thermophilus} PDB: 2ybb_8* 2fug_9* 3iam_9* 3ias_9* 3m9s_9* Back     alignment and structure
>1uwm_A Ferredoxin VI, FDVI; electron transport, metal-binding, iron-sulfur, iron, 2Fe-2S; 2.0A {Rhodobacter capsulatus} SCOP: d.15.4.1 PDB: 1e9m_A Back     alignment and structure
>1c0p_A D-amino acid oxidase; alpha-beta-alpha motif, flavin containing protein, oxidoreductase; HET: FAD; 1.20A {Rhodosporidium toruloides} SCOP: c.4.1.2 d.16.1.3 PDB: 1c0i_A* 1c0l_A* 1c0k_A* Back     alignment and structure
>2y5c_A Adrenodoxin-like protein, mitochondrial; electron transport, iron-sulfur cluster biogenesis; 1.70A {Homo sapiens} Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>2zvs_A Uncharacterized ferredoxin-like protein YFHL; electron transport, [4Fe-4S] clusters, iron-SULF clusters, reduction potential; 1.65A {Escherichia coli} Back     alignment and structure
>1xer_A Ferredoxin; electron transport, iron-sulfur, duplication; 2.00A {Sulfolobus tokodaii str} SCOP: d.58.1.3 PDB: 2vkr_A Back     alignment and structure
>2fgo_A Ferredoxin; allochromatium vinosum, [4Fe-4S] cluster, reduction potential, iron binding protein electron transport; 1.32A {Pseudomonas aeruginosa} Back     alignment and structure
>3ihg_A RDME; flavoenzyme, anthracycline, polyketide biosynthesis, merohedral twinning, enzyme mechanism, hydroxylase, flavoprotein; HET: FAD VAK; 2.49A {Streptomyces purpurascens} Back     alignment and structure
>3i3l_A Alkylhalidase CMLS; flavin-dependent halogenase, chloramphenicol biosynthesis, halogenation reaction, structural genomics; HET: FAD; 2.20A {Streptomyces venezuelae} Back     alignment and structure
>1rof_A Ferredoxin; electron transport, iron-sulfur; NMR {Thermotoga maritima} SCOP: d.58.1.4 PDB: 1vjw_A Back     alignment and structure
>2ywl_A Thioredoxin reductase related protein; uncharacterized conserved protein, rossmann fold, structural genomics, NPPSFA; HET: FAD; 1.60A {Thermus thermophilus} PDB: 2cvj_A* Back     alignment and structure
>1bc6_A 7-Fe ferredoxin; electron transport, iron-sulfur; NMR {Bacillus schlegelii} SCOP: d.58.1.2 PDB: 1bd6_A 1bqx_A 1bwe_A Back     alignment and structure
>1hfe_L Protein (Fe-only hydrogenase (E.C.1.18.99.1) (larger subunit)); hydrogene metabolism, periplasm; 1.60A {Desulfovibrio vulgaris subsp} SCOP: c.96.1.1 d.58.1.5 PDB: 1e08_A* 1gx7_A* Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>3eun_A Ferredoxin; electron transport, [4Fe-4S] cluster, 4Fe-4S, iron, iron-sulfur, metal-binding, transport; 1.05A {Allochromatium vinosum} SCOP: d.58.1.1 PDB: 1blu_A 3exy_A Back     alignment and structure
>1krh_A Benzoate 1,2-dioxygenase reductase; alpha-beta, FAD-binding, ferredoxin, NADH-binding, oxidoreductase; HET: FAD; 1.50A {Acinetobacter SP} SCOP: b.43.4.2 c.25.1.2 d.15.4.2 Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>3fim_B ARYL-alcohol oxidase; AAO, lignin degradation, oxidoreductase, flavoprotein; HET: FAD; 2.55A {Pleurotus eryngii} Back     alignment and structure
>7fd1_A FD1, protein (7-Fe ferredoxin I); electron transport, iron-sulfur; 1.30A {Azotobacter vinelandii} SCOP: d.58.1.2 PDB: 1fda_A 1fdb_A 1fer_A 1axq_A 5fd1_A 6fdr_A 6fd1_A 7fdr_A 1frh_A 1fri_A 1fdd_A 1frl_A 1d3w_A 1frm_A 1frx_A 1g6b_A 1pc4_A 1frj_A 2fd2_A 1fd2_A ... Back     alignment and structure
>3fmw_A Oxygenase; mithramycin, baeyer-villiger, flavin binding protein, oxidoreductase; HET: FAD; 2.89A {Streptomyces argillaceus} Back     alignment and structure
>1dwl_A Ferredoxin I; electron transfer, model, heteronuclear docking; HET: HEC; NMR {Desulfomicrobium norvegicum} SCOP: i.4.1.1 Back     alignment and structure
>2bry_A NEDD9 interacting protein with calponin homology and LIM domains; transport, coiled coil, cytoskeleton, FAD, flavoprotein, metal-binding, zinc; HET: FAD; 1.45A {Mus musculus} PDB: 2c4c_A* 2bra_A* Back     alignment and structure
>3ics_A Coenzyme A-disulfide reductase; pyridine nucleotide-disulfide oxidoreductase class I, rhodan coenzyme A, flavin adenine dinucleotide; HET: FAD COA ADP; 1.94A {Bacillus anthracis} PDB: 3icr_A* 3ict_A* Back     alignment and structure
>1k0i_A P-hydroxybenzoate hydroxylase; PHBH, FAD, P-OHB, hydrolase; HET: FAD PHB; 1.80A {Pseudomonas aeruginosa} SCOP: c.3.1.2 d.16.1.2 PDB: 1k0j_A* 1k0l_A* 1doc_A* 1d7l_A* 1dod_A* 1doe_A* 1ius_A* 1iut_A* 1iuu_A* 1iuv_A* 1iuw_A* 1iux_A* 1pxb_A* 1pxc_A* 1dob_A* 1ykj_A* 1pxa_A* 1pbe_A* 1pdh_A* 1phh_A* ... Back     alignment and structure
>1f2g_A Ferredoxin II; electron transport, FDII desulfovibrio gigas; NMR {Desulfovibrio gigas} SCOP: d.58.1.4 PDB: 1fxd_A Back     alignment and structure
>4a5l_A Thioredoxin reductase; oxidoreductase, redox metabolism, oxidative stress; HET: NDP FAD; 1.66A {Entamoeba histolytica} PDB: 4a65_A* Back     alignment and structure
>1dax_A Ferredoxin I; electron transport, electron-transfer protein, 4Fe-4S cluster; NMR {Desulfovibrio africanus} SCOP: d.58.1.4 PDB: 1dfd_A 1fxr_A Back     alignment and structure
>1h98_A Ferredoxin; electron transport, thermophilic, iron-sulfur, azotobacter, hydrogen bonds, stability, high resolution; 1.64A {Thermus aquaticus} SCOP: d.58.1.2 Back     alignment and structure
>2x3n_A Probable FAD-dependent monooxygenase; oxidoreductase; HET: FAD; 1.75A {Pseudomonas aeruginosa} Back     alignment and structure
>2c42_A Pyruvate-ferredoxin oxidoreductase; 4Fe-4S, iron, iron-sulfur, iron-sulfur cluster, pyruvate catabolism, TPP-dependent enzyme; HET: TPP; 1.78A {Desulfovibrio africanus} SCOP: c.36.1.8 c.36.1.12 c.48.1.3 c.64.1.1 d.58.1.5 PDB: 1b0p_A* 1kek_A* 2c3o_A* 2c3p_A* 2c3u_A* 2c3y_A* 2c3m_A* 2pda_A* 2uza_A* Back     alignment and structure
>2qa2_A CABE, polyketide oxygenase CABE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 2.70A {Streptomyces} Back     alignment and structure
>3c96_A Flavin-containing monooxygenase; FAD, oxidoreductase, PF01266, NESG, PAR240, structural genomics, PSI-2; HET: FAD; 1.90A {Pseudomonas aeruginosa PAO1} SCOP: c.3.1.2 d.16.1.2 PDB: 2rgj_A* Back     alignment and structure
>3n9z_C Adrenodoxin; cytochrome P450, 22-hydroxycholesterol, cholesterol SIDE CHA cleavage, structural genomics; HET: HEM HC9; 2.17A {Homo sapiens} SCOP: d.15.4.1 PDB: 3na1_C* 3p1m_A* 1l6u_A 1l6v_A 1e6e_B* 1cje_A Back     alignment and structure
>2v2k_A Ferredoxin; iron, transport, iron-sulfur, mycobacterium tuberculosis, Fe cluster, metal-binding, electron transfer, transport; 1.6A {Mycobacterium smegmatis} Back     alignment and structure
>2weu_A Tryptophan 5-halogenase; regioselectivity, antifungal protei; HET: TRP; 1.70A {Streptomyces rugosporus} PDB: 2wet_A* 2wes_A* Back     alignment and structure
>2r0c_A REBC; flavin adenine dinucleotide, monooxygenase, oxidoreductase; HET: FAD; 1.80A {Lechevalieria aerocolonigenes} PDB: 2r0g_A* 2r0p_A* 3ept_A* Back     alignment and structure
>1iqz_A Ferredoxin; iron-sulfer protein, ultlahigh resolution analysis, geometry of [4Fe-4S] cluster, electron transport; 0.92A {Bacillus thermoproteolyticus} SCOP: d.58.1.4 PDB: 1ir0_A 1wtf_A* Back     alignment and structure
>3fpz_A Thiazole biosynthetic enzyme; FAD, mitochondrion, N thiamine biosynthesis, transit peptide, biosynthetic protei; HET: AHZ; 1.82A {Saccharomyces cerevisiae} Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>3gyx_B Adenylylsulfate reductase; oxidoreductase; HET: FAD; 3.20A {Desulfovibrio gigas} Back     alignment and structure
>2qa1_A PGAE, polyketide oxygenase PGAE; FAD, angucycline, aromatic hydroxylase, oxidored; HET: FAD; 1.80A {Streptomyces} Back     alignment and structure
>1jnr_B Adenylylsulfate reductase; oxidoreductase; HET: FAD; 1.60A {Archaeoglobus fulgidus dsm 4304} SCOP: d.58.1.5 PDB: 1jnz_B* 2fja_B* 2fjb_B* 2fjd_B* 2fje_B* Back     alignment and structure
>2lfc_A Fumarate reductase, flavoprotein subunit; structural genomics, northeast structural genomics consortiu PSI-biology; NMR {Lactobacillus plantarum} Back     alignment and structure
>3iwa_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; structural genomics, PSI-2, protein structur initiative; 2.30A {Desulfovibrio vulgaris} Back     alignment and structure
>2aqj_A Tryptophan halogenase, pRNA; flavin-dependent halogenase, helical bundle, sandwiched sheets, structural genomics; HET: TRP FAD; 1.80A {Pseudomonas fluorescens} PDB: 2apg_A* 2ar8_A* 2ard_A* 2jkc_A* Back     alignment and structure
>1sj1_A Ferredoxin; thermostability, iron-sulfur cluster, hexammine cobalt(III), electron transport; HET: NCO; 1.50A {Pyrococcus furiosus} SCOP: d.58.1.4 PDB: 1siz_A* 2z8q_A 3pni_A Back     alignment and structure
>2e4g_A Tryptophan halogenase; flavin-binding, rebeccamycin biosynthesis, biosynthetic protein, flavoprotein; HET: TRP; 2.08A {Lechevalieria aerocolonigenes} PDB: 2o9z_A 2oa1_A* 2oal_A* 2oam_A Back     alignment and structure
>2pyx_A Tryptophan halogenase; structural genomics, JOI for structural genomics, JCSG, protein structure initiative biosynthetic protein; HET: MSE TLA PG4; 1.50A {Shewanella frigidimarina} Back     alignment and structure
>2vou_A 2,6-dihydroxypyridine hydroxylase; oxidoreductase, aromatic hydroxylase, nicotine degradation, mono-oxygenase; HET: FAD; 2.6A {Arthrobacter nicotinovorans} SCOP: c.3.1.2 d.16.1.2 Back     alignment and structure
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>3alj_A 2-methyl-3-hydroxypyridine-5-carboxylic acid OXYG; alpha/beta fold, oxidoreductase; HET: FAD; 1.48A {Mesorhizobium loti} PDB: 3alh_A* 3ali_A* 3gmb_A* 3gmc_A* 3alk_A* 3alm_A* 3all_A* Back     alignment and structure
>2dkh_A 3-hydroxybenzoate hydroxylase; flavoprotein, monooxygenase, complex, oxidoreductase; HET: FAD 3HB; 1.80A {Comamonas testosteroni} PDB: 2dki_A* Back     alignment and structure
>1ti6_B Pyrogallol hydroxytransferase small subunit; molybdenum binding enzyme, MGD-cofactors, DMSO-reductase family, 4Fe-4S-cluster; HET: MGD BTT; 2.00A {Pelobacter acidigallici} SCOP: b.3.5.1 d.58.1.5 PDB: 1ti2_B* 1ti4_B* 1vld_N* 1vle_N* 1vlf_N* Back     alignment and structure
>2ivf_B Ethylbenzene dehydrogenase beta-subunit; anaerobic hydrocarbon degradation, MOCO, Fe/S cluster, MO- B enzyme, DMSO reductase family; HET: MES MGD MD1 HEM; 1.88A {Aromatoleum aromaticum} Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>1q16_B Respiratory nitrate reductase 1 beta chain; membrane protein, electron-transfer, oxidoreductase; HET: FME MD1 HEM AGA 3PH; 1.90A {Escherichia coli} SCOP: d.58.1.5 PDB: 1r27_B* 1siw_B* 1y5i_B* 1y5l_B* 1y5n_B* 3ir5_B* 3ir6_B* 3ir7_B* 1y4z_B* 3egw_B* Back     alignment and structure
>3rp8_A Flavoprotein monooxygenase; FAD-binding protein, oxidoreductase; HET: FAD; 1.97A {Klebsiella pneumoniae} PDB: 3rp7_A* 3rp6_A* Back     alignment and structure
>2pia_A Phthalate dioxygenase reductase; HET: FMN; 2.00A {Burkholderia cepacia} SCOP: b.43.4.2 c.25.1.2 d.15.4.2 Back     alignment and structure
>3t37_A Probable dehydrogenase; BET alpha beta fold, ADP binding, oxidoreductase; HET: FAD; 2.19A {Mesorhizobium loti} Back     alignment and structure
>2ivf_B Ethylbenzene dehydrogenase beta-subunit; anaerobic hydrocarbon degradation, MOCO, Fe/S cluster, MO- B enzyme, DMSO reductase family; HET: MES MGD MD1 HEM; 1.88A {Aromatoleum aromaticum} Back     alignment and structure
>1kqf_B FDH-N beta S, formate dehydrogenase, nitrate-inducible, iron-SU subunit; oxidoreductase, selenium, selenocysteine, seCys, molybdenum; HET: MGD HEM CDL; 1.60A {Escherichia coli} SCOP: d.58.1.5 f.23.22.1 PDB: 1kqg_B* Back     alignment and structure
>2xve_A Flavin-containing monooxygenase; oxidoreductase; HET: FAD; 1.99A {Methylophaga aminisulfidivorans} PDB: 2xvf_A* 2xvh_A* 2xvi_A* 2xvj_A* 2xlt_A* 2vqb_A* 2vq7_A* 2xlu_A* 2xlp_A* 2xls_A* 2xlr_A* Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>1y56_A Hypothetical protein PH1363; dehydrogenase, protein-protein complex, oxidoreductase; HET: FAD FMN ATP CXS; 2.86A {Pyrococcus horikoshii} Back     alignment and structure
>3zyy_X Iron-sulfur cluster binding protein; iron-sulfur-binding protein, ashka family, ATPase; 2.20A {Carboxydothermus hydrogenoformans} Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>3gwf_A Cyclohexanone monooxygenase; flavoprotein biocatalysis baeyer-villiger oxidation green CH monooxygenase, oxidoreductase; HET: FAD NAP; 2.20A {Rhodococcus SP} PDB: 3gwd_A* 3ucl_A* Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>2vpz_B NRFC protein; oxidoreductase, molybdopterin guanine dinucleotide, iron-sulfur, metal-binding, molybdopterin; HET: MGD; 2.40A {Thermus thermophilus} PDB: 2vpx_B* 2vpw_B* 2vpy_B* Back     alignment and structure
>1n4w_A CHOD, cholesterol oxidase; flavoenzyme, steroid metabolism, oxidoreductase, atomic RESO; HET: FAD; 0.92A {Streptomyces SP} SCOP: c.3.1.2 d.16.1.1 PDB: 1b4v_A* 1n1p_A* 1n4u_A* 1n4v_A* 1mxt_A* 2gew_A* 1b8s_A* 3gyi_A* 1cc2_A* 3gyj_A* 1ijh_A* 1cbo_A* 3b3r_A* 3b6d_A* 3cnj_A* Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>1gpe_A Protein (glucose oxidase); oxidoreductase(flavoprotein); HET: NAG BMA MAN FAD; 1.80A {Penicillium amagasakiense} SCOP: c.3.1.2 d.16.1.1 Back     alignment and structure
>2xdo_A TETX2 protein; tetracycline degradation, tigecycline, flavin, bacteroides F oxidoreductase; HET: FAD; 2.09A {Bacteroides thetaiotaomicron} PDB: 2y6q_A* 2xyo_A* 2y6r_A* 3p9u_A* Back     alignment and structure
>2vpz_B NRFC protein; oxidoreductase, molybdopterin guanine dinucleotide, iron-sulfur, metal-binding, molybdopterin; HET: MGD; 2.40A {Thermus thermophilus} PDB: 2vpx_B* 2vpw_B* 2vpy_B* Back     alignment and structure
>2vdc_G Glutamate synthase [NADPH] small chain; oxidoreductase, amidotransferase, ammonia assimilation, iron, zymogen; HET: OMT FMN AKG FAD; 9.50A {Azospirillum brasilense} Back     alignment and structure
>2jbv_A Choline oxidase; alcohol oxidation, flavoenyzme oxidase, covalently linked FAD, C4A-adduct, flavoprotein, oxidoreductase; HET: FAO; 1.86A {Arthrobacter globiformis} PDB: 3nne_A* 3ljp_A* Back     alignment and structure
>4ap3_A Steroid monooxygenase; oxidoreductase, baeyer-villiger; HET: FAD NAP; 2.39A {Rhodococcus rhodochrous} PDB: 4aox_A* 4aos_A* 4ap1_A* Back     alignment and structure
>1q16_B Respiratory nitrate reductase 1 beta chain; membrane protein, electron-transfer, oxidoreductase; HET: FME MD1 HEM AGA 3PH; 1.90A {Escherichia coli} SCOP: d.58.1.5 PDB: 1r27_B* 1siw_B* 1y5i_B* 1y5l_B* 1y5n_B* 3ir5_B* 3ir6_B* 3ir7_B* 1y4z_B* 3egw_B* Back     alignment and structure
>1h0h_B Formate dehydrogenase (small subunit); tungsten selenium formate dehydrogenase, selenocysteine, molybdopterin, MGD, iron-sulphur cluster; HET: 2MD MGD EPE; 1.8A {Desulfovibrio gigas} SCOP: d.58.1.5 Back     alignment and structure
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Back     alignment and structure
>1coy_A Cholesterol oxidase; oxidoreductase(oxygen receptor); HET: AND FAD; 1.80A {Brevibacterium sterolicum} SCOP: c.3.1.2 d.16.1.1 PDB: 3cox_A* Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>1kqf_B FDH-N beta S, formate dehydrogenase, nitrate-inducible, iron-SU subunit; oxidoreductase, selenium, selenocysteine, seCys, molybdenum; HET: MGD HEM CDL; 1.60A {Escherichia coli} SCOP: d.58.1.5 f.23.22.1 PDB: 1kqg_B* Back     alignment and structure
>2a87_A TRXR, TR, thioredoxin reductase; FAD, NAP, NMA, TLS, oxidoreduct structural genomics, PSI, protein structure initiative; HET: FAD NAP; 3.00A {Mycobacterium tuberculosis} Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>3kd9_A Coenzyme A disulfide reductase; PSI-II, NYSGXRC, oxidoreductase, structural genomics structure initiative; 2.75A {Pyrococcus horikoshii} Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3fbs_A Oxidoreductase; structural genomics, PSI2, MCSG, protein STR initiative, midwest center for structural genomics; HET: FAD; 2.15A {Agrobacterium tumefaciens} Back     alignment and structure
>3unc_A Xanthine dehydrogenase/oxidase; oxidoreductase; HET: MTE FAD SAL; 1.65A {Bos taurus} PDB: 3una_A* 3uni_A* 1v97_A* 1fo4_A* 1vdv_A* 3am9_A* 3amz_A* 3ax7_A* 3ax9_A* 3bdj_A* 1n5x_A* 2ckj_A* 2e1q_A* 3an1_A* 2e3t_A* 1wyg_A* 3b9j_B* 1fiq_B* 3b9j_A* 1fiq_A* Back     alignment and structure
>1w4x_A Phenylacetone monooxygenase; baeyer-villiger, FAD; HET: FAD; 1.7A {Thermobifida fusca} SCOP: c.3.1.5 c.3.1.5 PDB: 2ylr_A* 2yls_A* 2ylt_A* 2ym1_A* 2ylw_A* 2ym2_A* 2ylx_A* 2ylz_A* Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>3uox_A Otemo; baeyer-villiger monooxygenase, oxidoreductase; HET: FAD; 1.96A {Pseudomonas putida} PDB: 3uov_A* 3uoy_A* 3uoz_A* 3up4_A* 3up5_A* Back     alignment and structure
>4gcm_A TRXR, thioredoxin reductase; FAD/NAD-linked reductases, PYR redox 2 family, structural GE joint center for structural genomics, JCSG; HET: MSE FAD NAP EPE; 1.80A {Staphylococcus aureus subsp} Back     alignment and structure
>1trb_A Thioredoxin reductase; oxidoreductase(flavoenzyme); HET: FAD; 2.00A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 PDB: 1cl0_A* 1f6m_A* 1tdf_A* 1tde_A* Back     alignment and structure
>3cty_A Thioredoxin reductase; FAD, oxidoreductase, flavin, flavoprotein; HET: FAD; 2.35A {Thermoplasma acidophilum} Back     alignment and structure
>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* Back     alignment and structure
>1ti6_B Pyrogallol hydroxytransferase small subunit; molybdenum binding enzyme, MGD-cofactors, DMSO-reductase family, 4Fe-4S-cluster; HET: MGD BTT; 2.00A {Pelobacter acidigallici} SCOP: b.3.5.1 d.58.1.5 PDB: 1ti2_B* 1ti4_B* 1vld_N* 1vle_N* 1vlf_N* Back     alignment and structure
>1ju2_A HydroxynitrIle lyase; flavin, GMC oxidoreductase, almond, cyanogenesis; HET: NAG NDG FUC BMA MAN FAD; 1.47A {Prunus dulcis} SCOP: c.3.1.2 d.16.1.1 PDB: 3gdp_A* 3gdn_A* Back     alignment and structure
>1kdg_A CDH, cellobiose dehydrogenase; GMC oxidoreductase, PHBH fold, alpha/beta structure, rossman 6-hydroxylated FAD, oxidoreductase; HET: NAG MAN 6FA EMT; 1.50A {Phanerochaete chrysosporium} SCOP: c.3.1.2 d.16.1.1 PDB: 1naa_A* Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>3g5s_A Methylenetetrahydrofolate--tRNA-(uracil-5-)- methyltransferase TRMFO; tRNA methyltransferase FAD folate, FAD, flavoprotein; HET: MSE FAD GSH; 1.05A {Thermus thermophilus} PDB: 3g5q_A* 3g5r_A* Back     alignment and structure
>3klj_A NAD(FAD)-dependent dehydrogenase, NIRB-family (N- domain); FAD-binding protein, GR-fold, oxidoreductase; HET: FAD; 2.10A {Clostridium acetobutylicum} Back     alignment and structure
>1cjc_A Protein (adrenodoxin reductase); flavoenzyme, MAD analysis, electron transferase, oxidoreductase; HET: FAD; 1.70A {Bos taurus} SCOP: c.3.1.1 c.4.1.1 PDB: 1e1k_A* 1e1l_A* 1e1m_A* 1e1n_A* 1e6e_A* Back     alignment and structure
>3itj_A Thioredoxin reductase 1; disulfide B flavoprotein, NADP, oxidoreductase, phosphoprotein, redox-A center; HET: FAD CIT; 2.40A {Saccharomyces cerevisiae} PDB: 3d8x_A* Back     alignment and structure
>1xhc_A NADH oxidase /nitrite reductase; southe collaboratory for structural genomics, secsg, hyperthermoph protein structure initiative, PSI; HET: FAD; 2.35A {Pyrococcus furiosus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>1fl2_A Alkyl hydroperoxide reductase subunit F; reactive oxygen, FAD, disulphi oxidoreductase, oxidoreductase; HET: FAD; 1.90A {Escherichia coli} SCOP: c.3.1.5 c.3.1.5 Back     alignment and structure
>3sx6_A Sulfide-quinone reductase, putative; sulfide:quinone oxidoreductase, Cys356Ala variant, integral membrane protein; HET: FAD LMT DCQ; 1.80A {Acidithiobacillus ferrooxidans} PDB: 3t0k_A* 3szc_A* 3sz0_A* 3t2z_A* 3t31_A* 3sy4_A* 3syi_A* 3sxi_A* 3t14_A* 3t2k_A* 3szw_A* 3szf_A* 3kpg_A* 3kpi_A* 3t2y_A* 3kpk_A* Back     alignment and structure
>1pn0_A Phenol 2-monooxygenase; two dimers, TLS refinement, oxidoreductase; HET: FAD; 1.70A {Trichosporon cutaneum} SCOP: c.3.1.2 c.47.1.10 d.16.1.2 PDB: 1foh_A* Back     alignment and structure
>3pl8_A Pyranose 2-oxidase; substrate complex, H167A mutant, homotetramer, GMC oxidoredu PHBH fold, rossmann domain, oxidoreductase; HET: FAD MES G3F; 1.35A {Trametes ochracea} PDB: 2igo_A* 3lsm_A* 2ign_A* 3k4c_A* 1tt0_A* 2igk_A* 3k4b_A* 3lsk_A* 3bg6_A* 3lsh_A* 3lsi_A* 2igm_A* 3k4j_A* 3k4m_A* 3bg7_A* 3k4k_A* 3k4l_A* 3bly_A* 1tzl_A* 3fdy_A* ... Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>3vrd_B FCCB subunit, flavocytochrome C flavin subunit; sulfide oxidation, heme C binding, FAD binding, electron TRA oxidoreductase complex; HET: HEC FAD; 1.50A {Thermochromatium tepidum} PDB: 1fcd_A* Back     alignment and structure
>3zyv_A AOH1; oxidoreductase, molybdenum cofactor; HET: MTE FAD; 2.54A {Mus musculus} Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>3fg2_P Putative rubredoxin reductase; ferredoxin reductase, RPA3782, F flavoprotein, oxidoreductase; HET: FAD; 2.20A {Rhodopseudomonas palustris} Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>2gmh_A Electron transfer flavoprotein-ubiquinone oxidoreductase; HET: BHG FAD UQ5; 2.50A {Sus scrofa} SCOP: c.3.1.2 d.16.1.8 d.58.1.6 PDB: 2gmj_A* Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>1lqt_A FPRA; NADP+ derivative, oxidoreductase, structural G PSI, protein structure initiative, TB structural genomics consortium, TBSGC; HET: FAD ODP; 1.05A {Mycobacterium tuberculosis} SCOP: c.3.1.1 c.4.1.1 PDB: 1lqu_A* 2c7g_A* Back     alignment and structure
>3ntd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; COA, persulfide reductase, rhodanese; HET: COA FAD; 1.99A {Shewanella loihica} PDB: 3nta_A* 3nt6_A* Back     alignment and structure
>1h0h_B Formate dehydrogenase (small subunit); tungsten selenium formate dehydrogenase, selenocysteine, molybdopterin, MGD, iron-sulphur cluster; HET: 2MD MGD EPE; 1.8A {Desulfovibrio gigas} SCOP: d.58.1.5 Back     alignment and structure
>2gqw_A Ferredoxin reductase; flavoprotein, oxidoreductase; HET: FAD; 1.40A {Pseudomonas SP} PDB: 1f3p_A* 1d7y_A* 2gr0_A* 2gr1_A* 2gr2_A* 2yvf_A* 2yvg_A* 2yvj_A* 2gr3_A* Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>3cgb_A Pyridine nucleotide-disulfide oxidoreductase, CLA; coenzyme A, flavin adenine dinucleotide, selenomethionine, F flavoprotein; HET: COA FAD; 1.90A {Bacillus anthracis str} PDB: 3cgc_A* 3cgd_A* 3cge_A* Back     alignment and structure
>2bc0_A NADH oxidase; flavoprotein, pyridine nucleotide disulfide oxidoreductase, C(4A)-peroxyflavin, crystallography, conformational dynamics; HET: FAD; 2.00A {Streptococcus pyogenes} PDB: 2bcp_A* 2bc1_A* Back     alignment and structure
>3h8l_A NADH oxidase; membrane protein, complete form, rossman-like fold, oxidoreductase; HET: FAD; 2.57A {Acidianus ambivalens} PDB: 3h8i_A* Back     alignment and structure
>2v3a_A Rubredoxin reductase; alkane degradation, NADH oxidoreductase, rubredoxin reductas NAD, flavoprotein, oxidoreductase; HET: FAD; 2.4A {Pseudomonas aeruginosa} PDB: 2v3b_A* Back     alignment and structure
>1mo9_A ORF3; nucleotide binding motifs, nucleotide binding domain, oxidor; HET: FAD KPC; 1.65A {Xanthobacter autotrophicus} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1mok_A* 2c3c_A* 2c3d_A* 3q6j_A* Back     alignment and structure
>3r9u_A Thioredoxin reductase; structural genomics, center for structural genomics of infec diseases, csgid, thioredoxin-disulfide reductase, FAD; HET: FAD; 2.36A {Campylobacter jejuni} Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>3mm5_A Sulfite reductase, dissimilatory-type subunit ALP; alpha-beta-protein, oxidoreductase; HET: SRM; 1.80A {Archaeoglobus fulgidus} PDB: 3mm6_A* 3mm7_A* 3mm8_A* 3mm9_A* 3mma_A* 3mmb_A* 3mmc_A* 3c7b_A* Back     alignment and structure
>3mm5_B Sulfite reductase, dissimilatory-type subunit BET; alpha-beta-protein, oxidoreductase; HET: SRM; 1.80A {Archaeoglobus fulgidus} PDB: 3c7b_B* 3mm6_B* 3mm7_B* 3mm8_B* 3mm9_B* 3mma_B* 3mmb_B* 3mmc_B* Back     alignment and structure
>4hb9_A Similarities with probable monooxygenase; flavin, structural genomics, NEW YORK structural genomics RE consortium, nysgrc, PSI; HET: MSE FAD; 1.93A {Photorhabdus luminescens} Back     alignment and structure
>3hyw_A Sulfide-quinone reductase; monotopic membrane protein, flavoprotein, polysulfur, oxidoreductase; HET: FAD DCQ LMT; 2.00A {Aquifex aeolicus} PDB: 3hyv_A* 3hyx_A* Back     alignment and structure
>1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* Back     alignment and structure
>3ab1_A Ferredoxin--NADP reductase; oxidoreductase, electron transport, FAD, flavoprotein; HET: FAD; 2.39A {Chlorobaculum tepidum} Back     alignment and structure
>1m6i_A Programmed cell death protein 8; apoptosis, AIF, oxidoreductase; HET: FAD; 1.80A {Homo sapiens} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 3gd3_A* 3gd4_A* 1gv4_A* Back     alignment and structure
>2zbw_A Thioredoxin reductase; redox protein, oxidoreductase, structural genomics, NPPSFA, project on protein structural and functional analyses; HET: FAD; 2.10A {Thermus thermophilus} Back     alignment and structure
>1nhp_A NADH peroxidase; oxidoreductase (H2O2(A)); HET: FAD; 2.00A {Enterococcus faecalis} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1npx_A* 1joa_A* 2npx_A* 1nhq_A* 1nhs_A* 1nhr_A* 1f8w_A* Back     alignment and structure
>2q7v_A Thioredoxin reductase; rossman fold, FAD, flavoprotein, oxidoreductase, redox- active center; HET: FAD; 1.90A {Deinococcus radiodurans} Back     alignment and structure
>2cul_A Glucose-inhibited division protein A-related PROT probable oxidoreductase; rossmann fold, protein-FAD complex; HET: FAD; 1.65A {Thermus thermophilus} SCOP: c.3.1.7 Back     alignment and structure
>3dgh_A TRXR-1, thioredoxin reductase 1, mitochondrial; oxidoreductase, rossmann, flavoprotein, alternative initiati mitochondrion, NADP; HET: FAD; 1.75A {Drosophila melanogaster} PDB: 2nvk_X* 3dh9_A* Back     alignment and structure
>3f8d_A Thioredoxin reductase (TRXB-3); redox protein, nucleotide binding, FAD, flavoprotein, oxidoreductase; HET: FAD; 1.40A {Sulfolobus solfataricus} PDB: 3f8p_A* 3f8r_A* Back     alignment and structure
>2q0l_A TRXR, thioredoxin reductase; bacterial thiredoxin reductase, NADP+ B reduced izoalloxazine bending, oxidoreductase; HET: FAD NAP; 1.45A {Helicobacter pylori} PDB: 2q0k_A* 3ish_A* Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>1v59_A Dihydrolipoamide dehydrogenase; 2-oxoacid dehydroganese complex, pyruvate dehydrogenase complex; HET: FAD NAD; 2.20A {Saccharomyces cerevisiae} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1jeh_A* Back     alignment and structure
>4g6h_A Rotenone-insensitive NADH-ubiquinone oxidoreducta mitochondrial; rossmann fold, electron transfer, FAD, oxidoreductase; HET: FAD NAD; 2.26A {Saccharomyces cerevisiae} PDB: 4g6g_A* 4g73_A* 4g74_A* 4g9k_A* 4gap_A* 4gav_A* Back     alignment and structure
>3lzw_A Ferredoxin--NADP reductase 2; ferredoxin reductase, FAD, NADPH, flavoprotein, oxidor; HET: FAD NAP; 1.80A {Bacillus subtilis} PDB: 3lzx_A* Back     alignment and structure
>1vdc_A NTR, NADPH dependent thioredoxin reductase; hypothetical protein, redox-active center, oxidoreductase, D oxidoreductase; HET: FAD; 2.50A {Arabidopsis thaliana} SCOP: c.3.1.5 c.3.1.5 PDB: 2whd_A* Back     alignment and structure
>3oc4_A Oxidoreductase, pyridine nucleotide-disulfide FAM; structural genomics, PSI-2, protein structure initiative; HET: FAD; 2.60A {Enterococcus faecalis} Back     alignment and structure
>3dgz_A Thioredoxin reductase 2; oxidoreductase, rossmann, flavoprotein, FAD, mitochondrion, redox-active center, selenium, selenocysteine, transit PEPT; HET: FAD NA7; 2.25A {Mus musculus} PDB: 1zkq_A* 1zdl_A* Back     alignment and structure
>1lvl_A Dihydrolipoamide dehydrogenase; oxidoreductase; HET: FAD NAD; 2.45A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>1q1r_A Putidaredoxin reductase; glutathione reductase fold, oxidoreductase; HET: FAD; 1.91A {Pseudomonas putida} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1q1w_A* 3lb8_A* Back     alignment and structure
>1vg0_A RAB proteins geranylgeranyltransferase component A 1; RAB prenylation, post-translational modification, protein binding/protein transport complex; HET: GER GDP PG4; 2.20A {Rattus norvegicus} SCOP: c.3.1.3 d.16.1.6 PDB: 1vg9_A* 1ltx_R* Back     alignment and structure
>3o0h_A Glutathione reductase; ssgcid, structur genomics, seattle structural genomics center for infectious gluathione reductase, oxidoreductase; HET: FAD; 1.90A {Bartonella henselae} Back     alignment and structure
>2gv8_A Monooxygenase; FMO, FAD, NADPH, cofactor complex, PSI, structura genomics, protein structure initiative; HET: FAD NDP; 2.10A {Schizosaccharomyces pombe} SCOP: c.3.1.5 c.3.1.5 PDB: 2gvc_A* 1vqw_A* Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>1zmd_A Dihydrolipoyl dehydrogenase; lipoamide dehydrogenase, pyruvate dehydrogenase, alpha- ketoglutarate dehydrogenase; HET: FAD NAI; 2.08A {Homo sapiens} PDB: 1zmc_A* 2f5z_A* 1zy8_A* 3rnm_A* Back     alignment and structure
>2hqm_A GR, grase, glutathione reductase; glutathione reductase complexed with FAD, oxidoreductase; HET: NAG FAD GSH; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4dna_A Probable glutathione reductase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; HET: FAD; 2.80A {Sinorhizobium meliloti} Back     alignment and structure
>3urh_A Dihydrolipoyl dehydrogenase; PSI-biology, structural genomics, protein structure initiati YORK structural genomics research consortium; HET: FAD; 1.90A {Sinorhizobium meliloti} Back     alignment and structure
>1fec_A Trypanothione reductase; redox-active center, oxidoreductase, flavoprotein, FAD, NADP; HET: FAD; 1.70A {Crithidia fasciculata} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 PDB: 1fea_A* 1feb_A* 2tpr_A* 1tyt_A* 1typ_A* 2jk6_A* 2w0h_A* 2yau_A* 2x50_A* 2ve2_A* Back     alignment and structure
>3d1c_A Flavin-containing putative monooxygenase; NP_373108.1, struc genomics, joint center for structural genomics, JCSG; HET: FAD UNL; 2.40A {Staphylococcus aureus} Back     alignment and structure
>2fdn_A Ferredoxin; electron transport, iron-sulfur, 4Fe-4S; 0.94A {Clostridium acidurici} SCOP: d.58.1.1 PDB: 1fdn_A 1fca_A 1clf_A 1dur_A Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>2fgo_A Ferredoxin; allochromatium vinosum, [4Fe-4S] cluster, reduction potential, iron binding protein electron transport; 1.32A {Pseudomonas aeruginosa} Back     alignment and structure
>2wpf_A Trypanothione reductase; oxidoreductase, trypanosomiasis, sleeping sickness, flavoPro redox-active center; HET: FAD WPF; 1.90A {Trypanosoma brucei} PDB: 2wov_A* 2wow_A* 2wp5_A* 2wp6_A* 2wpc_A* 2wpe_A* 2woi_A* 2wba_A* 1nda_A* 1gxf_A* 1bzl_A* 1aog_A* Back     alignment and structure
>3eun_A Ferredoxin; electron transport, [4Fe-4S] cluster, 4Fe-4S, iron, iron-sulfur, metal-binding, transport; 1.05A {Allochromatium vinosum} SCOP: d.58.1.1 PDB: 1blu_A 3exy_A Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>2pa8_D DNA-directed RNA polymerase subunit D; ferredoxin-like Fe-S binding motif, platform for RNA polymer assembly, transferase; 1.76A {Sulfolobus solfataricus} PDB: 2pmz_D 3hkz_D 2waq_D 2wb1_D 2y0s_D Back     alignment and structure
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>1jb0_C Photosystem I iron-sulfur center; membrane protein, multiprotein-pigment complex, photosynthes; HET: CL1 PQN BCR LHG LMG; 2.50A {Synechococcus elongatus} SCOP: d.58.1.2 PDB: 3pcq_C* 1k0t_A 2wsc_C* 2wse_C* 2wsf_C* 3lw5_C* 2o01_C* Back     alignment and structure
>1rgv_A Ferredoxin; electron transport; 2.90A {Thauera aromatica} SCOP: d.58.1.1 Back     alignment and structure
>1f2g_A Ferredoxin II; electron transport, FDII desulfovibrio gigas; NMR {Desulfovibrio gigas} SCOP: d.58.1.4 PDB: 1fxd_A Back     alignment and structure
>2cdu_A NADPH oxidase; flavoenzyme, oxidoreductase; HET: FAD ADP; 1.8A {Lactobacillus sanfranciscensis} Back     alignment and structure
>3ef6_A Toluene 1,2-dioxygenase system ferredoxin--NAD(+) reductase; FAD binding protein, NADH binding protein, aromatic hydrocar catabolism, FAD; HET: FAD; 1.80A {Pseudomonas putida} PDB: 4emi_A* 4emj_A* Back     alignment and structure
>4b63_A L-ornithine N5 monooxygenase; oxidoreductase, siderophore, flavin; HET: FAD NAP; 1.90A {Aspergillus fumigatus} PDB: 4b64_A* 4b65_A* 4b66_A* 4b67_A* 4b68_A* 4b69_A* Back     alignment and structure
>1rof_A Ferredoxin; electron transport, iron-sulfur; NMR {Thermotoga maritima} SCOP: d.58.1.4 PDB: 1vjw_A Back     alignment and structure
>2zvs_A Uncharacterized ferredoxin-like protein YFHL; electron transport, [4Fe-4S] clusters, iron-SULF clusters, reduction potential; 1.65A {Escherichia coli} Back     alignment and structure
>3dk9_A Grase, GR, glutathione reductase; flavoenzyme, nicotinamide, acetylation, alternative initiation, cytoplasm, FAD, flavoprotein, mitochondrion, NADP; HET: SO4 FAD; 0.95A {Homo sapiens} PDB: 1bwc_A* 1gra_A* 1gre_A* 1grf_A* 1grh_A* 1grb_A* 2gh5_A* 1gsn_A* 3dk4_A* 3dk8_A* 3djj_A* 3grs_A* 3sqp_A* 4gr1_A* 2aaq_A* 1dnc_A* 1grg_A* 1grt_A* 1xan_A* 5grt_A* ... Back     alignment and structure
>2gag_A Heterotetrameric sarcosine oxidase alpha-subunit; flavoenzyme, electron transfer, folate-ME enzyme, oxidoreductase; HET: NAD FAD FMN; 1.85A {Stenotrophomonas maltophilia} PDB: 2gah_A* 1x31_A* 1vrq_A* 3ad7_A* 3ad8_A* 3ad9_A* 3ada_A* Back     alignment and structure
>3lxd_A FAD-dependent pyridine nucleotide-disulphide oxidoreductase; glutathione reductase (GR)-like ONFR; HET: FAD; 2.50A {Novosphingobium aromaticivorans} Back     alignment and structure
>1dax_A Ferredoxin I; electron transport, electron-transfer protein, 4Fe-4S cluster; NMR {Desulfovibrio africanus} SCOP: d.58.1.4 PDB: 1dfd_A 1fxr_A Back     alignment and structure
>1xer_A Ferredoxin; electron transport, iron-sulfur, duplication; 2.00A {Sulfolobus tokodaii str} SCOP: d.58.1.3 PDB: 2vkr_A Back     alignment and structure
>1dxl_A Dihydrolipoamide dehydrogenase; oxidoreductase, multienzyme complex protein, pyruvate dehydrogenase complex, glycine decarboxylase complex; HET: FAD; 3.15A {Pisum sativum} SCOP: c.3.1.5 c.3.1.5 d.87.1.1 Back     alignment and structure
>3s5w_A L-ornithine 5-monooxygenase; class B flavin dependent N-hydroxylating monooxygenase, CLAS flavin dependent monooxygenase N-hydroxylating; HET: FAD ONH NAP; 1.90A {Pseudomonas aeruginosa} PDB: 3s61_A* Back     alignment and structure
>2hj1_A Hypothetical protein; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; 2.10A {Haemophilus influenzae} SCOP: d.15.3.4 Back     alignment and structure
>3or1_A Sulfite reductase alpha; dissimilatory sulfite reductase, sulfate reduction, oxidored sulfite reduction; HET: SRM; 1.76A {Desulfovibrio gigas} PDB: 3or2_A* 2v4j_A* 2xsj_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 786
d1neka2330 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase 2e-71
d1neka2330 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase 5e-21
d1chua2305 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {E 5e-59
d1chua2305 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {E 6e-11
d1kf6a2311 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Es 2e-56
d1kf6a2311 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Es 4e-07
d1neka3120 d.168.1.1 (A:236-355) Succinate dehydogenase {Esch 3e-49
d1jnra2356 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reduct 4e-47
d2bs2a2336 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wo 9e-47
d2bs2a2336 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wo 6e-07
d1kf6a3132 d.168.1.1 (A:226-357) Fumarate reductase {Escheric 4e-39
d2bs2a3121 d.168.1.1 (A:251-371) Fumarate reductase {Wolinell 3e-38
d1kf6b1138 a.1.2.1 (B:106-243) Fumarate reductase {Escherichi 1e-36
d1nekb1132 a.1.2.1 (B:107-238) Succinate dehydogenase {Escher 4e-36
d1neka1138 a.7.3.1 (A:451-588) Succinate dehydogenase {Escher 3e-35
d2bs2b1133 a.1.2.1 (B:107-239) Fumarate reductase {Wolinella 6e-32
d1chua3116 d.168.1.1 (A:238-353) L-aspartate oxidase {Escheri 1e-31
d1kf6a1134 a.7.3.1 (A:443-576) Fumarate reductase {Escherichi 7e-31
d2bs2a1198 a.7.3.1 (A:458-655) Fumarate reductase {Wolinella 7e-30
d1kf6b2105 d.15.4.2 (B:1-105) Fumarate reductase iron-sulfur 5e-28
d1y0pa2308 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 ( 8e-28
d1y0pa2308 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 ( 5e-12
d2bs2b2106 d.15.4.2 (B:1-106) Fumarate reductase iron-sulfur 1e-26
d1nekb2106 d.15.4.2 (B:1-106) Succinate dehydogenase iron-sul 1e-24
d1qo8a2317 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 ( 3e-23
d1qo8a2317 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 ( 2e-16
d1c0pa1268 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxida 1e-22
d1d4ca2322 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 ( 2e-21
d1d4ca2322 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 ( 2e-18
d1jnra1141 a.7.3.1 (A:503-643) Adenylylsulfate reductase A su 6e-20
d1qo8a3146 d.168.1.1 (A:360-505) Flavocytochrome c3 (respirat 1e-18
d1chua1111 a.7.3.1 (A:423-533) L-aspartate oxidase {Escherich 4e-18
d1y0pa3143 d.168.1.1 (A:362-504) Flavocytochrome c3 (respirat 2e-17
d1d4ca3146 d.168.1.1 (A:360-505) Flavocytochrome c3 (respirat 4e-17
d2i0za1251 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {B 8e-05
d2c42a5117 d.58.1.5 (A:669-785) Pyruvate-ferredoxin oxidoredu 0.001
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Length = 330 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain
domain: Succinate dehydogenase
species: Escherichia coli [TaxId: 562]

 Score =  235 bits (599), Expect = 2e-71
 Identities = 144/311 (46%), Positives = 191/311 (61%), Gaps = 4/311 (1%)

Query: 1   MRASLQLAQEGLNVAILSKVFPTRSHTVAAQGGISASLGNMSKDNWHWHMFDTIKGSDYL 60
           MRA+LQ++Q G   A+LSKVFPTRSHTV+AQGGI+ +LGN  +DNW WHM+DT+KGSDY+
Sbjct: 20  MRAALQISQSGQTCALLSKVFPTRSHTVSAQGGITVALGNTHEDNWEWHMYDTVKGSDYI 79

Query: 61  GDQDAIEFMCKEAPKVVYELEHFGMPFDRNKNGTIYQRPFGGHSSNFGEKPIARACAVAD 120
           GDQDAIE+MCK  P+ + ELEH G+PF R  +G IYQRPFGG S NFG +  AR  A AD
Sbjct: 80  GDQDAIEYMCKTGPEAILELEHMGLPFSRLDDGRIYQRPFGGQSKNFGGEQAARTAAAAD 139

Query: 121 RTGHALLHTLYQRNLHAKTNFFIEWMAIDLISDSEGDILGVVALEMETGNIMILESKITI 180
           RTGHALLHTLYQ+NL   T  F EW A+DL+ + +G ++G  AL +ETG ++  +++ T+
Sbjct: 140 RTGHALLHTLYQQNLKNHTTIFSEWYALDLVKNQDGAVVGCTALCIETGEVVYFKARATV 199

Query: 181 LATGGGGRIWAASTNAFINTGDGLGMAARAGLPLEDMEFWQFHPTGVAGAGVLITEGVRG 240
           LATGG GRI+ ++TNA INTGDG+GMA RAG+P    +     PT V G  + + E    
Sbjct: 200 LATGGAGRIYQSTTNAHINTGDGVGMAIRAGVP--VQDMMGGIPTKVTGQALTVNEKGED 257

Query: 241 EGGILINSNGERFMERYAPILKDLAPRDFVSRAMDQEIKEGRGCGPNKDHVML-DLRHIN 299
                + + GE            L     +   +              +   L D    +
Sbjct: 258 VVVPGLFAVGEIACVSVHG-ANRLGGNSLLDLVVFGRAAGLHLQESIAEQGALRDASESD 316

Query: 300 SETIINRLPSI 310
            E  ++RL   
Sbjct: 317 VEASLDRLNRW 327
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Length = 330 Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Length = 305 Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Length = 305 Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Length = 311 Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Length = 311 Back     information, alignment and structure
>d1neka3 d.168.1.1 (A:236-355) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Length = 120 Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 356 Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Length = 336 Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Length = 336 Back     information, alignment and structure
>d1kf6a3 d.168.1.1 (A:226-357) Fumarate reductase {Escherichia coli [TaxId: 562]} Length = 132 Back     information, alignment and structure
>d2bs2a3 d.168.1.1 (A:251-371) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Length = 121 Back     information, alignment and structure
>d1kf6b1 a.1.2.1 (B:106-243) Fumarate reductase {Escherichia coli [TaxId: 562]} Length = 138 Back     information, alignment and structure
>d1nekb1 a.1.2.1 (B:107-238) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Length = 132 Back     information, alignment and structure
>d1neka1 a.7.3.1 (A:451-588) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Length = 138 Back     information, alignment and structure
>d2bs2b1 a.1.2.1 (B:107-239) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Length = 133 Back     information, alignment and structure
>d1chua3 d.168.1.1 (A:238-353) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Length = 116 Back     information, alignment and structure
>d1kf6a1 a.7.3.1 (A:443-576) Fumarate reductase {Escherichia coli [TaxId: 562]} Length = 134 Back     information, alignment and structure
>d2bs2a1 a.7.3.1 (A:458-655) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Length = 198 Back     information, alignment and structure
>d1kf6b2 d.15.4.2 (B:1-105) Fumarate reductase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 105 Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 308 Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 308 Back     information, alignment and structure
>d2bs2b2 d.15.4.2 (B:1-106) Fumarate reductase iron-sulfur protein, N-terminal domain {Wolinella succinogenes [TaxId: 844]} Length = 106 Back     information, alignment and structure
>d1nekb2 d.15.4.2 (B:1-106) Succinate dehydogenase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]} Length = 106 Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 317 Back     information, alignment and structure
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 317 Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Length = 268 Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Length = 322 Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Length = 322 Back     information, alignment and structure
>d1jnra1 a.7.3.1 (A:503-643) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 141 Back     information, alignment and structure
>d1qo8a3 d.168.1.1 (A:360-505) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 146 Back     information, alignment and structure
>d1chua1 a.7.3.1 (A:423-533) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Length = 111 Back     information, alignment and structure
>d1y0pa3 d.168.1.1 (A:362-504) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Length = 143 Back     information, alignment and structure
>d1d4ca3 d.168.1.1 (A:360-505) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Length = 146 Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Length = 251 Back     information, alignment and structure
>d2c42a5 d.58.1.5 (A:669-785) Pyruvate-ferredoxin oxidoreductase, PFOR, domain V {Desulfovibrio africanus [TaxId: 873]} Length = 117 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query786
d1neka2330 Succinate dehydogenase {Escherichia coli [TaxId: 5 100.0
d1qo8a2317 Flavocytochrome c3 (respiratory fumarate reductase 100.0
d1y0pa2308 Flavocytochrome c3 (respiratory fumarate reductase 100.0
d1kf6a2311 Fumarate reductase {Escherichia coli [TaxId: 562]} 100.0
d1d4ca2322 Flavocytochrome c3 (respiratory fumarate reductase 100.0
d2bs2a2336 Fumarate reductase {Wolinella succinogenes [TaxId: 100.0
d1chua2305 L-aspartate oxidase {Escherichia coli [TaxId: 562] 100.0
d1neka1138 Succinate dehydogenase {Escherichia coli [TaxId: 5 100.0
d1kf6a1134 Fumarate reductase {Escherichia coli [TaxId: 562]} 99.97
d2bs2a1198 Fumarate reductase {Wolinella succinogenes [TaxId: 99.97
d1jnra2356 Adenylylsulfate reductase A subunit {Archaeon Arch 99.95
d2bs2a3121 Fumarate reductase {Wolinella succinogenes [TaxId: 99.95
d1jnra1141 Adenylylsulfate reductase A subunit {Archaeon Arch 99.95
d1kf6b2105 Fumarate reductase iron-sulfur protein, N-terminal 99.95
d2bs2b2106 Fumarate reductase iron-sulfur protein, N-terminal 99.93
d1neka3120 Succinate dehydogenase {Escherichia coli [TaxId: 5 99.93
d1nekb2106 Succinate dehydogenase iron-sulfur protein, N-term 99.92
d1kf6a3132 Fumarate reductase {Escherichia coli [TaxId: 562]} 99.92
d1chua3116 L-aspartate oxidase {Escherichia coli [TaxId: 562] 99.92
d1chua1111 L-aspartate oxidase {Escherichia coli [TaxId: 562] 99.89
d1nekb1132 Succinate dehydogenase {Escherichia coli [TaxId: 5 99.87
d1kf6b1138 Fumarate reductase {Escherichia coli [TaxId: 562]} 99.86
d2gqfa1253 Hypothetical protein HI0933 {Haemophilus influenza 99.84
d2bs2b1133 Fumarate reductase {Wolinella succinogenes [TaxId: 99.77
d2i0za1251 Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396] 99.72
d3c8ya2126 Fe-only hydrogenase, N-terminal domain {Clostridiu 99.11
d1qo8a3146 Flavocytochrome c3 (respiratory fumarate reductase 99.0
d1d4ca3146 Flavocytochrome c3 (respiratory fumarate reductase 98.93
d1ryia1276 Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} 98.84
d1pj5a2305 N,N-dimethylglycine oxidase {Arthrobacter globifor 98.73
d1h6va1235 Mammalian thioredoxin reductase {Rat (Rattus norve 98.71
d1y0pa3143 Flavocytochrome c3 (respiratory fumarate reductase 98.71
d1xdia1233 Dihydrolipoamide dehydrogenase {Mycobacterium tube 98.7
d1t3qa281 Quinoline 2-oxidoreductase small subunit QorS, N-d 98.69
d1rm6c281 4-hydroxybenzoyl-CoA reductase gamma subunit HrcC, 98.63
d1vlba280 Aldehyde oxidoreductase, N-terminal domain {Desulf 98.6
d1dxla1221 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 98.59
d2gf3a1281 Sarcosine oxidase {Bacillus sp., strain b0618 [Tax 98.56
d1dgja280 Aldehyde oxidoreductase, N-terminal domain {Desulf 98.54
d2fug3395 Nadh-quinone oxidoreductase chain 3, Nqo3, N-termi 98.53
d3grsa1221 Glutathione reductase {Human (Homo sapiens) [TaxId 98.45
d1ffva279 Carbone monoxide (CO) dehydrogenase iron-sulfur pr 98.44
d1ebda1223 Dihydrolipoamide dehydrogenase {Bacillus stearothe 98.4
d1n62a279 Carbone monoxide (CO) dehydrogenase iron-sulfur pr 98.36
d3c8ya383 Fe-only hydrogenase, second domain {Clostridium pa 98.32
d2c42a5117 Pyruvate-ferredoxin oxidoreductase, PFOR, domain V 98.31
d2fug34151 NADH-quinone oxidoreductase chain 3, Nqo3, domain 98.29
d1lvla1220 Dihydrolipoamide dehydrogenase {Pseudomonas putida 98.28
d1hfel285 Fe-only hydrogenase larger subunit, N-domain {Desu 98.22
d1mo9a1261 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 98.16
d3lada1229 Dihydrolipoamide dehydrogenase {Azotobacter vinela 98.16
d1jb0c_80 Photosystem I iron-sulfur protein PsaC {Synechococ 98.06
d2fdna_55 Ferredoxin II {Clostridium acidurici [TaxId: 1556] 98.03
d1jroa284 Xanthine dehydrogenase chain A, N-terminal domain 98.03
d2fug91154 NADH-quinone oxidoreductase chain 9, Nqo9 {Thermus 98.02
d1xera_103 Ferredoxin {Archaeon Sulfolobus sp. [TaxId: 2288]} 98.01
d1dura_55 Ferredoxin II {Peptostreptococcus asaccharolyticus 97.97
d1feca1240 Trypanothione reductase {Crithidia fasciculata [Ta 97.95
d1frra_95 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258] 97.82
d1czpa_98 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), 97.8
d1awda_94 2Fe-2S ferredoxin {Chlorella fusca [TaxId: 3073]} 97.8
d1a70a_97 2Fe-2S ferredoxin {Spinach (Spinacia oleracea) [Ta 97.71
d1rgva_80 Ferredoxin II {Thauera aromatica [TaxId: 59405]} 97.69
d1blua_80 Ferredoxin II {Chromatium vinosum [TaxId: 1049]} 97.67
d1jq4a_98 Methane monooxygenase reductase N-terminal domain 97.67
d1frda_98 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), 97.63
d1bc6a_77 Ferredoxin {Bacillus schlegelii [TaxId: 1484]} 97.62
d1doia_128 2Fe-2S ferredoxin {Archaeon Haloarcula marismortui 97.59
d1gtea5173 Dihydropyrimidine dehydrogenase, C-terminal domain 97.51
d1v97a290 Xanthine oxidase, N-terminal domain {Cow (Bos taur 97.51
d1h98a_77 Ferredoxin {Thermus thermophilus [TaxId: 274]} 97.49
d1sj1a_66 Fe3S4-ferredoxin PF1909 {Pyrococcus furiosus [TaxI 97.47
d1jnra3145 Adenylylsulfate reductase A subunit {Archaeon Arch 97.43
d1l5pa_93 2Fe-2S ferredoxin {Trichomonas vaginalis [TaxId: 5 97.43
d2cula1230 GidA-related protein TTHA1897 {Thermus thermophilu 97.4
d1onfa1259 Glutathione reductase {Plasmodium falciparum [TaxI 97.36
d1vjwa_59 Ferredoxin A {Thermotoga maritima [TaxId: 2336]} 97.36
d1iuea_98 2Fe-2S ferredoxin {Malaria parasite (Plasmodium fa 97.36
d1fxra_64 Ferredoxin I {Sulfate-reducing bacteria (Desulfovi 97.35
d1b9ra_105 2Fe-2S ferredoxin {Pseudomonas sp., terpredoxin [T 97.33
d2piaa398 Phthalate dioxygenase reductase, C-terminal domain 97.3
d1krha3104 Benzoate dioxygenase reductase, N-terminal domain 97.29
d7fd1a_106 Ferredoxin {Azotobacter vinelandii [TaxId: 354]} 97.29
d1xlqa1106 2Fe-2S ferredoxin {Pseudomonas putida, putidaredox 97.27
d1e9ma_106 2Fe-2S ferredoxin {Rhodobacter capsulatus, ferredo 97.18
d2bt6a1104 Adrenodoxin {Cow (Bos taurus) [TaxId: 9913]} 97.16
d1fxda_58 Ferredoxin I {Desulfovibrio gigas [TaxId: 879]} 97.15
d1nhpa1198 NADH peroxidase {Enterococcus faecalis [TaxId: 135 97.1
d1i7ha_109 Adrenodoxin-like ferredoxin {Escherichia coli [Tax 97.08
d2gmha1380 Electron transfer flavoprotein-ubiquinone oxidored 97.03
d1ojta1229 Dihydrolipoamide dehydrogenase {Neisseria meningit 97.02
d1wria_93 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258] 96.97
d1rp0a1278 Thiazole biosynthetic enzyme Thi4 {Thale cress(Ara 96.94
d1jnrb_149 Adenylylsulfate reductase B subunit {Archaeon Arch 96.91
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 96.8
d1cf3a1385 Glucose oxidase {Aspergillus niger [TaxId: 5061]} 96.79
d1c0pa1268 D-aminoacid oxidase, N-terminal domain {Rhodotorul 96.57
d3coxa1370 Cholesterol oxidase of GMC family {Brevibacterium 96.48
d2ivda1347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 96.38
d1iqza_81 Ferredoxin {Bacillus thermoproteolyticus [TaxId: 1 96.34
d1v59a2122 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 96.29
d1n4wa1367 Cholesterol oxidase of GMC family {Streptomyces sp 96.2
d1aoga1238 Trypanothione reductase {Trypanosoma cruzi [TaxId: 96.13
d1mo9a2121 NADH-dependent 2-ketopropyl coenzyme M oxidoreduct 95.94
d1gpea1391 Glucose oxidase {Penicillium amagasakiense [TaxId: 95.93
d3c7bb165 DsrB insert domain {Archaeoglobus fulgidus [TaxId: 95.89
d1d7ya1183 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 95.89
d1gesa2116 Glutathione reductase {Escherichia coli [TaxId: 56 95.87
d3lada2119 Dihydrolipoamide dehydrogenase {Azotobacter vinela 95.85
d1feca2117 Trypanothione reductase {Crithidia fasciculata [Ta 95.73
d1kqfb1244 Formate dehydrogenase N, iron-sulfur (beta) subuni 95.34
d1y5ib1 509 Respiratory nitrate reductase 1 beta chain {Escher 95.31
d1q1ra2133 Putidaredoxin reductase {Pseudomonas putida [TaxId 95.23
d1gesa1217 Glutathione reductase {Escherichia coli [TaxId: 56 95.14
d1w4xa1298 Phenylacetone monooxygenase {Thermobifida fusca [T 95.08
d1vlfn2195 Transhydroxylase beta subunit, BthL, N-terminal do 95.04
d2voua1265 Dihydroxypyridine hydroxylase DhpH {Arthrobacter n 95.02
d1k0ia1292 p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas a 94.98
d1q1ra1185 Putidaredoxin reductase {Pseudomonas putida [TaxId 94.82
d1m6ia2137 Apoptosis-inducing factor (AIF) {Human (Homo sapie 94.75
d1seza1373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 94.6
d1dxla2123 Dihydrolipoamide dehydrogenase {Garden pea (Pisum 94.58
d1ojta2125 Dihydrolipoamide dehydrogenase {Neisseria meningit 94.51
d1v59a1233 Dihydrolipoamide dehydrogenase {Baker's yeast (Sac 94.4
d2gjca1311 Thiazole biosynthetic enzyme Thi4 {Baker's yeast ( 94.35
d1h6va2122 Mammalian thioredoxin reductase {Rat (Rattus norve 94.32
d1kqfb1244 Formate dehydrogenase N, iron-sulfur (beta) subuni 94.09
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 93.92
d3grsa2125 Glutathione reductase {Human (Homo sapiens) [TaxId 93.36
d1fl2a1184 Alkyl hydroperoxide reductase subunit F (AhpF), C- 93.34
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 93.25
d1lvla2115 Dihydrolipoamide dehydrogenase {Pseudomonas putida 93.06
d1ebda2117 Dihydrolipoamide dehydrogenase {Bacillus stearothe 93.02
d3c96a1288 Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 92.71
d1m6ia1213 Apoptosis-inducing factor (AIF) {Human (Homo sapie 92.58
d1fl2a2126 Alkyl hydroperoxide reductase subunit F (AhpF), C- 92.45
d1jnra2356 Adenylylsulfate reductase A subunit {Archaeon Arch 92.13
d1y5ib1 509 Respiratory nitrate reductase 1 beta chain {Escher 92.01
d1xhca1167 NADH oxidase /nitrite reductase {Pyrococcus furios 91.85
d1h0hb_214 Tungsten containing formate dehydrogenase, small s 91.77
d2gv8a1335 Flavin-dependent monoxygenase SPBP16F5.08c {Schizo 91.71
d1aoga2117 Trypanothione reductase {Trypanosoma cruzi [TaxId: 91.64
d2f5va1379 Pyranose 2-oxidase {White-rot fungus (Peniophora s 91.6
d1d7ya2121 NADH-dependent ferredoxin reductase, BphA4 {Pseudo 91.44
d3c7bb165 DsrB insert domain {Archaeoglobus fulgidus [TaxId: 90.63
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 90.54
d1trba1190 Thioredoxin reductase {Escherichia coli [TaxId: 56 89.33
d1hfel285 Fe-only hydrogenase larger subunit, N-domain {Desu 88.96
d1blua_80 Ferredoxin II {Chromatium vinosum [TaxId: 1049]} 88.08
d1xhca2122 NADH oxidase /nitrite reductase {Pyrococcus furios 88.05
d1onfa2117 Glutathione reductase {Plasmodium falciparum [TaxI 87.86
d1bc6a_77 Ferredoxin {Bacillus schlegelii [TaxId: 1484]} 87.84
d7fd1a_106 Ferredoxin {Azotobacter vinelandii [TaxId: 354]} 87.71
d2fdna_55 Ferredoxin II {Clostridium acidurici [TaxId: 1556] 87.64
d1dura_55 Ferredoxin II {Peptostreptococcus asaccharolyticus 87.63
d1h98a_77 Ferredoxin {Thermus thermophilus [TaxId: 274]} 87.4
d1rgva_80 Ferredoxin II {Thauera aromatica [TaxId: 59405]} 86.86
d1jb0c_80 Photosystem I iron-sulfur protein PsaC {Synechococ 86.66
d1ep3b2160 Dihydroorotate dehydrogenase B, PyrK subunit {Lact 86.13
d2bcgg1297 Guanine nucleotide dissociation inhibitor, GDI {Ba 85.85
d1trba2126 Thioredoxin reductase {Escherichia coli [TaxId: 56 85.78
d1vdca2130 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 85.6
d1kdga1360 Flavoprotein domain of flavocytochrome cellobiose 85.59
d1xera_103 Ferredoxin {Archaeon Sulfolobus sp. [TaxId: 2288]} 85.48
d1vlfn2195 Transhydroxylase beta subunit, BthL, N-terminal do 85.41
d1vdca1192 Thioredoxin reductase {Mouse-ear cress (Arabidopsi 85.32
d1ps9a2162 2,4-dienoyl-CoA reductase, C-terminal domain {Esch 85.25
d2dw4a2449 Lysine-specific histone demethylase 1, LSD1 {Human 84.2
d3c8ya383 Fe-only hydrogenase, second domain {Clostridium pa 84.03
d1nhpa2123 NADH peroxidase {Enterococcus faecalis [TaxId: 135 83.88
d1nekb1132 Succinate dehydogenase {Escherichia coli [TaxId: 5 83.59
d2c42a5117 Pyruvate-ferredoxin oxidoreductase, PFOR, domain V 82.75
d1d5ta1336 Guanine nucleotide dissociation inhibitor, GDI {Co 82.17
d1kf6b1138 Fumarate reductase {Escherichia coli [TaxId: 562]} 81.36
d1vjwa_59 Ferredoxin A {Thermotoga maritima [TaxId: 2336]} 81.23
d1gtea1182 Dihydropyrimidine dehydrogenase, N-terminal domain 80.98
d1ps9a3179 2,4-dienoyl-CoA reductase, middle domain {Escheric 80.21
d1fxda_58 Ferredoxin I {Desulfovibrio gigas [TaxId: 879]} 80.13
>d1neka2 c.3.1.4 (A:1-235,A:356-450) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: Succinate dehydrogenase/fumarate reductase flavoprotein N-terminal domain
domain: Succinate dehydogenase
species: Escherichia coli [TaxId: 562]

Probab=100.00  E-value=2e-45  Score=393.78  Aligned_cols=305  Identities=57%  Similarity=0.976  Sum_probs=260.0

Q ss_pred             ChHhhhcHhCCCCEEEEEecCCCCChhhhcccCeeeccCCCCCCCHHHHHHHHHHhcCCCCcHHHHHHHHHHHHHHHHHH
Q psy9575           1 MRASLQLAQEGLNVAILSKVFPTRSHTVAAQGGISASLGNMSKDNWHWHMFDTIKGSDYLGDQDAIEFMCKEAPKVVYEL   80 (786)
Q Consensus         1 L~AA~~aa~~G~~V~vvek~~~~~g~s~~a~Ggi~a~~~~~~~d~~~~~~~d~~~~~~~~~~~~~v~~~~~~~~~~i~~l   80 (786)
                      |+||++|+++|++|+||||....+|+|.+|+|||+++..+.++|+++.|++|+++++.+++|+++++.+++++++.++||
T Consensus        20 l~AAl~aa~~G~~V~lleK~~~~gg~s~~A~GGi~a~~~~~~~Ds~e~~~~Dtl~aG~~l~d~~~v~~l~~~~~~~i~~L   99 (330)
T d1neka2          20 MRAALQISQSGQTCALLSKVFPTRSHTVSAQGGITVALGNTHEDNWEWHMYDTVKGSDYIGDQDAIEYMCKTGPEAILEL   99 (330)
T ss_dssp             HHHHHHHHHTTCCCEEECSSCGGGSGGGGCCSCEECCCCSSSCCCHHHHHHHHHHHHTSCSCHHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHcCCeEEEEeCCCCCCCcHHHHhhhHheEcCCCCCCCHHHHHHHHHHhhhhccCHHHHHHHHHHhHHHHHHH
Confidence            58999999999999999999998899999999999987765689999999999999999999999999999999999999


Q ss_pred             HHcCCCccccCCCcccccCCCCccCCCCCCCcceEEEecCCcHHHHHHHHHHHHhcCCceEEeceEEEeeeecCCCCEEE
Q psy9575          81 EHFGMPFDRNKNGTIYQRPFGGHSSNFGEKPIARACAVADRTGHALLHTLYQRNLHAKTNFFIEWMAIDLISDSEGDILG  160 (786)
Q Consensus        81 ~~~Gv~~~~~~~g~~~~~~~gg~~~~~~~~~~~r~~~~~~~~g~~i~~~L~~~~~~~Gv~i~~~~~v~~L~~~~~g~v~G  160 (786)
                      +++|++|+++.+|.+....+++++..+.....+|..+..+.+|..++..|.+++++.+++++.++.+++|+++++++++|
T Consensus       100 ~~~Gv~f~~~~~g~~~~~~~g~~s~~~~~~~~~~~~~~~d~~G~~i~~~L~~~~~~~~v~~~~~~~~~~l~~~~~~~~~g  179 (330)
T d1neka2         100 EHMGLPFSRLDDGRIYQRPFGGQSKNFGGEQAARTAAAADRTGHALLHTLYQQNLKNHTTIFSEWYALDLVKNQDGAVVG  179 (330)
T ss_dssp             HHTTCCCCBCSCBTTBCCCSSBCEEECTTSSSEEEECCTTCHHHHHHHHHHHHHHHTTCEEECSEEEEEEEECTTSCEEE
T ss_pred             hhccccccccCCCceehhccCcccccccCcccccccccCCccHHHHHHHHHHHHHhcCCeEEEEEEEEEeeeecccccee
Confidence            99999999999999988888888554444466788888899999999999999999999999999999999876689999


Q ss_pred             EEEEEcCCCcEEEEEeCeEEEcCCCCCccCccCcccCCCchHHHHHHHHCCCCccCCCccccccccccCCCCcccccccc
Q psy9575         161 VVALEMETGNIMILESKITILATGGGGRIWAASTNAFINTGDGLGMAARAGLPLEDMEFWQFHPTGVAGAGVLITEGVRG  240 (786)
Q Consensus       161 ~~~~~~~~g~~~~i~AkaVVlATGG~~~~~~~~~~~~~~tGdg~~~a~~aGa~l~~~e~~q~~p~~~~~~~~~~~~~~~~  240 (786)
                      +.+++..+|++..|.|++|||||||++++|.++++++.+||||++||+++||.+.||++  ++|..+...          
T Consensus       180 ~~~~~~~~g~~~~~~a~~vIlAtGG~~~ly~~ttn~~~~tGdG~~~a~~aGa~l~d~~~--~~~~~~~~~----------  247 (330)
T d1neka2         180 CTALCIETGEVVYFKARATVLATGGAGRIYQSTTNAHINTGDGVGMAIRAGVPVQDMMG--GIPTKVTGQ----------  247 (330)
T ss_dssp             EEEEETTTCCEEEEEESCEEECCCCCGGGSSSBSSCTTCSCHHHHHHHTTTCCEESECC--BEEBCTTCE----------
T ss_pred             eeeEEccCCcEEEEeccEEEEcCCCccccccCcCCCCccEeHHHHHHHHcCCCcccccc--ccccccccc----------
Confidence            99999999999999999999999999999999999999999999999999999999873  232211000          


Q ss_pred             CCcEEEcCCCCccccccCCccCCCCchhHHHHHHHHHHHhcCCCCCCCCeEEEeCCCCChhHHHhHchhHHHHHHhhcCC
Q psy9575         241 EGGILINSNGERFMERYAPILKDLAPRDFVSRAMDQEIKEGRGCGPNKDHVMLDLRHINSETIINRLPSILEIGNKFANV  320 (786)
Q Consensus       241 ~g~~~vn~~G~rf~~~~~p~~~~~~~~~~~~~~i~~~~~~g~g~~~~~~~v~ld~~~~~~~~~~~~~~~~~~~~~~~~g~  320 (786)
                        +.+                                                                           
T Consensus       248 --~~~---------------------------------------------------------------------------  250 (330)
T d1neka2         248 --ALT---------------------------------------------------------------------------  250 (330)
T ss_dssp             --EEE---------------------------------------------------------------------------
T ss_pred             --eee---------------------------------------------------------------------------
Confidence              000                                                                           


Q ss_pred             CCCCCCeeeeecccccccCcccCCCCcccccCCCCCcccCceeeecccCCccCCCCCccChhhhHHHHHHHHHHHHHHHH
Q psy9575         321 NALKEPIPVIPTIHYQMGGIPTNIYGQVIIPNNDNNKIVNGLYAIGECACVSVHGANRLGTNSLLDLLVFGRSAGNHILS  400 (786)
Q Consensus       321 d~~~~~i~v~p~~~~t~GGi~vd~~~~vl~~~~~~~t~IpGLyAaGe~a~gg~~Ga~rlgg~~l~~a~v~G~~Ag~~aa~  400 (786)
                                           ++..++        .+.+|||||+||++|.|+||+|||+||+|.+++|||++||++|++
T Consensus       251 ---------------------~~~~g~--------~~v~~gl~a~Ge~a~~g~HganrL~~nsl~~~~v~g~~ag~~~~~  301 (330)
T d1neka2         251 ---------------------VNEKGE--------DVVVPGLFAVGEIACVSVHGANRLGGNSLLDLVVFGRAAGLHLQE  301 (330)
T ss_dssp             ---------------------ECSSSC--------EEEEEEEEECSSSEECSSSTTSCCTTHHHHHHHHHHHHHHHHHHH
T ss_pred             ---------------------cccCCC--------ceecccccccCcccccccccccccccccHHHHHHHHHHHHHHHHH
Confidence                                 001111        145899999999998899999999999999999999999999999


Q ss_pred             HhhhccCCCCCCcccHHHHHHHH
Q psy9575         401 LELKKIHNKKLPINSIDIIIDRL  423 (786)
Q Consensus       401 ~~~~~~~~~~~~~~~~~~~~~~~  423 (786)
                      +++......+.+.+.++...+++
T Consensus       302 ~~~~~~~~~~~~~~~~~~~~~~~  324 (330)
T d1neka2         302 SIAEQGALRDASESDVEASLDRL  324 (330)
T ss_dssp             HHHHHCCCCCCCHHHHHHHTHHH
T ss_pred             HhhccCCcCCCCHHHHHHHHHHH
Confidence            98776544444444444333343
>d1qo8a2 c.3.1.4 (A:103-359,A:506-565) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1y0pa2 c.3.1.4 (A:111-361,A:512-568) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1kf6a2 c.3.1.4 (A:0-225,A:358-442) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1d4ca2 c.3.1.4 (A:103-359,A:506-570) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d2bs2a2 c.3.1.4 (A:1-250,A:372-457) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1chua2 c.3.1.4 (A:2-237,A:354-422) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1neka1 a.7.3.1 (A:451-588) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kf6a1 a.7.3.1 (A:443-576) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bs2a1 a.7.3.1 (A:458-655) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2bs2a3 d.168.1.1 (A:251-371) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1jnra1 a.7.3.1 (A:503-643) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1kf6b2 d.15.4.2 (B:1-105) Fumarate reductase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bs2b2 d.15.4.2 (B:1-106) Fumarate reductase iron-sulfur protein, N-terminal domain {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d1neka3 d.168.1.1 (A:236-355) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nekb2 d.15.4.2 (B:1-106) Succinate dehydogenase iron-sulfur protein, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kf6a3 d.168.1.1 (A:226-357) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1chua3 d.168.1.1 (A:238-353) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1chua1 a.7.3.1 (A:423-533) L-aspartate oxidase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nekb1 a.1.2.1 (B:107-238) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kf6b1 a.1.2.1 (B:106-243) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gqfa1 c.3.1.8 (A:1-194,A:343-401) Hypothetical protein HI0933 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2bs2b1 a.1.2.1 (B:107-239) Fumarate reductase {Wolinella succinogenes [TaxId: 844]} Back     information, alignment and structure
>d2i0za1 c.3.1.8 (A:1-192,A:362-420) Flavoprotein BC4706 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d3c8ya2 d.15.4.2 (A:1-126) Fe-only hydrogenase, N-terminal domain {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1qo8a3 d.168.1.1 (A:360-505) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1d4ca3 d.168.1.1 (A:360-505) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella putrefaciens [TaxId: 24]} Back     information, alignment and structure
>d1ryia1 c.3.1.2 (A:1-218,A:307-364) Glycine oxidase ThiO {Bacillus sp. [TaxId: 1409]} Back     information, alignment and structure
>d1pj5a2 c.3.1.2 (A:4-219,A:339-427) N,N-dimethylglycine oxidase {Arthrobacter globiformis [TaxId: 1665]} Back     information, alignment and structure
>d1h6va1 c.3.1.5 (A:10-170,A:293-366) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1y0pa3 d.168.1.1 (A:362-504) Flavocytochrome c3 (respiratory fumarate reductase) {Shewanella frigidimarina [TaxId: 56812]} Back     information, alignment and structure
>d1xdia1 c.3.1.5 (A:2-161,A:276-348) Dihydrolipoamide dehydrogenase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1t3qa2 d.15.4.2 (A:7-87) Quinoline 2-oxidoreductase small subunit QorS, N-domain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1rm6c2 d.15.4.2 (C:1-81) 4-hydroxybenzoyl-CoA reductase gamma subunit HrcC, N-terminal domain {Thauera aromatica [TaxId: 59405]} Back     information, alignment and structure
>d1vlba2 d.15.4.2 (A:1-80) Aldehyde oxidoreductase, N-terminal domain {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure
>d1dxla1 c.3.1.5 (A:4-152,A:276-347) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d2gf3a1 c.3.1.2 (A:1-217,A:322-385) Sarcosine oxidase {Bacillus sp., strain b0618 [TaxId: 1409]} Back     information, alignment and structure
>d1dgja2 d.15.4.2 (A:1-80) Aldehyde oxidoreductase, N-terminal domain {Desulfovibrio desulfuricans [TaxId: 876]} Back     information, alignment and structure
>d2fug33 d.15.4.2 (3:1-95) Nadh-quinone oxidoreductase chain 3, Nqo3, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d3grsa1 c.3.1.5 (A:18-165,A:291-363) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ffva2 d.15.4.2 (A:3-81) Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain {Hydrogenophaga pseudoflava [TaxId: 47421]} Back     information, alignment and structure
>d1ebda1 c.3.1.5 (A:7-154,A:272-346) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1n62a2 d.15.4.2 (A:3-81) Carbone monoxide (CO) dehydrogenase iron-sulfur protein, N-domain {Oligotropha carboxidovorans, formerly Pseudomonas carboxydovorans [TaxId: 40137]} Back     information, alignment and structure
>d3c8ya3 d.58.1.5 (A:127-209) Fe-only hydrogenase, second domain {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d2c42a5 d.58.1.5 (A:669-785) Pyruvate-ferredoxin oxidoreductase, PFOR, domain V {Desulfovibrio africanus [TaxId: 873]} Back     information, alignment and structure
>d2fug34 d.58.1.5 (3:96-246) NADH-quinone oxidoreductase chain 3, Nqo3, domain 2 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1lvla1 c.3.1.5 (A:1-150,A:266-335) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1hfel2 d.58.1.5 (L:2-86) Fe-only hydrogenase larger subunit, N-domain {Desulfovibrio desulfuricans [TaxId: 876]} Back     information, alignment and structure
>d1mo9a1 c.3.1.5 (A:2-192,A:314-383) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d3lada1 c.3.1.5 (A:1-158,A:278-348) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1jb0c_ d.58.1.2 (C:) Photosystem I iron-sulfur protein PsaC {Synechococcus elongatus [TaxId: 32046]} Back     information, alignment and structure
>d2fdna_ d.58.1.1 (A:) Ferredoxin II {Clostridium acidurici [TaxId: 1556]} Back     information, alignment and structure
>d1jroa2 d.15.4.2 (A:1-84) Xanthine dehydrogenase chain A, N-terminal domain {Rhodobacter capsulatus [TaxId: 1061]} Back     information, alignment and structure
>d2fug91 d.58.1.5 (9:26-179) NADH-quinone oxidoreductase chain 9, Nqo9 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xera_ d.58.1.3 (A:) Ferredoxin {Archaeon Sulfolobus sp. [TaxId: 2288]} Back     information, alignment and structure
>d1dura_ d.58.1.1 (A:) Ferredoxin II {Peptostreptococcus asaccharolyticus [TaxId: 1258]} Back     information, alignment and structure
>d1feca1 c.3.1.5 (A:1-169,A:287-357) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1frra_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258]} Back     information, alignment and structure
>d1czpa_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), pcc 7119 and 7120 [TaxId: 1167]} Back     information, alignment and structure
>d1awda_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Chlorella fusca [TaxId: 3073]} Back     information, alignment and structure
>d1a70a_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Spinach (Spinacia oleracea) [TaxId: 3562]} Back     information, alignment and structure
>d1rgva_ d.58.1.1 (A:) Ferredoxin II {Thauera aromatica [TaxId: 59405]} Back     information, alignment and structure
>d1blua_ d.58.1.1 (A:) Ferredoxin II {Chromatium vinosum [TaxId: 1049]} Back     information, alignment and structure
>d1jq4a_ d.15.4.2 (A:) Methane monooxygenase reductase N-terminal domain {Methylococcus capsulatus [TaxId: 414]} Back     information, alignment and structure
>d1frda_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Cyanobacterium (Anabaena sp.), pcc 7119 and 7120 [TaxId: 1167]} Back     information, alignment and structure
>d1bc6a_ d.58.1.2 (A:) Ferredoxin {Bacillus schlegelii [TaxId: 1484]} Back     information, alignment and structure
>d1doia_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Archaeon Haloarcula marismortui [TaxId: 2238]} Back     information, alignment and structure
>d1gtea5 d.58.1.5 (A:845-1017) Dihydropyrimidine dehydrogenase, C-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1v97a2 d.15.4.2 (A:3-92) Xanthine oxidase, N-terminal domain {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1h98a_ d.58.1.2 (A:) Ferredoxin {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1sj1a_ d.58.1.4 (A:) Fe3S4-ferredoxin PF1909 {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1jnra3 d.168.1.1 (A:257-401) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1l5pa_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Trichomonas vaginalis [TaxId: 5722]} Back     information, alignment and structure
>d2cula1 c.3.1.7 (A:2-231) GidA-related protein TTHA1897 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1onfa1 c.3.1.5 (A:1-153,A:271-376) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1vjwa_ d.58.1.4 (A:) Ferredoxin A {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1iuea_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1fxra_ d.58.1.4 (A:) Ferredoxin I {Sulfate-reducing bacteria (Desulfovibrio africanus) [TaxId: 873]} Back     information, alignment and structure
>d1b9ra_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Pseudomonas sp., terpredoxin [TaxId: 306]} Back     information, alignment and structure
>d2piaa3 d.15.4.2 (A:224-321) Phthalate dioxygenase reductase, C-terminal domain {Pseudomonas cepacia, db01 [TaxId: 292]} Back     information, alignment and structure
>d1krha3 d.15.4.2 (A:2-105) Benzoate dioxygenase reductase, N-terminal domain {Acinetobacter sp. [TaxId: 472]} Back     information, alignment and structure
>d7fd1a_ d.58.1.2 (A:) Ferredoxin {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1xlqa1 d.15.4.1 (A:1-106) 2Fe-2S ferredoxin {Pseudomonas putida, putidaredoxin [TaxId: 303]} Back     information, alignment and structure
>d1e9ma_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Rhodobacter capsulatus, ferredoxin VI [TaxId: 1061]} Back     information, alignment and structure
>d2bt6a1 d.15.4.1 (A:5-108) Adrenodoxin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fxda_ d.58.1.4 (A:) Ferredoxin I {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure
>d1nhpa1 c.3.1.5 (A:1-119,A:243-321) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1i7ha_ d.15.4.1 (A:) Adrenodoxin-like ferredoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gmha1 c.3.1.2 (A:4-236,A:336-482) Electron transfer flavoprotein-ubiquinone oxidoreductase, EFT-QO {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ojta1 c.3.1.5 (A:117-275,A:401-470) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1wria_ d.15.4.1 (A:) 2Fe-2S ferredoxin {Equisetum arvense [TaxId: 3258]} Back     information, alignment and structure
>d1rp0a1 c.3.1.6 (A:7-284) Thiazole biosynthetic enzyme Thi4 {Thale cress(Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1jnrb_ d.58.1.5 (B:) Adenylylsulfate reductase B subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1cf3a1 c.3.1.2 (A:3-324,A:521-583) Glucose oxidase {Aspergillus niger [TaxId: 5061]} Back     information, alignment and structure
>d1c0pa1 c.4.1.2 (A:999-1193,A:1289-1361) D-aminoacid oxidase, N-terminal domain {Rhodotorula gracilis [TaxId: 5286]} Back     information, alignment and structure
>d3coxa1 c.3.1.2 (A:5-318,A:451-506) Cholesterol oxidase of GMC family {Brevibacterium sterolicum [TaxId: 1702]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1iqza_ d.58.1.4 (A:) Ferredoxin {Bacillus thermoproteolyticus [TaxId: 1427]} Back     information, alignment and structure
>d1v59a2 c.3.1.5 (A:161-282) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1n4wa1 c.3.1.2 (A:9-318,A:451-507) Cholesterol oxidase of GMC family {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d1aoga1 c.3.1.5 (A:3-169,A:287-357) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1mo9a2 c.3.1.5 (A:193-313) NADH-dependent 2-ketopropyl coenzyme M oxidoreductase/carboxylase {Xanthobacter sp., py2 [TaxId: 35809]} Back     information, alignment and structure
>d1gpea1 c.3.1.2 (A:1-328,A:525-587) Glucose oxidase {Penicillium amagasakiense [TaxId: 63559]} Back     information, alignment and structure
>d3c7bb1 d.58.1.5 (B:197-261) DsrB insert domain {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1d7ya1 c.3.1.5 (A:5-115,A:237-308) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d1gesa2 c.3.1.5 (A:147-262) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3lada2 c.3.1.5 (A:159-277) Dihydrolipoamide dehydrogenase {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d1feca2 c.3.1.5 (A:170-286) Trypanothione reductase {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1kqfb1 d.58.1.5 (B:2-245) Formate dehydrogenase N, iron-sulfur (beta) subunit {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y5ib1 d.58.1.5 (B:1-509) Respiratory nitrate reductase 1 beta chain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1q1ra2 c.3.1.5 (A:115-247) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1gesa1 c.3.1.5 (A:3-146,A:263-335) Glutathione reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure
>d1vlfn2 d.58.1.5 (N:1-195) Transhydroxylase beta subunit, BthL, N-terminal domain {Pelobacter acidigallici [TaxId: 35816]} Back     information, alignment and structure
>d2voua1 c.3.1.2 (A:2-163,A:292-394) Dihydroxypyridine hydroxylase DhpH {Arthrobacter nicotinovorans [TaxId: 29320]} Back     information, alignment and structure
>d1k0ia1 c.3.1.2 (A:1-173,A:276-394) p-Hydroxybenzoate hydroxylase, PHBH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1q1ra1 c.3.1.5 (A:2-114,A:248-319) Putidaredoxin reductase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1m6ia2 c.3.1.5 (A:264-400) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1dxla2 c.3.1.5 (A:153-275) Dihydrolipoamide dehydrogenase {Garden pea (Pisum sativum) [TaxId: 3888]} Back     information, alignment and structure
>d1ojta2 c.3.1.5 (A:276-400) Dihydrolipoamide dehydrogenase {Neisseria meningitidis [TaxId: 487]} Back     information, alignment and structure
>d1v59a1 c.3.1.5 (A:1-160,A:283-355) Dihydrolipoamide dehydrogenase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2gjca1 c.3.1.6 (A:16-326) Thiazole biosynthetic enzyme Thi4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1h6va2 c.3.1.5 (A:171-292) Mammalian thioredoxin reductase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1kqfb1 d.58.1.5 (B:2-245) Formate dehydrogenase N, iron-sulfur (beta) subunit {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d3grsa2 c.3.1.5 (A:166-290) Glutathione reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fl2a1 c.3.1.5 (A:212-325,A:452-521) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1lvla2 c.3.1.5 (A:151-265) Dihydrolipoamide dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1ebda2 c.3.1.5 (A:155-271) Dihydrolipoamide dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d3c96a1 c.3.1.2 (A:4-182,A:294-402) Monooxygenase PhzS {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1m6ia1 c.3.1.5 (A:128-263,A:401-477) Apoptosis-inducing factor (AIF) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fl2a2 c.3.1.5 (A:326-451) Alkyl hydroperoxide reductase subunit F (AhpF), C-terminal domains {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jnra2 c.3.1.4 (A:2-256,A:402-502) Adenylylsulfate reductase A subunit {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1y5ib1 d.58.1.5 (B:1-509) Respiratory nitrate reductase 1 beta chain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xhca1 c.3.1.5 (A:1-103,A:226-289) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1h0hb_ d.58.1.5 (B:) Tungsten containing formate dehydrogenase, small subunit {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure
>d2gv8a1 c.3.1.5 (A:3-180,A:288-444) Flavin-dependent monoxygenase SPBP16F5.08c {Schizosaccharomyces pombe [TaxId: 4896]} Back     information, alignment and structure
>d1aoga2 c.3.1.5 (A:170-286) Trypanothione reductase {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2f5va1 c.3.1.2 (A:43-354,A:553-619) Pyranose 2-oxidase {White-rot fungus (Peniophora sp. SG) [TaxId: 204723]} Back     information, alignment and structure
>d1d7ya2 c.3.1.5 (A:116-236) NADH-dependent ferredoxin reductase, BphA4 {Pseudomonas sp., KKS102 [TaxId: 306]} Back     information, alignment and structure
>d3c7bb1 d.58.1.5 (B:197-261) DsrB insert domain {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1trba1 c.3.1.5 (A:1-118,A:245-316) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hfel2 d.58.1.5 (L:2-86) Fe-only hydrogenase larger subunit, N-domain {Desulfovibrio desulfuricans [TaxId: 876]} Back     information, alignment and structure
>d1blua_ d.58.1.1 (A:) Ferredoxin II {Chromatium vinosum [TaxId: 1049]} Back     information, alignment and structure
>d1xhca2 c.3.1.5 (A:104-225) NADH oxidase /nitrite reductase {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1onfa2 c.3.1.5 (A:154-270) Glutathione reductase {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1bc6a_ d.58.1.2 (A:) Ferredoxin {Bacillus schlegelii [TaxId: 1484]} Back     information, alignment and structure
>d7fd1a_ d.58.1.2 (A:) Ferredoxin {Azotobacter vinelandii [TaxId: 354]} Back     information, alignment and structure
>d2fdna_ d.58.1.1 (A:) Ferredoxin II {Clostridium acidurici [TaxId: 1556]} Back     information, alignment and structure
>d1dura_ d.58.1.1 (A:) Ferredoxin II {Peptostreptococcus asaccharolyticus [TaxId: 1258]} Back     information, alignment and structure
>d1h98a_ d.58.1.2 (A:) Ferredoxin {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1rgva_ d.58.1.1 (A:) Ferredoxin II {Thauera aromatica [TaxId: 59405]} Back     information, alignment and structure
>d1jb0c_ d.58.1.2 (C:) Photosystem I iron-sulfur protein PsaC {Synechococcus elongatus [TaxId: 32046]} Back     information, alignment and structure
>d1ep3b2 c.25.1.3 (B:103-262) Dihydroorotate dehydrogenase B, PyrK subunit {Lactococcus lactis, isozyme B [TaxId: 1358]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1trba2 c.3.1.5 (A:119-244) Thioredoxin reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vdca2 c.3.1.5 (A:118-243) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1kdga1 c.3.1.2 (A:215-512,A:694-755) Flavoprotein domain of flavocytochrome cellobiose dehydrogenase (CDH), FAD-binding domain {Fungus (Phanerochaete chrysosporium) [TaxId: 5306]} Back     information, alignment and structure
>d1xera_ d.58.1.3 (A:) Ferredoxin {Archaeon Sulfolobus sp. [TaxId: 2288]} Back     information, alignment and structure
>d1vlfn2 d.58.1.5 (N:1-195) Transhydroxylase beta subunit, BthL, N-terminal domain {Pelobacter acidigallici [TaxId: 35816]} Back     information, alignment and structure
>d1vdca1 c.3.1.5 (A:1-117,A:244-316) Thioredoxin reductase {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ps9a2 c.3.1.1 (A:466-627) 2,4-dienoyl-CoA reductase, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3c8ya3 d.58.1.5 (A:127-209) Fe-only hydrogenase, second domain {Clostridium pasteurianum [TaxId: 1501]} Back     information, alignment and structure
>d1nhpa2 c.3.1.5 (A:120-242) NADH peroxidase {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1nekb1 a.1.2.1 (B:107-238) Succinate dehydogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c42a5 d.58.1.5 (A:669-785) Pyruvate-ferredoxin oxidoreductase, PFOR, domain V {Desulfovibrio africanus [TaxId: 873]} Back     information, alignment and structure
>d1kf6b1 a.1.2.1 (B:106-243) Fumarate reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vjwa_ d.58.1.4 (A:) Ferredoxin A {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1gtea1 a.1.2.2 (A:2-183) Dihydropyrimidine dehydrogenase, N-terminal domain {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1ps9a3 c.4.1.1 (A:331-465,A:628-671) 2,4-dienoyl-CoA reductase, middle domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fxda_ d.58.1.4 (A:) Ferredoxin I {Desulfovibrio gigas [TaxId: 879]} Back     information, alignment and structure