Psyllid ID: psy9584

Local Sequence Feature Prediction

Prediction and (Method)	Result

Residue Number Marker

Protein Sequence

Secondary Structure (PSIPRED)

Secondary Structure Prediction (SSPRO)

Coil and Loop (DISEMBL)

Flexible Loop (DISEMBL)

Low Complexity Region (SEG)

Disordered region (IsUnstruct)

Disordered Region (DISOPRED)

Disordered Region (DISEMBL)

Disordered Region (DISPRO)

Transmembrane Helix (TMHMM)

Transmembrane Helix (HMMTOP)

Transmembrane Helix (MEMSAT)

TM Helix, Signal Peptide (MEMSAT_SVM)

TM Helix, Signal Peptide (Phobius)

Signal Peptide (SignalP HMM Mode)

Signal Peptide (SignalP NN Mode)

Coiled Coils (COILS)

Positional Conservation

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460------

MCIQCLQAVFNFKPPPRVEARTHLQLGNILLTHTKNIDLARNHLEQAWHLSQSINAFDDVKFEAASVLAELYETQLLSNLSKPILRRAIELSQHSIYWHCRLIFQLAQIHAGEKDYELASSLLGVGVDYANISNAQYTRVLFLLSRCMLLLIDKKVNDAVQLLTQAGYQVENWTGSQYQKEYLKVFFLVLQVCHYLMAGQVKSVKPCLKQLQQSILTIMQPTWPSDEVVSGPNVGDMFIWMPKEHLYVVVYLVTVIGHLKFFGVTGTAGTEVERLSQERELWTFANLNLAIVYLRGKREGDFAALLERINPETLTSHSHSLRAAAYYVQGLQSFFQARYNEAKRYLRETLKMANAEDLNRLTSCSLVLLGHIFLSLGNHRESMNMVTPAMQLASKIPDVHVQLWASAILKDLYKILNDPVRENEALQMHCNFSQMLLKDHFQSSERAEHNLINCIDGTFTIPTFKV

cccHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHccccccccccccccccccHHccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccc

cHHHHHHHHHccccccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHccccccccccccccHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEcccccccccEEc

MCIQCLQAvfnfkppprveaRTHLQLGNILLTHTKNIDLARNHLEQAWHLSQSINAFDDVKFEAASVLAELYETQLLSNLSKPILRRAIELSQHSIYWHCRLIFQLAQIHAGEKDYELASSLLGVgvdyanisnAQYTRVLFLLSRCMLLLIDKKVNDAVQLLTQAGyqvenwtgsqyQKEYLKVFFLVLQVCHYLMagqvksvkPCLKQLQQSILTimqptwpsdevvsgpnvgdmfiwmpkeHLYVVVYLVTVIGHLkffgvtgtagtEVERLSQERELWTFANLNLAIVYLRGKREGDFAALLErinpetltshsHSLRAAAYYVQGLQSFFQARYNEAKRYLRETLKMANAEDLNRLTSCSLVLLGHIFLSlgnhresmnmvTPAMQLASKIPDVHVQLWASAILKDLYKILNDPVRENEALQMHCNFSQMLLkdhfqsseraehnlincidgtftiptfkv

MCIQCLQAVfnfkppprVEARTHLQLGNILLTHTKNIDLARNHLEQAWHLSQSINAFDDVKFEAASVLAELYETQLLSNLSKPILRRAIELSQHSIYWHCRLIFQLAQIHAGEKDYELASSLLGVGVDYANISNAQYTRVLFLLSRCMLLLIDKKVNDAVQLLTQAGYQVENWTGSQYQKEYLKVFFLVLQVCHYLMAGQVKSVKPCLKQLQQSILTImqptwpsdevvsGPNVGDMFIWMPKEHLYVVVYLVTVIGHLKFFGVTGTAGTEVERLSQERELWTFANLNLAIVYLRGKREGDFAALLERINPETLTSHSHSLRAAAYYVQGLQSFFQARYNEAKRYLRETLKMANAEDLNRLTSCSLVLLGHIFLSLGNHRESMNMVTPAMQLASKIPDVHVQLWASAILKDLYKILNDPVRENEALQMHCNFSQMLLKDHFQSSERAEHnlincidgtftiptfkv

*CIQCLQAVFNFKPPPRVEARTHLQLGNILLTHTKNIDLARNHLEQAWHLSQSINAFDDVKFEAASVLAELYETQLLSNLSKPILRRAIELSQHSIYWHCRLIFQLAQIHAGEKDYELASSLLGVGVDYANISNAQYTRVLFLLSRCMLLLIDKKVNDAVQLLTQAGYQVENWTGSQYQKEYLKVFFLVLQVCHYLMAGQVKSVKPCLKQLQQSILTIMQPTWPSDEVVSGPNVGDMFIWMPKEHLYVVVYLVTVIGHLKFFGVTGTAGTEVERLSQERELWTFANLNLAIVYLRGKREGDFAALLERINPETLTSHSHSLRAAAYYVQGLQSFFQARYNEAKRYLRETLKMANAEDLNRLTSCSLVLLGHIFLSLGNHRESMNMVTPAMQLASKIPDVHVQLWASAILKDLYKILNDPVRENEALQMHCNFSQMLLKDHFQSSERAEHNLINCIDGTFTIPT***

*CIQCLQAVFNFKPPPRVEARTHLQLGNILLTHTKNIDLARNHLEQAWHLSQSINAFDDVKFEAASVLAELYETQLLSNLSKPILRRAIELSQHSIYWHCRLIFQLAQIHAGEKDYELASSLLGVGVDYANISNAQYTRVLFLLSRCMLLLIDKKVNDAVQLLTQAGY*V**WTGSQYQKEYLKVFFLVLQVCHYLMAGQVKSVKPCLKQLQQSILTIMQPTWPSDEVVSGPNVGDMFIWMPKEHLYVVVYLVTVIGHLKFFGVTGTAGTEVERLSQERELWTFANLNLAIVYLRGKREGDFAALLE**********SHSLRAAAYYVQGLQSFFQARYNEAKRYLRETLKMANAEDLNRLTSCSLVLLGHIFLSLGNHRESMNMVTPAMQLASKIPDVHVQLWASAILKDLYKILND*****************************EHNLINCIDGTFTIPTFK*

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo

oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST

Original result of BLAST against SWISS-PROT Database

ID	Alignment graph	Length	Definition	RBH(Q2H)	RBH(H2Q)	Q cover	H cover	Identity	E-value
Query		466	2.2.26 [Sep-21-2011]
B4K4X6		625	MAU2 chromatid cohesion f	N/A	N/A	0.972	0.724	0.405	1e-98
B0WYS3		616	MAU2 chromatid cohesion f	N/A	N/A	0.598	0.452	0.608	8e-97
Q16NZ8		620	MAU2 chromatid cohesion f	N/A	N/A	0.598	0.45	0.601	2e-96
B4JHK2		623	MAU2 chromatid cohesion f	N/A	N/A	0.972	0.727	0.403	3e-96
B4M4L4		621	MAU2 chromatid cohesion f	N/A	N/A	0.972	0.729	0.397	1e-95
Q296H8		620	MAU2 chromatid cohesion f	yes	N/A	0.598	0.45	0.562	3e-91
B4GF49		620	MAU2 chromatid cohesion f	N/A	N/A	0.598	0.45	0.562	3e-91
B4NKT1		663	MAU2 chromatid cohesion f	N/A	N/A	0.598	0.420	0.562	5e-91
B3M1B7		639	MAU2 chromatid cohesion f	N/A	N/A	0.596	0.435	0.573	1e-90
Q9VFC0		632	MAU2 chromatid cohesion f	yes	N/A	0.596	0.439	0.569	1e-89

>sp\|B4K4X6\|SCC4_DROMO MAU2 chromatid cohesion factor homolog OS=Drosophila mojavensis GN=GI22403 PE=3 SV=1	Back alignment and function desciption

 Score =  360 bits (925), Expect = 1e-98,   Method: Compositional matrix adjust.
 Identities = 224/553 (40%), Positives = 309/553 (55%), Gaps = 100/553 (18%)

Query: 2   CIQCLQAVFNFKPPPRVEARTHLQLGNILLTHTKNIDLARNHLEQAWHLSQSINAFDDVK 61
           CIQCLQA+F F+PP +VEARTHLQ+G +L+ +T NIDLAR HLEQAW +++ +  FDDVK
Sbjct: 36  CIQCLQALFTFQPPSKVEARTHLQMGQVLMAYTCNIDLARRHLEQAWSIAEPLMNFDDVK 95

Query: 62  FEAASVLAELYETQLLSNLSKPILRRAIELSQHSIYWHCRLIFQLAQIHAGEKDYELASS 121
           F+ AS+LA+L+     S+ +K +LRRA+ELSQ+++YWHC+L+ QL+QIHA +++Y LAS 
Sbjct: 96  FDTASLLAQLHLKTEQSSHAKAMLRRAVELSQNNVYWHCKLLLQLSQIHASDREYSLASD 155

Query: 122 LLGVGVDYA------------------------------------------NISNA---Q 136
           LL VG + A                                          NI N    +
Sbjct: 156 LLAVGAESAEEAGATYLKVLFLLSRAMILMIERKTNDVLALLNSAGQIIDNNIPNPHQKE 215

Query: 137 YTRVLFLLSRCMLLLIDKKVNDAVQLLTQAGYQVE-----NWT-------GSQYQ----- 179
           Y +V FL+ +    L   +V      L Q    ++     NW        G+Q +     
Sbjct: 216 YLKVFFLVLQVCYYLALGQVKTVKPSLKQLQMSIQTIMAPNWPSDETIFGGNQLEMFVWL 275

Query: 180 -KEYLKVFFLVLQVCHYLMAGQV----KSVKPCLKQLQQ-------SILTIMQPTWPSDE 227
            KE L V   ++ V H +MAG +    K  +  L Q+++       SIL++ +       
Sbjct: 276 PKEQLYVLVYLVTVSHSMMAGYMDKAQKYTEKALTQIEKLKQQEDKSILSVFKVILLEHI 335

Query: 228 VVSGPNVG-------------DMFIWMPKEHLYV--VVYLVTVIGHLKFFGVTGTAGTEV 272
           V+    +G             D+ + +P  +L       L  +IG    + ++ +     
Sbjct: 336 VMCRMVMGNRELAIREIAAARDVCLAVPHRNLLKRHSAQLHCLIG---LYSMSTSFFEHA 392

Query: 273 ERL-------SQERELWTFANLNLAIVYLRGKREGDFAALLERINPE-TLTSHSHSLRAA 324
           ER        + ER+L  FANLNLAI+YLR KRE D   +L+ ++ E T T  S +L   
Sbjct: 393 ERQFLVCVNETTERDLKLFANLNLAIIYLRTKREADLKQILDAVSTENTHTYSSQALMGG 452

Query: 325 AYYVQGLQSFFQARYNEAKRYLRETLKMANAEDLNRLTSCSLVLLGHIFLSLGNHRESMN 384
            YYVQGL +F +  ++EAKR+LRETLKMANAEDLNRLTSCSLVLL H+FLS+GN +ESMN
Sbjct: 453 FYYVQGLHAFHKNSFHEAKRFLRETLKMANAEDLNRLTSCSLVLLSHVFLSIGNSKESMN 512

Query: 385 MVTPAMQLASKIPDVHVQLWASAILKDLYKILNDPVRENEALQMHCNFSQMLLKDHFQSS 444
           MVTPAMQLASKIPD+HVQLW SAILKDL+++  D   E EA   H  +S+ L+ D  +  
Sbjct: 513 MVTPAMQLASKIPDIHVQLWGSAILKDLHRMSKDAQHEKEAYANHVKYSENLIADQRKCV 572

Query: 445 ERAEHNLINCIDG 457
           + A H LIN   G
Sbjct: 573 QSAHHELINWFQG 585

Required for association of the cohesin complex with chromatin during interphase. Plays a role in sister chromatid cohesion and normal progression through prometaphase.
Drosophila mojavensis (taxid: 7230)

>sp\|B0WYS3\|SCC4_CULQU MAU2 chromatid cohesion factor homolog OS=Culex quinquefasciatus GN=CPIJ012302 PE=3 SV=1	Back alignment and function description

>sp\|Q16NZ8\|SCC4_AEDAE MAU2 chromatid cohesion factor homolog OS=Aedes aegypti GN=AAEL011819 PE=3 SV=1	Back alignment and function description

>sp\|B4JHK2\|SCC4_DROGR MAU2 chromatid cohesion factor homolog OS=Drosophila grimshawi GN=GH18976 PE=3 SV=1	Back alignment and function description

>sp\|B4M4L4\|SCC4_DROVI MAU2 chromatid cohesion factor homolog OS=Drosophila virilis GN=GJ10962 PE=3 SV=1	Back alignment and function description

>sp\|Q296H8\|SCC4_DROPS MAU2 chromatid cohesion factor homolog OS=Drosophila pseudoobscura pseudoobscura GN=GA18027 PE=3 SV=2	Back alignment and function description

>sp\|B4GF49\|SCC4_DROPE MAU2 chromatid cohesion factor homolog OS=Drosophila persimilis GN=GL22140 PE=3 SV=1	Back alignment and function description

>sp\|B4NKT1\|SCC4_DROWI MAU2 chromatid cohesion factor homolog OS=Drosophila willistoni GN=GK13302 PE=3 SV=2	Back alignment and function description

>sp\|B3M1B7\|SCC4_DROAN MAU2 chromatid cohesion factor homolog OS=Drosophila ananassae GN=GF17837 PE=3 SV=1	Back alignment and function description

>sp\|Q9VFC0\|SCC4_DROME MAU2 chromatid cohesion factor homolog OS=Drosophila melanogaster GN=CG4203 PE=2 SV=1	Back alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST

Original result of BLAST against Nonredundant Database

GI	Alignment Graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		466
241678585		579	conserved hypothetical protein [Ixodes s	0.967	0.778	0.578	1e-153
307206425		594	Uncharacterized protein KIAA0892 [Harpeg	0.587	0.461	0.778	1e-125
242015832		593	conserved hypothetical protein [Pediculu	0.590	0.463	0.793	1e-125
340716199		594	PREDICTED: MAU2 chromatid cohesion facto	0.587	0.461	0.778	1e-124
383862247		594	PREDICTED: MAU2 chromatid cohesion facto	0.587	0.461	0.775	1e-124
66512196		594	PREDICTED: MAU2 chromatid cohesion facto	0.587	0.461	0.775	1e-124
380018264		594	PREDICTED: LOW QUALITY PROTEIN: MAU2 chr	0.587	0.461	0.775	1e-124
307168026		594	Uncharacterized protein KIAA0892 [Campon	0.587	0.461	0.767	1e-123
328706676		637	PREDICTED: MAU2 chromatid cohesion facto	0.517	0.378	0.865	1e-123
322788604		594	hypothetical protein SINV_09137 [Solenop	0.587	0.461	0.75	1e-120

>gi\|241678585\|ref\|XP_002400648.1\| conserved hypothetical protein [Ixodes scapularis] gi\|215504266\|gb\|EEC13760.1\| conserved hypothetical protein [Ixodes scapularis]	Back alignment and taxonomy information

 Score =  548 bits (1412), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 292/505 (57%), Positives = 349/505 (69%), Gaps = 54/505 (10%)

Query: 2   CIQCLQAVFNFKPPPRVEARTHLQLGNILLTHTKNIDLARNHLEQAWHLSQSINAFDDVK 61
           CI+CL A+F   P PRVEA THLQLG  LL +T N DLA++HLE+A      I   DDVK
Sbjct: 58  CIRCLLAIFQLNPAPRVEALTHLQLGMNLLQYTNNTDLAQSHLEKA---PPQIAGLDDVK 114

Query: 62  FEAASVLAELYETQLLSNLSKPILRRAIELSQHSIYWHCRLIFQLAQIHAGEKDYELASS 121
           F+AA+ LA+LYE +  +  +K IL +AIE S+H+ +WHCRLIF++ QI A E+DY  A S
Sbjct: 115 FQAANALADLYEKRNQTAAAKQILTKAIESSRHTTFWHCRLIFRIVQIFATERDYHSACS 174

Query: 122 LLGVGVDYANISNAQYTRVLFLLSRCMLLLIDKKVNDAVQLLTQAGYQVENWTGSQYQKE 181
            LG+G +Y++++ A YTR+LFLLS  MLL++D+K+++  Q+L QAG  VE W GS + KE
Sbjct: 175 FLGMGAEYSHMAGAHYTRILFLLSEGMLLMVDRKLSEVHQVLNQAGQLVEAWQGSMHHKE 234

Query: 182 YLKVFFLVLQVCHYLMAGQVKSVKPCLKQLQQSILTIMQPTWPSDEVVSGPNVGDMFIWM 241
            LKVFFLVLQVCHYL AGQVKSVKPCLKQLQQ I TI       D V + P  GDMF WM
Sbjct: 235 ALKVFFLVLQVCHYLSAGQVKSVKPCLKQLQQGIQTITSLHSDEDGVPAHP--GDMFHWM 292

Query: 242 PKEHLYVVVYLVTVI-----GHL-KFFGVTGTAGTEVERL----------SQER------ 279
           PKEH+ V+VYLVTV+     G++ K    T  A  ++E+L          S+ R      
Sbjct: 293 PKEHMCVLVYLVTVLHSMQAGYMDKAHKYTDKALMQIEKLKNTNPTSQGASEARAGKENG 352

Query: 280 ----------------ELWT-----------FANLNLAIVYLRGKREGDFAALLERINPE 312
                           E WT            A+LNL IVYLR  RE +   LL R+NPE
Sbjct: 353 LADLPKGGVAGELADIEEWTQKSTASMELRILASLNLVIVYLRCHREKELQELLARLNPE 412

Query: 313 TLTSHSHSLRAAAYYVQGLQSFFQARYNEAKRYLRETLKMANAEDLNRLTSCSLVLLGHI 372
           TL S SHSLRAAAYYV G  +FFQARYN+AKRYLRETLKMANAEDLNRLTSCSLVLLGHI
Sbjct: 413 TLPSASHSLRAAAYYVHGFNAFFQARYNDAKRYLRETLKMANAEDLNRLTSCSLVLLGHI 472

Query: 373 FLSLGNHRESMNMVTPAMQLASKIPDVHVQLWASAILKDLYKILNDPVRENEALQMHCNF 432
           F SLGN RESMNMVTPAMQLASKIPDVHVQLWASA+LKDLY++   PV+E EA+Q H NF
Sbjct: 473 FFSLGNSRESMNMVTPAMQLASKIPDVHVQLWASALLKDLYRLCGQPVQEQEAIQTHANF 532

Query: 433 SQMLLKDHFQSSERAEHNLINCIDG 457
           SQ+LL DHFQ+S+  EH LI  IDG
Sbjct: 533 SQLLLNDHFQASQLPEHGLIQWIDG 557

Source: Ixodes scapularis

Species: Ixodes scapularis

Genus: Ixodes

Family: Ixodidae

Order: Ixodida

Class: Arachnida

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi\|307206425\|gb\|EFN84463.1\| Uncharacterized protein KIAA0892 [Harpegnathos saltator]	Back alignment and taxonomy information

>gi\|242015832\|ref\|XP_002428551.1\| conserved hypothetical protein [Pediculus humanus corporis] gi\|212513185\|gb\|EEB15813.1\| conserved hypothetical protein [Pediculus humanus corporis]	Back alignment and taxonomy information

>gi\|340716199\|ref\|XP_003396588.1\| PREDICTED: MAU2 chromatid cohesion factor homolog [Bombus terrestris] gi\|350396675\|ref\|XP_003484628.1\| PREDICTED: MAU2 chromatid cohesion factor homolog [Bombus impatiens]	Back alignment and taxonomy information

>gi\|383862247\|ref\|XP_003706595.1\| PREDICTED: MAU2 chromatid cohesion factor homolog [Megachile rotundata]	Back alignment and taxonomy information

>gi\|66512196\|ref\|XP_394668.2\| PREDICTED: MAU2 chromatid cohesion factor homolog [Apis mellifera]	Back alignment and taxonomy information

>gi\|380018264\|ref\|XP_003693053.1\| PREDICTED: LOW QUALITY PROTEIN: MAU2 chromatid cohesion factor homolog [Apis florea]	Back alignment and taxonomy information

>gi\|307168026\|gb\|EFN61350.1\| Uncharacterized protein KIAA0892 [Camponotus floridanus]	Back alignment and taxonomy information

>gi\|328706676\|ref\|XP_001943219.2\| PREDICTED: MAU2 chromatid cohesion factor homolog [Acyrthosiphon pisum]	Back alignment and taxonomy information

>gi\|322788604\|gb\|EFZ14231.1\| hypothetical protein SINV_09137 [Solenopsis invicta]	Back alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST

Original result of BLAST against Gene Ontology (AMIGO)

ID	Alignment graph	Length	Definition	Q cover	H cover	Identity	E-value
Query		466
UNIPROTKB\|Q7PXE1		644	AgaP_AGAP001363 "AGAP001363-PA	0.598	0.433	0.597	2.6e-145
UNIPROTKB\|B4ZIX8		607	mau2 "MAU2 chromatid cohesion	0.542	0.416	0.605	2.4e-140
UNIPROTKB\|B1H1Z8		604	mau2 "MAU2 chromatid cohesion	0.542	0.418	0.601	5.7e-139
UNIPROTKB\|F1MM05		612	MAU2 "Uncharacterized protein"	0.542	0.413	0.601	7.2e-139
UNIPROTKB\|B4NKT1		663	GK13302 "MAU2 chromatid cohesi	0.598	0.420	0.562	1.5e-138
UNIPROTKB\|Q9Y6X3		613	MAU2 "MAU2 chromatid cohesion	0.542	0.412	0.601	1.1e-137
MGI\|MGI:1921799		619	Mau2 "MAU2 chromatid cohesion	0.542	0.408	0.601	1.1e-137
RGD\|1308759		619	Mau2 "Mau2 chromatid cohesion	0.542	0.408	0.601	1.1e-137
UNIPROTKB\|B4PS83		632	GE24275 "MAU2 chromatid cohesi	0.596	0.439	0.569	2.8e-137
UNIPROTKB\|F1N9E5		617	MAU2 "Uncharacterized protein"	0.542	0.410	0.589	6.6e-136

UNIPROTKB\|Q7PXE1 AgaP_AGAP001363 "AGAP001363-PA" [Anopheles gambiae (taxid:7165)]	Back alignment and assigned GO terms

 Score = 868 (310.6 bits), Expect = 2.6e-145, Sum P(2) = 2.6e-145
 Identities = 171/286 (59%), Positives = 220/286 (76%)

Query:     2 CIQCLQAVFNFKPPPRVEARTHLQLGNILLTHTKNIDLARNHLEQAWHLSQSINAFDDVK 61
             CIQCLQA+F FKPP +VEARTHLQLG IL+ +TKN DLA+NHLEQAW LS++IN FDDVK
Sbjct:    30 CIQCLQALFTFKPPLKVEARTHLQLGQILMAYTKNTDLAKNHLEQAWILSENINNFDDVK 89

Query:    62 FEAASVLAELYETQLLSNLSKPILRRAIELSQHSIYWHCRLIFQLAQIHAGEKDYELASS 121
             F+ AS+LA+LY+ Q  S+L+KP+LR+AIELSQH++YWHC+L+FQLAQ HA +K+Y LAS 
Sbjct:    90 FDTASLLAQLYQQQDQSSLAKPVLRKAIELSQHNVYWHCKLLFQLAQTHATDKEYTLASE 149

Query:   122 LLGVGVDYANISNAQYTRVLFLLSRCMLLLIDKKVNDAVQLLTQAGYQVENWTGSQYQKE 181
             LL VGV+  + SNA Y + LFLLSR M+++I++K ND + +L QA   +++   + + KE
Sbjct:   150 LLAVGVESTDESNATYLKSLFLLSRAMIMMIERKTNDVLAILNQASPIIDHSIQNVHLKE 209

Query:   182 YLKVFFLVLQVCHYLMAGQVKSVKPCLKQLQQSILTIMQPTWPSDEVVSGPNVGDMFIWM 241
             YLKVFF VLQVCHYL  GQVK+VK  LK LQQSI TI+ P WPSDE + G N  +MF+W+
Sbjct:   210 YLKVFFYVLQVCHYLQLGQVKTVKTSLKMLQQSIQTIIAPNWPSDEQIFGQNNTEMFMWL 269

Query:   242 PKEHLYVVVYLVTV-----IGHL-KFFGVTGTAGTEVERL-SQERE 280
             PKE LYV+VYLVTV      G++ K    T  A T++E+L SQE +
Sbjct:   270 PKEQLYVLVYLVTVSHSMMAGYMDKAQKYTEKALTQIEKLKSQENK 315

GO:0000785 "chromatin" evidence=ISS

GO:0005634 "nucleus" evidence=ISS

GO:0005654 "nucleoplasm" evidence=ISS

GO:0032116 "SMC loading complex" evidence=ISS

GO:0034088 "maintenance of mitotic sister chromatid cohesion" evidence=ISS

UNIPROTKB\|B4ZIX8 mau2 "MAU2 chromatid cohesion factor homolog" [Xenopus laevis (taxid:8355)]	Back alignment and assigned GO terms

UNIPROTKB\|B1H1Z8 mau2 "MAU2 chromatid cohesion factor homolog" [Xenopus (Silurana) tropicalis (taxid:8364)]	Back alignment and assigned GO terms

UNIPROTKB\|F1MM05 MAU2 "Uncharacterized protein" [Bos taurus (taxid:9913)]	Back alignment and assigned GO terms

UNIPROTKB\|B4NKT1 GK13302 "MAU2 chromatid cohesion factor homolog" [Drosophila willistoni (taxid:7260)]	Back alignment and assigned GO terms

UNIPROTKB\|Q9Y6X3 MAU2 "MAU2 chromatid cohesion factor homolog" [Homo sapiens (taxid:9606)]	Back alignment and assigned GO terms

MGI\|MGI:1921799 Mau2 "MAU2 chromatid cohesion factor homolog (C. elegans)" [Mus musculus (taxid:10090)]	Back alignment and assigned GO terms

RGD\|1308759 Mau2 "Mau2 chromatid cohesion factor homolog (C. elegans)" [Rattus norvegicus (taxid:10116)]	Back alignment and assigned GO terms

UNIPROTKB\|B4PS83 GE24275 "MAU2 chromatid cohesion factor homolog" [Drosophila yakuba (taxid:7245)]	Back alignment and assigned GO terms

UNIPROTKB\|F1N9E5 MAU2 "Uncharacterized protein" [Gallus gallus (taxid:9031)]	Back alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries

Original result of BLAST against SWISS-PROT

ID	Name	Annotated EC number	Identity	Query coverage	Hit coverage	RBH(Q2H)	RBH(H2Q)
B1H1Z8	SCC4_XENTR	No assigned EC number	0.6015	0.5429	0.4188	yes	N/A
Q9Y6X3	SCC4_HUMAN	No assigned EC number	0.6015	0.5429	0.4127	yes	N/A
Q296H8	SCC4_DROPS	No assigned EC number	0.5629	0.5987	0.45	yes	N/A
Q9D2X5	SCC4_MOUSE	No assigned EC number	0.6015	0.5429	0.4087	yes	N/A
Q9VFC0	SCC4_DROME	No assigned EC number	0.5699	0.5965	0.4398	yes	N/A

EC Number Prediction by EFICAz Software

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST

Original result of RPS-BLAST against CDD database

ID	Alignment Graph	Length	Definition	E-value
Query		466
pfam10345		592	pfam10345, Cohesin_load, Cohesin loading factor	2e-51
pfam10345		592	pfam10345, Cohesin_load, Cohesin loading factor	3e-31

>gnl\|CDD\|220706 pfam10345, Cohesin_load, Cohesin loading factor	Back alignment and domain information

 Score =  182 bits (464), Expect = 2e-51
 Identities = 83/272 (30%), Positives = 123/272 (45%), Gaps = 23/272 (8%)

Query: 1   MCIQCLQAVFN-FKPPPRVEARTHLQLGNILLTHTKNIDLARNHLEQAWHLSQSINAFDD 59
             IQCL+AV   FK PPR EART L+L  ILL  T+NIDLA  +L +A  +++  N   D
Sbjct: 40  TGIQCLEAVLKKFKLPPRQEARTRLRLARILLEETENIDLAETYLSKAILIAER-NGLID 98

Query: 60  VKFEAASVLAELYETQLLSNLSKPILRRAIELSQ----HSIYWHCRLI-FQLAQIHAGEK 114
           +KF    +LA L   +     +   L + IE ++    ++  +  RL+  QL        
Sbjct: 99  LKFVCQFLLARLLF-KTNPKAALKSLNKLIEDAETYQHNAWVYAFRLLKIQLLLQSG--- 154

Query: 115 DYELASSLLGVGVDYANISNAQYTRVLFLLSRCMLLLIDKKVNDAVQLLTQAGYQ---VE 171
           D   A   L    + AN    +   V+  L   +L L      D ++LL +A      ++
Sbjct: 155 DLAAALENLQSLAELANRRGDRKLFVVLSLLEALLHLYRGSPKDVLELLQEAIAAARSLQ 214

Query: 172 NWTGSQYQKEYLKVFFLVLQVCHYLMAGQVKSVKPCLKQLQQSILTIMQPT-WPS-DEVV 229
                  Q   LK   L+L +   L    VK+VK  LKQLQ  +  +   + W S D   
Sbjct: 215 LD--DSEQIPQLKALRLLLDLLCSLQKDDVKNVKEKLKQLQSFLDELKNLSDWSSWDIDG 272

Query: 230 SGPNVGD-----MFIWMPKEHLYVVVYLVTVI 256
           S           +F W+PKE LY +VY ++ +
Sbjct: 273 SIKLKIVIRDPLVFSWLPKEDLYALVYFLSGL 304

Cohesin_load is a common cohesin loading factor protein that is conserved in fungi. It is associated with the cohesin complex and is required in G1 for cohesin binding to chromosomes but dispensable in G2 when cohesion has been established. It is referred to as both Ssl3, in pombe, and Scc4, in S.cerevisiae. It complexes with Mis4. Length = 592

>gnl\|CDD\|220706 pfam10345, Cohesin_load, Cohesin loading factor	Back alignment and domain information

Conserved Domains Detected by HHsearch

Original result of HHsearch against CDD database

ID	Alignment Graph	Length	Definition	Probability
Query		466
KOG2300\|consensus		629		100.0
PF10345		608	Cohesin_load: Cohesin loading factor; InterPro: IP	100.0
PRK11447		1157	cellulose synthase subunit BcsC; Provisional	98.97
TIGR02917		899	PEP_TPR_lipo putative PEP-CTERM system TPR-repeat	98.94
KOG1130\|consensus		639		98.92
KOG1840\|consensus		508		98.9
TIGR02917		899	PEP_TPR_lipo putative PEP-CTERM system TPR-repeat	98.85
TIGR00990		615	3a0801s09 mitochondrial precursor proteins import	98.82
TIGR00990		615	3a0801s09 mitochondrial precursor proteins import	98.79
PRK11788		389	tetratricopeptide repeat protein; Provisional	98.74
PRK04841		903	transcriptional regulator MalT; Provisional	98.74
PRK10049		765	pgaA outer membrane protein PgaA; Provisional	98.71
KOG4626\|consensus		966		98.7
PRK11788		389	tetratricopeptide repeat protein; Provisional	98.67
PF10345		608	Cohesin_load: Cohesin loading factor; InterPro: IP	98.67
PRK11447		1157	cellulose synthase subunit BcsC; Provisional	98.61
KOG1840\|consensus		508		98.52
PRK15174		656	Vi polysaccharide export protein VexE; Provisional	98.51
KOG1130\|consensus		639		98.48
KOG2300\|consensus		629		98.44
KOG2002\|consensus		1018		98.39
PRK10049		765	pgaA outer membrane protein PgaA; Provisional	98.25
TIGR00540		409	hemY_coli hemY protein. This is an uncharacterized	98.23
KOG2002\|consensus		1018		98.22
KOG2076\|consensus		895		98.2
PRK15174		656	Vi polysaccharide export protein VexE; Provisional	98.16
PRK04841		903	transcriptional regulator MalT; Provisional	98.16
KOG4626\|consensus		966		98.01
PRK14574		822	hmsH outer membrane protein; Provisional	97.98
TIGR02521		234	type_IV_pilW type IV pilus biogenesis/stability pr	97.95
KOG4162\|consensus		799		97.88
PF14938		282	SNAP: Soluble NSF attachment protein, SNAP; PDB: 1	97.84
PF14938		282	SNAP: Soluble NSF attachment protein, SNAP; PDB: 1	97.83
PF13424		78	TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15	97.8
cd05804		355	StaR_like StaR_like; a well-conserved protein foun	97.79
cd05804		355	StaR_like StaR_like; a well-conserved protein foun	97.75
PF13424		78	TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15	97.72
PF12862		94	Apc5: Anaphase-promoting complex subunit 5	97.67
PRK10747		398	putative protoheme IX biogenesis protein; Provisio	97.66
PRK09782		987	bacteriophage N4 receptor, outer membrane subunit;	97.65
PRK12370		553	invasion protein regulator; Provisional	97.57
PF09976		145	TPR_21: Tetratricopeptide repeat; InterPro: IPR018	97.48
KOG1941\|consensus		518		97.43
TIGR02521		234	type_IV_pilW type IV pilus biogenesis/stability pr	97.4
TIGR00540		409	hemY_coli hemY protein. This is an uncharacterized	97.39
PLN03081		697	pentatricopeptide (PPR) repeat-containing protein;	97.39
PF13429		280	TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2	97.39
PRK12370		553	invasion protein regulator; Provisional	97.34
PF09976		145	TPR_21: Tetratricopeptide repeat; InterPro: IPR018	97.33
KOG1173\|consensus		611		97.3
KOG2003\|consensus		840		97.28
PRK10747		398	putative protoheme IX biogenesis protein; Provisio	97.22
PRK09782		987	bacteriophage N4 receptor, outer membrane subunit;	97.22
PRK14574		822	hmsH outer membrane protein; Provisional	97.21
TIGR03302		235	OM_YfiO outer membrane assembly lipoprotein YfiO.	97.21
cd00189		100	TPR Tetratricopeptide repeat domain; typically con	97.2
KOG1941\|consensus		518		97.1
cd00189		100	TPR Tetratricopeptide repeat domain; typically con	97.08
KOG1126\|consensus		638		97.04
PLN03218		1060	maturation of RBCL 1; Provisional	96.99
PRK10370		198	formate-dependent nitrite reductase complex subuni	96.97
PLN03218		1060	maturation of RBCL 1; Provisional	96.94
PF13429		280	TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2	96.92
KOG0547\|consensus		606		96.91
TIGR02795		119	tol_pal_ybgF tol-pal system protein YbgF. Members	96.88
TIGR02795		119	tol_pal_ybgF tol-pal system protein YbgF. Members	96.86
TIGR02552		135	LcrH_SycD type III secretion low calcium response	96.7
PRK11189		296	lipoprotein NlpI; Provisional	96.64
PLN03077		857	Protein ECB2; Provisional	96.62
TIGR03302		235	OM_YfiO outer membrane assembly lipoprotein YfiO.	96.59
PF13414		69	TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A	96.51
PF12895		84	Apc3: Anaphase-promoting complex, cyclosome, subun	96.38
KOG4162\|consensus		799		96.32
PRK02603		172	photosystem I assembly protein Ycf3; Provisional	96.31
CHL00033		168	ycf3 photosystem I assembly protein Ycf3	96.3
COG3071		400	HemY Uncharacterized enzyme of heme biosynthesis [	96.29
PLN03077		857	Protein ECB2; Provisional	96.26
PRK11189		296	lipoprotein NlpI; Provisional	96.17
TIGR02552		135	LcrH_SycD type III secretion low calcium response	96.16
PF12895		84	Apc3: Anaphase-promoting complex, cyclosome, subun	96.06
COG2956		389	Predicted N-acetylglucosaminyl transferase [Carboh	96.03
PLN03088		356	SGT1, suppressor of G2 allele of SKP1; Provisional	96.01
CHL00033		168	ycf3 photosystem I assembly protein Ycf3	95.86
PLN03081		697	pentatricopeptide (PPR) repeat-containing protein;	95.79
PF13414		69	TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A	95.78
PRK10803		263	tol-pal system protein YbgF; Provisional	95.72
PRK02603		172	photosystem I assembly protein Ycf3; Provisional	95.7
PRK15359		144	type III secretion system chaperone protein SscB;	95.54
PLN03088		356	SGT1, suppressor of G2 allele of SKP1; Provisional	95.46
PRK15359		144	type III secretion system chaperone protein SscB;	95.16
KOG0547\|consensus		606		95.12
PF13432		65	TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL	95.07
KOG1126\|consensus		638		95.01
KOG0624\|consensus		504		94.82
PF13432		65	TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL	94.66
COG3063		250	PilF Tfp pilus assembly protein PilF [Cell motilit	94.4
KOG2003\|consensus		840		94.03
COG3063		250	PilF Tfp pilus assembly protein PilF [Cell motilit	94.01
PRK10803		263	tol-pal system protein YbgF; Provisional	93.79
PF09295		395	ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter	93.64
KOG1585\|consensus		308		93.57
PF12688		120	TPR_5: Tetratrico peptide repeat	93.43
PF13371		73	TPR_9: Tetratricopeptide repeat	93.3
KOG0543\|consensus		397		93.25
PRK10370		198	formate-dependent nitrite reductase complex subuni	93.24
PRK15363		157	pathogenicity island 2 chaperone protein SscA; Pro	93.03
PF09295		395	ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter	92.92
PRK15363		157	pathogenicity island 2 chaperone protein SscA; Pro	92.85
PF14559		68	TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN	92.77
KOG3785\|consensus		557		92.66
KOG0548\|consensus		539		92.49
COG2909		894	MalT ATP-dependent transcriptional regulator [Tran	92.09
KOG0553\|consensus		304		92.01
KOG4555\|consensus		175		91.89
PF12862		94	Apc5: Anaphase-promoting complex subunit 5	91.69
KOG2581\|consensus		493		91.43
PF04733		290	Coatomer_E: Coatomer epsilon subunit; InterPro: IP	91.43
PF14559		68	TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN	91.38
PF13176		36	TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_	91.29
PRK15331		165	chaperone protein SicA; Provisional	91.28
PF08631		278	SPO22: Meiosis protein SPO22/ZIP4 like; InterPro:	91.02
PRK15179		694	Vi polysaccharide biosynthesis protein TviE; Provi	90.94
PRK10866		243	outer membrane biogenesis protein BamD; Provisiona	90.66
KOG1586\|consensus		288		90.58
PF10602		177	RPN7: 26S proteasome subunit RPN7; InterPro: IPR01	90.24
PF13181		34	TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_	90.18
PF13374		42	TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT	90.15
PF13176		36	TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_	89.9
PF11207		203	DUF2989: Protein of unknown function (DUF2989); In	89.62
PRK10866		243	outer membrane biogenesis protein BamD; Provisiona	89.6
KOG1586\|consensus		288		89.5
KOG1173\|consensus		611		89.37
PF12688		120	TPR_5: Tetratrico peptide repeat	89.36
COG2956		389	Predicted N-acetylglucosaminyl transferase [Carboh	89.24
PF12569		517	NARP1: NMDA receptor-regulated protein 1 ; InterPr	89.17
KOG1129\|consensus		478		88.77
PF13371		73	TPR_9: Tetratricopeptide repeat	88.61
PF09986		214	DUF2225: Uncharacterized protein conserved in bact	88.24
PRK10153		517	DNA-binding transcriptional activator CadC; Provis	87.73
PF13525		203	YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M	87.7
PF13181		34	TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_	87.41
COG5010		257	TadD Flp pilus assembly protein TadD, contains TPR	86.88
PRK10153		517	DNA-binding transcriptional activator CadC; Provis	86.46
COG4783		484	Putative Zn-dependent protease, contains TPR repea	86.32
KOG1125\|consensus		579		86.14
PF07719		34	TPR_2: Tetratricopeptide repeat; InterPro: IPR0131	85.75
PF10579		80	Rapsyn_N: Rapsyn N-terminal myristoylation and lin	85.3
COG2976		207	Uncharacterized protein conserved in bacteria [Fun	84.69
PF07719		34	TPR_2: Tetratricopeptide repeat; InterPro: IPR0131	84.6
PF09986		214	DUF2225: Uncharacterized protein conserved in bact	84.59
PF10300		468	DUF3808: Protein of unknown function (DUF3808); In	83.74
PLN03098		453	LPA1 LOW PSII ACCUMULATION1; Provisional	83.25
PF12569		517	NARP1: NMDA receptor-regulated protein 1 ; InterPr	83.08
KOG0550\|consensus		486		82.85
PF04733		290	Coatomer_E: Coatomer epsilon subunit; InterPro: IP	82.72
PRK14720		906	transcript cleavage factor/unknown domain fusion p	82.6
PF00515		34	TPR_1: Tetratricopeptide repeat; InterPro: IPR0014	82.43
KOG0550\|consensus		486		82.4
KOG3785\|consensus		557		82.29
PF08631		278	SPO22: Meiosis protein SPO22/ZIP4 like; InterPro:	81.88
PRK15179		694	Vi polysaccharide biosynthesis protein TviE; Provi	81.23
PF10579		80	Rapsyn_N: Rapsyn N-terminal myristoylation and lin	80.62
COG4235		287	Cytochrome c biogenesis factor [Posttranslational	80.61
PF00515		34	TPR_1: Tetratricopeptide repeat; InterPro: IPR0014	80.61

>KOG2300\|consensus	Back alignment and domain information

Probab=100.00  E-value=1.8e-116  Score=898.71  Aligned_cols=462  Identities=50%  Similarity=0.725  Sum_probs=447.3

Q ss_pred             CcchhHHHhhcCCCChhHHHHHHHHHHHHHHHhcCCHHHHHHHHHHHHHHHhccccchHHHHHHHHHHHHHHHHhC-Ccc
Q psy9584           1 MCIQCLQAVFNFKPPPRVEARTHLQLGNILLTHTKNIDLARNHLEQAWHLSQSINAFDDVKFEAASVLAELYETQL-LSN   79 (466)
Q Consensus         1 ~ai~CLeAvl~~~~~p~~Ea~~rLrla~lL~~~T~N~~~A~~hLeka~~L~~~~~~~~d~K~~a~slLa~~y~~~~-~~~   79 (466)
                      +||+||+|+|++.+|.++|||||||+|.+|+.||+|+++||+||||||+++++++.|.|+||+++|+||++|++.+ +.+
T Consensus        27 k~IkClqA~~~~~is~~veart~LqLg~lL~~yT~N~elAksHLekA~~i~~~ip~fydvKf~a~SlLa~lh~~~~~s~~  106 (629)
T KOG2300|consen   27 KCIKCLQAIFQFQISFLVEARTHLQLGALLLRYTKNVELAKSHLEKAWLISKSIPSFYDVKFQAASLLAHLHHQLAQSFP  106 (629)
T ss_pred             HHHHHHHHHhccCChHHHHHHHHHHHHHHHHHHhccHHHHHHHHHHHHHHHcccccHHhhhhHHHHHHHHHHHHhcCCCc
Confidence            5999999999999999999999999999999999999999999999999999999999999999999999999998 789


Q ss_pred             chhHHHHHHHHhhchhhhhHHHHHHHHHHHhcccccHHHHHHHHHhHHHHHHHhcChHHHHHHHHHHHHHHhcccCccHH
Q psy9584          80 LSKPILRRAIELSQHSIYWHCRLIFQLAQIHAGEKDYELASSLLGVGVDYANISNAQYTRVLFLLSRCMLLLIDKKVNDA  159 (466)
Q Consensus        80 ~ak~~l~k~i~~s~~~~~W~~~~~fqLA~i~~~~~D~~~A~~~L~~g~~~A~~~~d~~~~~lf~ls~~~~ll~~~~~~~v  159 (466)
                      ++|+++||+|++++++|+|+|+|+||||++|..++||.+|++.|+.|+++|...+.+|++++|.+|++|++++++|..+|
T Consensus       107 ~~KalLrkaielsq~~p~wsckllfQLaql~~idkD~~sA~elLavga~sAd~~~~~ylr~~ftls~~~ll~me~d~~dV  186 (629)
T KOG2300|consen  107 PAKALLRKAIELSQSVPYWSCKLLFQLAQLHIIDKDFPSALELLAVGAESADHICFPYLRMLFTLSMLMLLIMERDDYDV  186 (629)
T ss_pred             hHHHHHHHHHHHhcCCchhhHHHHHHHHHHHhhhccchhHHHHHhccccccchhhhHHHHHHHHHHHHHHHHhCccHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999988899999


Q ss_pred             HHHHHHHhhHhhhhccccchHhhHHHHHHHHHHHhhhhhhhhhhhhHHHHHHHHHHHHhcCCCCCCCCccCCCCCCcccc
Q psy9584         160 VQLLTQAGYQVENWTGSQYQKEYLKVFFLVLQVCHYLMAGQVKSVKPCLKQLQQSILTIMQPTWPSDEVVSGPNVGDMFI  239 (466)
Q Consensus       160 ~~al~~~~~l~~~~~g~~~~~e~L~~~~~~L~i~~~l~~g~v~~~k~~lkqLq~~~q~i~~~~w~~~~~~~~~~~~~~f~  239 (466)
                      +++++.||+++++++++|.++|+|++||+|+++|+|+..|+||++||++||||++++++++++|++|+.+.|+++.+.|+
T Consensus       187 ~~ll~~~~qi~~n~~sdk~~~E~LkvFyl~lql~yy~~~gq~rt~k~~lkQLQ~siqtist~~~~h~e~ilgsps~~l~~  266 (629)
T KOG2300|consen  187 EKLLQRCGQIWQNISSDKTQKEMLKVFYLVLQLSYYLLPGQVRTVKPALKQLQDSIQTISTSSRGHDEKILGSPSPILFE  266 (629)
T ss_pred             HHHHHHHHHHHhccCCChHHHHHHHHHHHHHHHHHHhcccchhhhHHHHHHHHHHHhccCCCCCCccccccCCCChHHHh
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cCcchhHHHHHHHHHHhh-----------------------------------hhhH-----------------------
Q psy9584         240 WMPKEHLYVVVYLVTVIG-----------------------------------HLKF-----------------------  261 (466)
Q Consensus       240 WLpk~~l~aLvyl~tv~~-----------------------------------~lk~-----------------------  261 (466)
                      |||||++|||||++||+|                                   ++||                       
T Consensus       267 wlpkeqicaLV~l~tv~hsm~~gy~~~~~K~tDe~i~q~eklkq~d~~srilsm~km~~LE~iv~c~lv~~~~~~al~~i  346 (629)
T KOG2300|consen  267 WLPKEQICALVYLVTVIHSMPAGYFKKAQKYTDEAIKQTEKLKQADLMSRILSMFKMILLEHIVMCRLVRGDYVEALEEI  346 (629)
T ss_pred             hccHhhhHhhhhhhHHhhhhhhHHHHHHHHHHHHHHHHHhhcccccchhHHHHHHHHHHHHHHHHHHHHhCCHHHHHHHH
Confidence            999999999999999998                                   1122                       


Q ss_pred             -----------------------HHhcCchhh-------------HHhhhhcchhhHHHHHHHHHHHHHhCCCchHHHHH
Q psy9584         262 -----------------------FGVTGTAGT-------------EVERLSQERELWTFANLNLAIVYLRGKREGDFAAL  305 (466)
Q Consensus       262 -----------------------Flv~G~~~~-------------eAl~~~~~~~~~~~~~lNlai~Yl~~~~~~e~~~~  305 (466)
                                             .+++|+|++             +|++.+.+.|+|+||++|+|++|+|.+++.++|++
T Consensus       347 ~dm~~w~~r~p~~~Llr~~~~~ih~LlGlys~sv~~~enAe~hf~~a~k~t~~~dl~a~~nlnlAi~YL~~~~~ed~y~~  426 (629)
T KOG2300|consen  347 VDMKNWCTRFPTPLLLRAHEAQIHMLLGLYSHSVNCYENAEFHFIEATKLTESIDLQAFCNLNLAISYLRIGDAEDLYKA  426 (629)
T ss_pred             HHHHHHHHhCCchHHHHHhHHHHHHHHhhHhhhcchHHHHHHHHHHHHHhhhHHHHHHHHHHhHHHHHHHhccHHHHHHH
Confidence                                   057777766             39999999999999999999999999888899999


Q ss_pred             HhhhCCC-ccccccchhhHHHHHHHhHHHhhhhcHHHHHHHHHHHHHhhhhhhhhhHHHhHHHHHHHHHHhcCChHHHHH
Q psy9584         306 LERINPE-TLTSHSHSLRAAAYYVQGLQSFFQARYNEAKRYLRETLKMANAEDLNRLTSCSLVLLGHIFLSLGNHRESMN  384 (466)
Q Consensus       306 l~~i~~~-~~~~~~~~L~a~~~yv~~~~~~~~~~~~eAk~~lre~lk~a~~~~l~~l~~~~l~llg~i~l~~~~~~ea~~  384 (466)
                      +++|+|+ +++.++++++|+++||+|+++|+||+++|||+++||+|||||+||++||++|+||+||++|+++||..||+|
T Consensus       427 ld~i~p~nt~s~ssq~l~a~~~~v~glfaf~qn~lnEaK~~l~e~Lkmanaed~~rL~a~~LvLLs~v~lslgn~~es~n  506 (629)
T KOG2300|consen  427 LDLIGPLNTNSLSSQRLEASILYVYGLFAFKQNDLNEAKRFLRETLKMANAEDLNRLTACSLVLLSHVFLSLGNTVESRN  506 (629)
T ss_pred             HHhcCCCCCCcchHHHHHHHHHHHHHHHHHHhccHHHHHHHHHHHHhhcchhhHHHHHHHHHHHHHHHHHHhcchHHHHh
Confidence            9999999 889999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             hhHHHHHHhhcCCChhHHHHHHHHHHHHHHHcCC--chHHHHHHHHHHHHHHHHHHHH---hhhcccccccccccccCCC
Q psy9584         385 MVTPAMQLASKIPDVHVQLWASAILKDLYKILND--PVRENEALQMHCNFSQMLLKDH---FQSSERAEHNLINCIDGTF  459 (466)
Q Consensus       385 ~~~~a~~lAkK~~D~~~qlw~~~lL~~ly~~~g~--~~~~~e~~~~~~~~s~~l~~~~---~~~~~~~~~~l~~~~~~~~  459 (466)
                      ||+|||||||||||++||+|+++||+|+|+++|+  .+.|.|++++|..+|+.+++|+   ..+.++|+|+|++|+||||
T Consensus       507 mvrpamqlAkKi~Di~vqLws~si~~~L~~a~g~~~~~~e~e~~~~~ql~Sr~lla~~~i~~~~~~~pa~~ll~wfdgdP  586 (629)
T KOG2300|consen  507 MVRPAMQLAKKIPDIPVQLWSSSILTDLYQALGEKGNEMENEAFRKHQLQSRLLLADGSIHHIELVAPAHILLYWFDGDP  586 (629)
T ss_pred             ccchHHHHHhcCCCchHHHHHHHHHHHHHHHhCcchhhHHHHHHHHHHHHHHHHHhccCcchHhhcccHHhhhhhccCCC
Confidence            9999999999999999999999999999999998  8889999999999999999999   9999999999999999999


Q ss_pred             CCC
Q psy9584         460 TIP  462 (466)
Q Consensus       460 ~~~  462 (466)
                      |+.
T Consensus       587 pv~  589 (629)
T KOG2300|consen  587 PVA  589 (629)
T ss_pred             ccc
Confidence            864

>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi	Back alignment and domain information

>PRK11447 cellulose synthase subunit BcsC; Provisional	Back alignment and domain information

>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein	Back alignment and domain information

>KOG1130\|consensus	Back alignment and domain information

>KOG1840\|consensus	Back alignment and domain information

>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein	Back alignment and domain information

>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70)	Back alignment and domain information

>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70)	Back alignment and domain information

>PRK11788 tetratricopeptide repeat protein; Provisional	Back alignment and domain information

>PRK04841 transcriptional regulator MalT; Provisional	Back alignment and domain information

>PRK10049 pgaA outer membrane protein PgaA; Provisional	Back alignment and domain information

>KOG4626\|consensus	Back alignment and domain information

>PRK11788 tetratricopeptide repeat protein; Provisional	Back alignment and domain information

>PF10345 Cohesin_load: Cohesin loading factor; InterPro: IPR019440 Cohesin loading factor is a conserved protein that has been characterised in fungi	Back alignment and domain information

>PRK11447 cellulose synthase subunit BcsC; Provisional	Back alignment and domain information

>KOG1840\|consensus	Back alignment and domain information

>PRK15174 Vi polysaccharide export protein VexE; Provisional	Back alignment and domain information

>KOG1130\|consensus	Back alignment and domain information

>KOG2300\|consensus	Back alignment and domain information

>KOG2002\|consensus	Back alignment and domain information

>PRK10049 pgaA outer membrane protein PgaA; Provisional	Back alignment and domain information

>TIGR00540 hemY_coli hemY protein	Back alignment and domain information

>KOG2002\|consensus	Back alignment and domain information

>KOG2076\|consensus	Back alignment and domain information

>PRK15174 Vi polysaccharide export protein VexE; Provisional	Back alignment and domain information

>PRK04841 transcriptional regulator MalT; Provisional	Back alignment and domain information

>KOG4626\|consensus	Back alignment and domain information

>PRK14574 hmsH outer membrane protein; Provisional	Back alignment and domain information

>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW	Back alignment and domain information

>KOG4162\|consensus	Back alignment and domain information

>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A	Back alignment and domain information

>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A	Back alignment and domain information

>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H	Back alignment and domain information

>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals	Back alignment and domain information

>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals	Back alignment and domain information

>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H	Back alignment and domain information

>PF12862 Apc5: Anaphase-promoting complex subunit 5	Back alignment and domain information

>PRK10747 putative protoheme IX biogenesis protein; Provisional	Back alignment and domain information

>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional	Back alignment and domain information

>PRK12370 invasion protein regulator; Provisional	Back alignment and domain information

>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function	Back alignment and domain information

>KOG1941\|consensus	Back alignment and domain information

>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW	Back alignment and domain information

>TIGR00540 hemY_coli hemY protein	Back alignment and domain information

>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional	Back alignment and domain information

>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B	Back alignment and domain information

>PRK12370 invasion protein regulator; Provisional	Back alignment and domain information

>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function	Back alignment and domain information

>KOG1173\|consensus	Back alignment and domain information

>KOG2003\|consensus	Back alignment and domain information

>PRK10747 putative protoheme IX biogenesis protein; Provisional	Back alignment and domain information

>PRK09782 bacteriophage N4 receptor, outer membrane subunit; Provisional	Back alignment and domain information

>PRK14574 hmsH outer membrane protein; Provisional	Back alignment and domain information

>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO	Back alignment and domain information

>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C

Back alignment and domain information

>KOG1941\|consensus	Back alignment and domain information

Back alignment and domain information

>KOG1126\|consensus	Back alignment and domain information

>PLN03218 maturation of RBCL 1; Provisional	Back alignment and domain information

>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional	Back alignment and domain information

>PLN03218 maturation of RBCL 1; Provisional	Back alignment and domain information

>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B	Back alignment and domain information

>KOG0547\|consensus	Back alignment and domain information

>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF	Back alignment and domain information

>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF	Back alignment and domain information

>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD	Back alignment and domain information

>PRK11189 lipoprotein NlpI; Provisional	Back alignment and domain information

>PLN03077 Protein ECB2; Provisional	Back alignment and domain information

>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO	Back alignment and domain information

>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A	Back alignment and domain information

>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A	Back alignment and domain information

>KOG4162\|consensus	Back alignment and domain information

>PRK02603 photosystem I assembly protein Ycf3; Provisional	Back alignment and domain information

>CHL00033 ycf3 photosystem I assembly protein Ycf3	Back alignment and domain information

>COG3071 HemY Uncharacterized enzyme of heme biosynthesis [Coenzyme metabolism]	Back alignment and domain information

>PLN03077 Protein ECB2; Provisional	Back alignment and domain information

>PRK11189 lipoprotein NlpI; Provisional	Back alignment and domain information

>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD	Back alignment and domain information

>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A	Back alignment and domain information

>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional	Back alignment and domain information

>CHL00033 ycf3 photosystem I assembly protein Ycf3	Back alignment and domain information

>PLN03081 pentatricopeptide (PPR) repeat-containing protein; Provisional	Back alignment and domain information

>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A	Back alignment and domain information

>PRK10803 tol-pal system protein YbgF; Provisional	Back alignment and domain information

>PRK02603 photosystem I assembly protein Ycf3; Provisional	Back alignment and domain information

>PRK15359 type III secretion system chaperone protein SscB; Provisional	Back alignment and domain information

>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional	Back alignment and domain information

>PRK15359 type III secretion system chaperone protein SscB; Provisional	Back alignment and domain information

>KOG0547\|consensus	Back alignment and domain information

>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B	Back alignment and domain information

>KOG1126\|consensus	Back alignment and domain information

>KOG0624\|consensus	Back alignment and domain information

>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B	Back alignment and domain information

>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>KOG2003\|consensus	Back alignment and domain information

>COG3063 PilF Tfp pilus assembly protein PilF [Cell motility and secretion / Intracellular trafficking and secretion]	Back alignment and domain information

>PRK10803 tol-pal system protein YbgF; Provisional	Back alignment and domain information

>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi	Back alignment and domain information

>KOG1585\|consensus	Back alignment and domain information

>PF12688 TPR_5: Tetratrico peptide repeat	Back alignment and domain information

>PF13371 TPR_9: Tetratricopeptide repeat	Back alignment and domain information

>KOG0543\|consensus	Back alignment and domain information

>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional	Back alignment and domain information

>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional	Back alignment and domain information

>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi	Back alignment and domain information

>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional	Back alignment and domain information

>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A	Back alignment and domain information

>KOG3785\|consensus	Back alignment and domain information

>KOG0548\|consensus	Back alignment and domain information

>COG2909 MalT ATP-dependent transcriptional regulator [Transcription]	Back alignment and domain information

>KOG0553\|consensus	Back alignment and domain information

>KOG4555\|consensus	Back alignment and domain information

>PF12862 Apc5: Anaphase-promoting complex subunit 5	Back alignment and domain information

>KOG2581\|consensus	Back alignment and domain information

>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment	Back alignment and domain information

>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A	Back alignment and domain information

>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A	Back alignment and domain information

>PRK15331 chaperone protein SicA; Provisional	Back alignment and domain information

>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis []	Back alignment and domain information

>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional	Back alignment and domain information

>PRK10866 outer membrane biogenesis protein BamD; Provisional	Back alignment and domain information

>KOG1586\|consensus	Back alignment and domain information

>PF10602 RPN7: 26S proteasome subunit RPN7; InterPro: IPR019585 This entry represents the regulatory subunit RPN7 (known as the non-ATPase regulatory subunit 6 in higher eukaryotes) of the 26S proteasome	Back alignment and domain information

>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A	Back alignment and domain information

>PF13374 TPR_10: Tetratricopeptide repeat; PDB: 3CEQ_B 3EDT_H 3NF1_A	Back alignment and domain information

>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A	Back alignment and domain information

>PF11207 DUF2989: Protein of unknown function (DUF2989); InterPro: IPR021372 Some members in this bacterial family of proteins are annotated as lipoproteins however this cannot be confirmed	Back alignment and domain information

>PRK10866 outer membrane biogenesis protein BamD; Provisional	Back alignment and domain information

>KOG1586\|consensus	Back alignment and domain information

>KOG1173\|consensus	Back alignment and domain information

>PF12688 TPR_5: Tetratrico peptide repeat	Back alignment and domain information

>COG2956 Predicted N-acetylglucosaminyl transferase [Carbohydrate transport and metabolism]	Back alignment and domain information

>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala	Back alignment and domain information

>KOG1129\|consensus	Back alignment and domain information

>PF13371 TPR_9: Tetratricopeptide repeat	Back alignment and domain information

>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function	Back alignment and domain information

>PRK10153 DNA-binding transcriptional activator CadC; Provisional	Back alignment and domain information

>PF13525 YfiO: Outer membrane lipoprotein; PDB: 3TGO_A 3Q5M_A 2YHC_A	Back alignment and domain information

>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A	Back alignment and domain information

>COG5010 TadD Flp pilus assembly protein TadD, contains TPR repeats [Intracellular trafficking and secretion]	Back alignment and domain information

>PRK10153 DNA-binding transcriptional activator CadC; Provisional	Back alignment and domain information

>COG4783 Putative Zn-dependent protease, contains TPR repeats [General function prediction only]	Back alignment and domain information

>KOG1125\|consensus	Back alignment and domain information

>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ]	Back alignment and domain information

>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane	Back alignment and domain information

>COG2976 Uncharacterized protein conserved in bacteria [Function unknown]	Back alignment and domain information

>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ]	Back alignment and domain information

>PF09986 DUF2225: Uncharacterized protein conserved in bacteria (DUF2225); InterPro: IPR018708 This conserved bacterial family has no known function	Back alignment and domain information

>PF10300 DUF3808: Protein of unknown function (DUF3808); InterPro: IPR019412 This entry represents a family of proteins conserved from fungi to humans	Back alignment and domain information

>PLN03098 LPA1 LOW PSII ACCUMULATION1; Provisional	Back alignment and domain information

>PF12569 NARP1: NMDA receptor-regulated protein 1 ; InterPro: IPR021183 This group represents N-terminal acetyltransferase A (NatA) auxiliary subunit and represents a non-catalytic component of the NatA N-terminal acetyltransferase, which catalyzes acetylation of proteins beginning with Met-Ser, Met-Gly and Met-Ala	Back alignment and domain information

>KOG0550\|consensus	Back alignment and domain information

>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment	Back alignment and domain information

>PRK14720 transcript cleavage factor/unknown domain fusion protein; Provisional	Back alignment and domain information

>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ]	Back alignment and domain information

>KOG0550\|consensus	Back alignment and domain information

>KOG3785\|consensus	Back alignment and domain information

>PF08631 SPO22: Meiosis protein SPO22/ZIP4 like; InterPro: IPR013940 SPO22 is a meiosis-specific protein with similarity to phospholipase A2, involved in completion of nuclear divisions during meiosis; induced early in meiosis []	Back alignment and domain information

>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional	Back alignment and domain information

>PF10579 Rapsyn_N: Rapsyn N-terminal myristoylation and linker region; InterPro: IPR019568 Neuromuscular junction formation relies upon the clustering of acetylcholine receptors and other proteins in the muscle membrane	Back alignment and domain information

>COG4235 Cytochrome c biogenesis factor [Posttranslational modification, protein turnover, chaperones]	Back alignment and domain information

>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ]	Back alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST

Original result of RPS-BLAST against PDB70 database

ID	Alignment Graph	Length	Definition	E-value
Query		466
1vt4_I		1221	APAF-1 related killer DARK; drosophila apoptosome,	2e-09
1hz4_A		373	MALT regulatory protein; two-helix bundles, helix	1e-06
1hz4_A		373	MALT regulatory protein; two-helix bundles, helix	6e-04
3q15_A		378	PSP28, response regulator aspartate phosphatase H;	3e-05
3q15_A		378	PSP28, response regulator aspartate phosphatase H;	2e-04
3ulq_A		383	Response regulator aspartate phosphatase F; tetrat	5e-05
3ulq_A		383	Response regulator aspartate phosphatase F; tetrat	1e-04
3gw4_A		203	Uncharacterized protein; structural genomics, PSI-	9e-05
4a1s_A		411	PINS, partner of inscuteable; cell cycle, LGN, mit	3e-04
3sf4_A		406	G-protein-signaling modulator 2; tetratricopeptide	6e-04

>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221	Back alignment and structure

 Score = 59.5 bits (143), Expect = 2e-09
 Identities = 90/526 (17%), Positives = 157/526 (29%), Gaps = 150/526 (28%)

Query: 3   IQCLQAVFN----FKPPPRVEARTHLQLGNIL--LTHTKNI---------------DLAR 41
           I+    ++N    F        + +L+L   L  L   KN+               D+  
Sbjct: 113 IEQRDRLYNDNQVFAKYNVSRLQPYLKLRQALLELRPAKNVLIDGVLGSGKTWVALDVCL 172

Query: 42  NHLEQA-------W-HLSQSINAFDDVKFEAASVLAELYETQLLSNLSKPILRRA----- 88
           ++  Q        W +L               +VL  L   +LL  +      R+     
Sbjct: 173 SYKVQCKMDFKIFWLNLKN--------CNSPETVLEML--QKLLYQIDPNWTSRSDHSSN 222

Query: 89  IELSQHSIYWHCRLIFQLAQIHAGEKDYELASSLLGVGVDYANISNAQYTRVLFLLSRCM 148
           I+L  HSI    R + +        K YE  + LL V +   N+ NA+     F L  C 
Sbjct: 223 IKLRIHSIQAELRRLLK-------SKPYE--NCLL-V-LL--NVQNAKAWNA-FNL-SCK 267

Query: 149 LLLI--DKKVNDAVQLLTQAGYQVENWTGSQYQKEYLKVFFLVLQVCHYLMAGQVKSVKP 206
           +LL    K+V D +   T     +++ + +    E   +    L      +  +V +  P
Sbjct: 268 ILLTTRFKQVTDFLSAATTTHISLDHHSMTLTPDEVKSLLLKYLDCRPQDLPREVLTTNP 327

Query: 207 CL-----KQLQQSILTIMQPTWPSDEVVSGPNVGDMFIWM--PKE--HLYVVVYLVTVIG 257
                  + ++  + T     W          + +  + +  P E   ++          
Sbjct: 328 RRLSIIAESIRDGLATWDN--WKHVNCDKLTTIIESSLNVLEPAEYRKMFD--------- 376

Query: 258 HLKFF--GVTGTAGTEVERLSQERELW---TFANLNLAIVYLRGKREGDFAALLERINPE 312
            L  F              LS    +W     +++ + +  L          L+E+  P+
Sbjct: 377 RLSVFPPSAHIPTIL----LSL---IWFDVIKSDVMVVVNKLHKYS------LVEK-QPK 422

Query: 313 TLTSHSHSL----RAAAYYVQGLQSFFQARYNEAKRYLRETLK---------------MA 353
             T    S+    +        L       YN  K +  + L                + 
Sbjct: 423 ESTISIPSIYLELKVKLENEYALHRSIVDHYNIPKTFDSDDLIPPYLDQYFYSHIGHHLK 482

Query: 354 NAEDLNRLTSCSLVLLGHIFLSLGNHRESMNMVTPAMQLASKIPDVHVQLWASAILKDLY 413
           N E   R+T     L   +FL      + +   + A   +  I +   QL         Y
Sbjct: 483 NIEHPERMT-----LFRMVFLDFRFLEQKIRHDSTAWNASGSILNTLQQL-------KFY 530

Query: 414 K---ILNDPVRENEALQMHCNFSQMLLKD--HFQSSERAEHNLINC 454
           K     NDP  E             L+     F    + E NLI  
Sbjct: 531 KPYICDNDPKYE------------RLVNAILDF--LPKIEENLICS 562

PyMOL of 1vt4

>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373	Back alignment and structure

>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Length = 373	Back alignment and structure

>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378	Back alignment and structure

>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Length = 378	Back alignment and structure

>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383	Back alignment and structure

>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Length = 383	Back alignment and structure

>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Length = 203	Back alignment and structure

>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Length = 411	Back alignment and structure

>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Length = 406	Back alignment and structure

Structure Templates Detected by HHsearch

Original result of HHsearch against PDB70 database

ID	Alignment Graph	Length	Definition	Probability
Query		466
3sf4_A		406	G-protein-signaling modulator 2; tetratricopeptide	99.79
4a1s_A		411	PINS, partner of inscuteable; cell cycle, LGN, mit	99.75
3ro2_A		338	PINS homolog, G-protein-signaling modulator 2; TPR	99.72
3sf4_A		406	G-protein-signaling modulator 2; tetratricopeptide	99.71
3ro2_A		338	PINS homolog, G-protein-signaling modulator 2; TPR	99.68
4a1s_A		411	PINS, partner of inscuteable; cell cycle, LGN, mit	99.67
3ulq_A		383	Response regulator aspartate phosphatase F; tetrat	99.54
3q15_A		378	PSP28, response regulator aspartate phosphatase H;	99.54
1hz4_A		373	MALT regulatory protein; two-helix bundles, helix	99.46
3ulq_A		383	Response regulator aspartate phosphatase F; tetrat	99.42
3ieg_A		359	DNAJ homolog subfamily C member 3; TPR motif, chap	99.37
3q15_A		378	PSP28, response regulator aspartate phosphatase H;	99.34
1w3b_A		388	UDP-N-acetylglucosamine--peptide N-acetylglucosami	99.34
1hz4_A		373	MALT regulatory protein; two-helix bundles, helix	99.32
4eqf_A		365	PEX5-related protein; accessory protein, tetratric	99.26
2gw1_A		514	Mitochondrial precursor proteins import receptor;	99.25
1fch_A		368	Peroxisomal targeting signal 1 receptor; protein-p	99.25
2y4t_A		450	DNAJ homolog subfamily C member 3; chaperone, endo	99.22
2gw1_A		514	Mitochondrial precursor proteins import receptor;	99.22
3fp2_A		537	TPR repeat-containing protein YHR117W; TOM71, mito	99.16
3ieg_A		359	DNAJ homolog subfamily C member 3; TPR motif, chap	99.15
3fp2_A		537	TPR repeat-containing protein YHR117W; TOM71, mito	99.13
3edt_B		283	KLC 2, kinesin light chain 2; superhelical, struct	99.12
2y4t_A		450	DNAJ homolog subfamily C member 3; chaperone, endo	99.12
3ro3_A		164	PINS homolog, G-protein-signaling modulator 2; asy	99.11
4g1t_A		472	Interferon-induced protein with tetratricopeptide	99.11
1w3b_A		388	UDP-N-acetylglucosamine--peptide N-acetylglucosami	99.09
3nf1_A		311	KLC 1, kinesin light chain 1; TPR, structural geno	99.09
3u4t_A		272	TPR repeat-containing protein; structural genomics	99.08
2xpi_A		597	Anaphase-promoting complex subunit CUT9; cell cycl	99.07
2xpi_A		597	Anaphase-promoting complex subunit CUT9; cell cycl	99.04
2ifu_A		307	Gamma-SNAP; membrane fusion, snare complex disasse	99.01
3hym_B		330	Cell division cycle protein 16 homolog; APC, anaph	99.01
3nf1_A		311	KLC 1, kinesin light chain 1; TPR, structural geno	99.0
3cv0_A		327	Peroxisome targeting signal 1 receptor PEX5; TPR m	99.0
3uq3_A		258	Heat shock protein STI1; HSP90, peptide binding, c	98.98
3ro3_A		164	PINS homolog, G-protein-signaling modulator 2; asy	98.97
3gw4_A		203	Uncharacterized protein; structural genomics, PSI-	98.92
3edt_B		283	KLC 2, kinesin light chain 2; superhelical, struct	98.89
3gw4_A		203	Uncharacterized protein; structural genomics, PSI-	98.88
3hym_B		330	Cell division cycle protein 16 homolog; APC, anaph	98.87
1fch_A		368	Peroxisomal targeting signal 1 receptor; protein-p	98.83
4g1t_A		472	Interferon-induced protein with tetratricopeptide	98.83
4eqf_A		365	PEX5-related protein; accessory protein, tetratric	98.82
1qqe_A		292	Vesicular transport protein SEC17; helix-turn-heli	98.79
3cv0_A		327	Peroxisome targeting signal 1 receptor PEX5; TPR m	98.7
3u4t_A		272	TPR repeat-containing protein; structural genomics	98.61
3u3w_A		293	Transcriptional activator PLCR protein; ternary co	98.61
2qfc_A		293	PLCR protein; TPR, HTH, transcription regulation;	98.59
4b4t_Q		434	26S proteasome regulatory subunit RPN6; hydrolase,	98.57
4b4t_Q		434	26S proteasome regulatory subunit RPN6; hydrolase,	98.57
3uq3_A		258	Heat shock protein STI1; HSP90, peptide binding, c	98.56
2qfc_A		293	PLCR protein; TPR, HTH, transcription regulation;	98.54
1ouv_A		273	Conserved hypothetical secreted protein; TPR repea	98.54
2ifu_A		307	Gamma-SNAP; membrane fusion, snare complex disasse	98.53
2xm6_A		490	Protein corresponding to locus C5321 from CFT073 s	98.52
2xm6_A		490	Protein corresponding to locus C5321 from CFT073 s	98.5
1qqe_A		292	Vesicular transport protein SEC17; helix-turn-heli	98.49
1ouv_A		273	Conserved hypothetical secreted protein; TPR repea	98.48
3u3w_A		293	Transcriptional activator PLCR protein; ternary co	98.46
2ho1_A		252	Type 4 fimbrial biogenesis protein PILF; type IV p	98.45
4abn_A		474	Tetratricopeptide repeat protein 5; P53 cofactor,	98.45
1xnf_A		275	Lipoprotein NLPI; TPR, tetratricopeptide, structur	98.45
3qky_A		261	Outer membrane assembly lipoprotein YFIO; membrane	98.34
1xnf_A		275	Lipoprotein NLPI; TPR, tetratricopeptide, structur	98.27
2pl2_A		217	Hypothetical conserved protein TTC0263; TPR, prote	98.24
2q7f_A		243	YRRB protein; TPR, protein binding; 2.49A {Bacillu	98.19
2ho1_A		252	Type 4 fimbrial biogenesis protein PILF; type IV p	98.18
4gcn_A		127	Protein STI-1; structural genomics, PSI-biology, m	98.07
2vq2_A		225	PILW, putative fimbrial biogenesis and twitching m	98.04
3e4b_A		452	ALGK; tetratricopeptide repeat, superhelix, algina	98.02
4gyw_A		723	UDP-N-acetylglucosamine--peptide N- acetylglucosam	98.02
2pl2_A		217	Hypothetical conserved protein TTC0263; TPR, prote	97.99
2h6f_A		382	Protein farnesyltransferase/geranylgeranyltransfer	97.98
3mkr_A		291	Coatomer subunit epsilon; tetratricopeptide repeat	97.97
4gcn_A		127	Protein STI-1; structural genomics, PSI-biology, m	97.93
4i17_A		228	Hypothetical protein; TPR repeats protein, structu	97.91
3vtx_A		184	MAMA; tetratricopeptide repeats (TPR) containing p	97.91
1hh8_A		213	P67PHOX, NCF-2, neutrophil cytosol factor 2; cell	97.91
2q7f_A		243	YRRB protein; TPR, protein binding; 2.49A {Bacillu	97.89
3as5_A		186	MAMA; tetratricopeptide repeats (TPR) containing p	97.88
3sz7_A		164	HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G	97.87
3vtx_A		184	MAMA; tetratricopeptide repeats (TPR) containing p	97.83
1a17_A		166	Serine/threonine protein phosphatase 5; hydrolase,	97.82
3as5_A		186	MAMA; tetratricopeptide repeats (TPR) containing p	97.81
1a17_A		166	Serine/threonine protein phosphatase 5; hydrolase,	97.79
1elr_A		131	TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp	97.77
3upv_A		126	Heat shock protein STI1; TPR-fold, adaptor protein	97.76
4gyw_A		723	UDP-N-acetylglucosamine--peptide N- acetylglucosam	97.74
1elr_A		131	TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp	97.72
3qky_A		261	Outer membrane assembly lipoprotein YFIO; membrane	97.71
4i17_A		228	Hypothetical protein; TPR repeats protein, structu	97.7
4ga2_A		150	E3 SUMO-protein ligase ranbp2; TPR motif, nuclear	97.7
4gco_A		126	Protein STI-1; structural genomics, PSI-biology, m	97.68
3rkv_A		162	Putative peptidylprolyl isomerase; structural geno	97.67
2e2e_A		177	Formate-dependent nitrite reductase complex NRFG;	97.66
2fo7_A		136	Synthetic consensus TPR protein; tetratricopeptide	97.65
2vyi_A		131	SGTA protein; chaperone, TPR repeat, phosphoprotei	97.64
2fbn_A		198	70 kDa peptidylprolyl isomerase, putative; sulfur	97.62
2h6f_A		382	Protein farnesyltransferase/geranylgeranyltransfer	97.62
2vq2_A		225	PILW, putative fimbrial biogenesis and twitching m	97.62
3upv_A		126	Heat shock protein STI1; TPR-fold, adaptor protein	97.59
3q49_B		137	STIP1 homology and U box-containing protein 1; E3	97.59
4ga2_A		150	E3 SUMO-protein ligase ranbp2; TPR motif, nuclear	97.56
4gco_A		126	Protein STI-1; structural genomics, PSI-biology, m	97.56
1elw_A		118	TPR1-domain of HOP; HOP, TPR-domain, peptide-compl	97.54
2fo7_A		136	Synthetic consensus TPR protein; tetratricopeptide	97.53
3sz7_A		164	HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G	97.53
3n71_A		490	Histone lysine methyltransferase SMYD1; heart deve	97.52
2lni_A		133	Stress-induced-phosphoprotein 1; structural genomi	97.52
3rkv_A		162	Putative peptidylprolyl isomerase; structural geno	97.49
2xev_A		129	YBGF; tetratricopeptide, alpha-helical, metal bind	97.48
2xcb_A		142	PCRH, regulatory protein PCRH; protein transport,	97.48
2vgx_A		148	Chaperone SYCD; alternative dimer assembly, tetrat	97.47
1hh8_A		213	P67PHOX, NCF-2, neutrophil cytosol factor 2; cell	97.47
2xev_A		129	YBGF; tetratricopeptide, alpha-helical, metal bind	97.45
2lni_A		133	Stress-induced-phosphoprotein 1; structural genomi	97.45
1na0_A		125	Designed protein CTPR3; de novo protein; HET: IPT;	97.43
3n71_A		490	Histone lysine methyltransferase SMYD1; heart deve	97.42
2vsy_A		568	XCC0866; transferase, glycosyl transferase, GT-B,	97.42
2yhc_A		225	BAMD, UPF0169 lipoprotein YFIO; essential BAM comp	97.38
3mkr_A		291	Coatomer subunit epsilon; tetratricopeptide repeat	97.37
3gyz_A		151	Chaperone protein IPGC; asymmetric homodimer, tetr	97.37
2l6j_A		111	TPR repeat-containing protein associated with HSP;	97.35
1elw_A		118	TPR1-domain of HOP; HOP, TPR-domain, peptide-compl	97.34
3q49_B		137	STIP1 homology and U box-containing protein 1; E3	97.34
3ma5_A		100	Tetratricopeptide repeat domain protein; NESG, str	97.34
2dba_A		148	Smooth muscle cell associated protein-1, isoform 2	97.32
4b4t_P		445	26S proteasome regulatory subunit RPN5; hydrolase,	97.31
1hxi_A		121	PEX5, peroxisome targeting signal 1 receptor PEX5;	97.31
2yhc_A		225	BAMD, UPF0169 lipoprotein YFIO; essential BAM comp	97.3
3qww_A		433	SET and MYND domain-containing protein 2; methyltr	97.3
1p5q_A		336	FKBP52, FK506-binding protein 4; isomerase; 2.80A	97.3
4abn_A		474	Tetratricopeptide repeat protein 5; P53 cofactor,	97.29
2vyi_A		131	SGTA protein; chaperone, TPR repeat, phosphoprotei	97.28
2hr2_A		159	Hypothetical protein; alpha-alpha superhelix fold,	97.27
3urz_A		208	Uncharacterized protein; tetratricopeptide repeats	97.25
3gyz_A		151	Chaperone protein IPGC; asymmetric homodimer, tetr	97.24
2vgx_A		148	Chaperone SYCD; alternative dimer assembly, tetrat	97.21
2xcb_A		142	PCRH, regulatory protein PCRH; protein transport,	97.2
2dba_A		148	Smooth muscle cell associated protein-1, isoform 2	97.2
1hxi_A		121	PEX5, peroxisome targeting signal 1 receptor PEX5;	97.19
2fbn_A		198	70 kDa peptidylprolyl isomerase, putative; sulfur	97.19
1kt0_A		457	FKBP51, 51 kDa FK506-binding protein; FKBP-like pp	97.18
3qww_A		433	SET and MYND domain-containing protein 2; methyltr	97.16
1ihg_A		370	Cyclophilin 40; ppiase immunophilin tetratricopept	97.15
3k9i_A		117	BH0479 protein; putative protein binding protein,	97.13
3ma5_A		100	Tetratricopeptide repeat domain protein; NESG, str	97.08
2kck_A		112	TPR repeat; tetratricopeptide repeat, structural g	97.07
3e4b_A		452	ALGK; tetratricopeptide repeat, superhelix, algina	97.06
1na0_A		125	Designed protein CTPR3; de novo protein; HET: IPT;	97.06
2vsy_A		568	XCC0866; transferase, glycosyl transferase, GT-B,	97.01
2kck_A		112	TPR repeat; tetratricopeptide repeat, structural g	96.94
2r5s_A		176	Uncharacterized protein VP0806; APC090868.1, vibri	96.91
2ond_A		308	Cleavage stimulation factor 77 kDa subunit; HAT do	96.89
3k9i_A		117	BH0479 protein; putative protein binding protein,	96.88
2pzi_A		681	Probable serine/threonine-protein kinase PKNG; ATP	96.87
1p5q_A		336	FKBP52, FK506-binding protein 4; isomerase; 2.80A	96.86
2kat_A		115	Uncharacterized protein; NESG, structure, structur	96.86
2hr2_A		159	Hypothetical protein; alpha-alpha superhelix fold,	96.85
1xi4_A		1630	Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle	96.8
1ihg_A		370	Cyclophilin 40; ppiase immunophilin tetratricopept	96.78
1xi4_A		1630	Clathrin heavy chain; alpha-ZIG-ZAG, beta-propelle	96.77
2kat_A		115	Uncharacterized protein; NESG, structure, structur	96.64
2c2l_A		281	CHIP, carboxy terminus of HSP70-interacting protei	96.63
3qwp_A		429	SET and MYND domain-containing protein 3; SMYD3,SE	96.6
3urz_A		208	Uncharacterized protein; tetratricopeptide repeats	96.6
3qwp_A		429	SET and MYND domain-containing protein 3; SMYD3,SE	96.58
2c2l_A		281	CHIP, carboxy terminus of HSP70-interacting protei	96.52
2e2e_A		177	Formate-dependent nitrite reductase complex NRFG;	96.47
2if4_A		338	ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha,	96.46
2l6j_A		111	TPR repeat-containing protein associated with HSP;	96.44
1kt0_A		457	FKBP51, 51 kDa FK506-binding protein; FKBP-like pp	96.43
1klx_A		138	Cysteine rich protein B; structural genomics, heli	96.31
1na3_A		91	Designed protein CTPR2; de novo protein; HET: IPT;	96.3
3mv2_B		310	Coatomer subunit epsilon; vesicular membrane coat	96.17
3qou_A		287	Protein YBBN; thioredoxin-like fold, tetratricopep	96.16
3rjv_A		212	Putative SEL1 repeat protein; alpha-alpha superhel	96.15
3txn_A		394	26S proteasome regulatory complex subunit P42B; PC	96.15
2pzi_A		681	Probable serine/threonine-protein kinase PKNG; ATP	96.13
2ooe_A		530	Cleavage stimulation factor 77 kDa subunit; HAT do	96.11
3rjv_A		212	Putative SEL1 repeat protein; alpha-alpha superhel	96.05
1na3_A		91	Designed protein CTPR2; de novo protein; HET: IPT;	96.02
2if4_A		338	ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha,	96.02
2ond_A		308	Cleavage stimulation factor 77 kDa subunit; HAT do	95.99
4f3v_A		282	ESX-1 secretion system protein ECCA1; tetratricope	95.97
3qou_A		287	Protein YBBN; thioredoxin-like fold, tetratricopep	95.94
2r5s_A		176	Uncharacterized protein VP0806; APC090868.1, vibri	95.88
1wao_1		477	Serine/threonine protein phosphatase 5; hydrolase,	95.87
2kc7_A		99	BFR218_protein; tetratricopeptide repeat, all-alph	95.76
1wao_1		477	Serine/threonine protein phosphatase 5; hydrolase,	95.67
2ooe_A		530	Cleavage stimulation factor 77 kDa subunit; HAT do	95.4
2v5f_A		104	Prolyl 4-hydroxylase subunit alpha-1; endoplasmic	95.31
3ffl_A		167	Anaphase-promoting complex subunit 7; tetratricope	95.21
3txn_A		394	26S proteasome regulatory complex subunit P42B; PC	94.55
2kc7_A		99	BFR218_protein; tetratricopeptide repeat, all-alph	94.19
3bee_A		93	Putative YFRE protein; putaive YFRE protein, struc	93.4
2v5f_A		104	Prolyl 4-hydroxylase subunit alpha-1; endoplasmic	93.38
1zu2_A		158	Mitochondrial import receptor subunit TOM20-3; TPR	92.69
4f3v_A		282	ESX-1 secretion system protein ECCA1; tetratricope	92.6
3mv2_B		310	Coatomer subunit epsilon; vesicular membrane coat	92.53
1zu2_A		158	Mitochondrial import receptor subunit TOM20-3; TPR	92.27
3ffl_A		167	Anaphase-promoting complex subunit 7; tetratricope	92.02
4b4t_P		445	26S proteasome regulatory subunit RPN5; hydrolase,	91.89
3bee_A		93	Putative YFRE protein; putaive YFRE protein, struc	91.26
3u64_A		301	Protein TP_0956; tetratrico peptide repeat, protei	90.84
3ly7_A		372	Transcriptional activator CADC; alpha/beta domain,	90.17
3ly7_A		372	Transcriptional activator CADC; alpha/beta domain,	89.81
1klx_A		138	Cysteine rich protein B; structural genomics, heli	89.52
4b4t_R		429	RPN7, 26S proteasome regulatory subunit RPN7; hydr	89.42
3t5v_B		455	Nuclear mRNA export protein THP1; PCI, mRNA nuclea	86.26
4b4t_S		523	RPN3, 26S proteasome regulatory subunit RPN3; hydr	84.58
4b4t_R		429	RPN7, 26S proteasome regulatory subunit RPN7; hydr	83.85
1b89_A		449	Protein (clathrin heavy chain); triskelion, coated	83.49

>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens}	Back alignment and structure

Probab=99.79  E-value=2.3e-16  Score=155.56  Aligned_cols=347  Identities=14%  Similarity=0.068  Sum_probs=228.8

Q ss_pred             HHHHHHHHHHHHHHhcCCHHHHHHHHHHHHHHHhccccchHHHHHHHHHHHHHHHHhCCccchhHHHHHHHHhhc--hhh
Q psy9584          19 EARTHLQLGNILLTHTKNIDLARNHLEQAWHLSQSINAFDDVKFEAASVLAELYETQLLSNLSKPILRRAIELSQ--HSI   96 (466)
Q Consensus        19 Ea~~rLrla~lL~~~T~N~~~A~~hLeka~~L~~~~~~~~d~K~~a~slLa~~y~~~~~~~~ak~~l~k~i~~s~--~~~   96 (466)
                      .+.+....|..+ ....+.++|..++++++.+...   ..+....+...+|.+|...|.+..+...++++++...  +.+
T Consensus         8 ~~~~l~~~g~~~-~~~g~~~~A~~~~~~al~~~~~---~~~~~~~~~~~l~~~~~~~g~~~~A~~~~~~al~~~~~~~~~   83 (406)
T 3sf4_A            8 SCLELALEGERL-CKSGDCRAGVSFFEAAVQVGTE---DLKTLSAIYSQLGNAYFYLHDYAKALEYHHHDLTLARTIGDQ   83 (406)
T ss_dssp             CHHHHHHHHHHH-HHTTCHHHHHHHHHHHHHHCCS---CHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHTTCH
T ss_pred             HHHHHHHHHHHH-HHhccHHHHHHHHHHHHhcCcc---cHHHHHHHHHHHHHHHHHhcCHHHHHHHHHHHHHHHHhcccc
Confidence            455566777664 4567888888888888887444   4667778888888888888888888888888888765  555


Q ss_pred             hhHHHHHHHHHHHhcccccHHHHHHHHHhHHHHHHHhcChHHHHHHHHHHHHHHhcccC--------------------c
Q psy9584          97 YWHCRLIFQLAQIHAGEKDYELASSLLGVGVDYANISNAQYTRVLFLLSRCMLLLIDKK--------------------V  156 (466)
Q Consensus        97 ~W~~~~~fqLA~i~~~~~D~~~A~~~L~~g~~~A~~~~d~~~~~lf~ls~~~~ll~~~~--------------------~  156 (466)
                      ......++.+|.++...||++.|++.++.+.+++...+++..........+.++....+                    .
T Consensus        84 ~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~~l~~~~~~~g~~~~~~~~~~~~~~~~~a~~~~  163 (406)
T 3sf4_A           84 LGEAKASGNLGNTLKVLGNFDEAIVCCQRHLDISRELNDKVGEARALYNLGNVYHAKGKSFGCPGPQDVGEFPEEVRDAL  163 (406)
T ss_dssp             HHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHHTCHHHHHHHHHHHHHHHHHHHHTCC-------CCCCHHHHHHH
T ss_pred             HHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHHhcccccchHHHHHHHHHHHHHcCCcccccccchhhhhhhhHHHHH
Confidence            66677777888888888888888888888888888888866554444444444332211                    1


Q ss_pred             cHHHHHHHHHhhHhhhhccccchHhhHHHHHHHHHHHhhhhhhhhhhhhHHHHHHHHHHHHhcCCCCCCCCccCCCCCCc
Q psy9584         157 NDAVQLLTQAGYQVENWTGSQYQKEYLKVFFLVLQVCHYLMAGQVKSVKPCLKQLQQSILTIMQPTWPSDEVVSGPNVGD  236 (466)
Q Consensus       157 ~~v~~al~~~~~l~~~~~g~~~~~e~L~~~~~~L~i~~~l~~g~v~~~k~~lkqLq~~~q~i~~~~w~~~~~~~~~~~~~  236 (466)
                      ++....+.++-.+.+.. +.  ......++...  ...+...|+...+...+++.-.....                   
T Consensus       164 ~~A~~~~~~al~~~~~~-~~--~~~~~~~~~~l--a~~~~~~g~~~~A~~~~~~al~~~~~-------------------  219 (406)
T 3sf4_A          164 QAAVDFYEENLSLVTAL-GD--RAAQGRAFGNL--GNTHYLLGNFRDAVIAHEQRLLIAKE-------------------  219 (406)
T ss_dssp             HHHHHHHHHHHHHHHHT-TC--HHHHHHHHHHH--HHHHHHHTBHHHHHHHHHHHHHHHHH-------------------
T ss_pred             HHHHHHHHHHHHHHHhc-cC--cHHHHHHHHHH--HHHHHHccCHHHHHHHHHHHHHHHHh-------------------
Confidence            11112222222222221 11  11112222221  22334455655555555444322222                   


Q ss_pred             ccccCcchhHHHHHHHHHHhhhhhHHHhcCchhhHHhhhhcchhhHHHHHHHHHHHHHhCCCch---HHHHHHhhhCCCc
Q psy9584         237 MFIWMPKEHLYVVVYLVTVIGHLKFFGVTGTAGTEVERLSQERELWTFANLNLAIVYLRGKREG---DFAALLERINPET  313 (466)
Q Consensus       237 ~f~WLpk~~l~aLvyl~tv~~~lk~Flv~G~~~~eAl~~~~~~~~~~~~~lNlai~Yl~~~~~~---e~~~~l~~i~~~~  313 (466)
                                                             ..++...+.+..|+|.+|...++..   ++++..-.+.+..
T Consensus       220 ---------------------------------------~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~  260 (406)
T 3sf4_A          220 ---------------------------------------FGDKAAERRAYSNLGNAYIFLGEFETASEYYKKTLLLARQL  260 (406)
T ss_dssp             ---------------------------------------TTCHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHT
T ss_pred             ---------------------------------------cCCcHHHHHHHHHHHHHHHHcCChHHHHHHHHHHHHHHHhC
Confidence                                                   1245566778999999999987433   2333332232211


Q ss_pred             cccccchhhHHHHHHHhHHHhhhhcHHHHHHHHHHHHHhhhhhhhhhHHHhHHHHHHHHHHhcCChHHHHHhhHHHHHHh
Q psy9584         314 LTSHSHSLRAAAYYVQGLQSFFQARYNEAKRYLRETLKMANAEDLNRLTSCSLVLLGHIFLSLGNHRESMNMVTPAMQLA  393 (466)
Q Consensus       314 ~~~~~~~L~a~~~yv~~~~~~~~~~~~eAk~~lre~lk~a~~~~l~~l~~~~l~llg~i~l~~~~~~ea~~~~~~a~~lA  393 (466)
                         ......+.+++.-|......|++.+|.+++++++++....+.....+.++..+|.++...|++++|.+....++.++
T Consensus       261 ---~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~a~~~~~~~~~~~~~~~~~~~la~~~~~~g~~~~A~~~~~~al~~~  337 (406)
T 3sf4_A          261 ---KDRAVEAQSCYSLGNTYTLLQDYEKAIDYHLKHLAIAQELNDRIGEGRACWSLGNAYTALGNHDQAMHFAEKHLEIS  337 (406)
T ss_dssp             ---TCHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHHTCHHHHHHHHHHHHHHH
T ss_pred             ---cCchHHHHHHHHHHHHHHHhCcHHHHHHHHHHHHHHHHhcCCcHHHHHHHHHHHHHHHHcCCHHHHHHHHHHHHHHH
Confidence               11222244444455556889999999999999999999998888889999999999999999999999999999999


Q ss_pred             hcCCChhHHHHHHHHHHHHHHHcCCchHHH-HHHHHHHHHHHH
Q psy9584         394 SKIPDVHVQLWASAILKDLYKILNDPVREN-EALQMHCNFSQM  435 (466)
Q Consensus       394 kK~~D~~~qlw~~~lL~~ly~~~g~~~~~~-e~~~~~~~~s~~  435 (466)
                      ++++|......+...+.++|...|++.++. ....-...+.++
T Consensus       338 ~~~~~~~~~~~~~~~l~~~~~~~g~~~~~~~~~~~~~~~~~~~  380 (406)
T 3sf4_A          338 REVGDKSGELTARLNLSDLQMVLGLSYSTNNSIMSENTEIDSS  380 (406)
T ss_dssp             HHTTCHHHHHHHHHHHHHHHHHHHTTSCC--------------
T ss_pred             HHhcCCcchhHHHHHHHHHHHHhhHhHHHHHHHHHHHHHHHHH
Confidence            999999999999999999999999885543 333333334343

PyMOL of 3sf4

>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster}	Back alignment and structure

>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus}	Back alignment and structure

>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens}	Back alignment and structure

>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus}	Back alignment and structure

>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster}	Back alignment and structure

>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis}	Back alignment and structure

>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis}	Back alignment and structure

>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2	Back alignment and structure

>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis}	Back alignment and structure

>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus}	Back alignment and structure

>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis}	Back alignment and structure

>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1	Back alignment and structure

>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2	Back alignment and structure

>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus}	Back alignment and structure

>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae}	Back alignment and structure

>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A	Back alignment and structure

>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A	Back alignment and structure

>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae}	Back alignment and structure

>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A	Back alignment and structure

>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus}	Back alignment and structure

>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A	Back alignment and structure

>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A	Back alignment and structure

>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A	Back alignment and structure

>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus}	Back alignment and structure

>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens}	Back alignment and structure

>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1	Back alignment and structure

>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens}	Back alignment and structure

>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii}	Back alignment and structure

>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe}	Back alignment and structure

>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe}	Back alignment and structure

>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio}	Back alignment and structure

>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens}	Back alignment and structure

>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens}	Back alignment and structure

>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A	Back alignment and structure

>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae}	Back alignment and structure

>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus}	Back alignment and structure

>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1}	Back alignment and structure

>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A	Back alignment and structure

>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1}	Back alignment and structure

>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens}	Back alignment and structure

>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A	Back alignment and structure

>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens}	Back alignment and structure

>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus}	Back alignment and structure

>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1	Back alignment and structure

>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A	Back alignment and structure

>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii}	Back alignment and structure

>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A	Back alignment and structure

>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646}	Back alignment and structure

>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae}	Back alignment and structure

>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646}	Back alignment and structure

>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1	Back alignment and structure

>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio}	Back alignment and structure

>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli}	Back alignment and structure

>2xm6_A Protein corresponding to locus C5321 from CFT073 strain; unknown function, SEL1-like repeats; 1.68A {Escherichia coli}	Back alignment and structure

>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1	Back alignment and structure

>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1	Back alignment and structure

>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A	Back alignment and structure

>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A	Back alignment and structure

>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus}	Back alignment and structure

>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1	Back alignment and structure

>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus}	Back alignment and structure

>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1	Back alignment and structure

>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus}	Back alignment and structure

>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1	Back alignment and structure

>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A	Back alignment and structure

>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans}	Back alignment and structure

>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis}	Back alignment and structure

>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens}	Back alignment and structure

>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A*	Back alignment and structure

>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus}	Back alignment and structure

>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ...

Back alignment and structure

>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus}	Back alignment and structure

>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans}	Back alignment and structure

>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis}	Back alignment and structure

>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A	Back alignment and structure

>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B*	Back alignment and structure

>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1	Back alignment and structure

>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A	Back alignment and structure

>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus}	Back alignment and structure

>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A	Back alignment and structure

>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A	Back alignment and structure

>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A	Back alignment and structure

>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A	Back alignment and structure

>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A	Back alignment and structure

>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae}	Back alignment and structure

>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A*	Back alignment and structure

>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A	Back alignment and structure

>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus}	Back alignment and structure

>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis}	Back alignment and structure

>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A*	Back alignment and structure

>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans}	Back alignment and structure

>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans}	Back alignment and structure

>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli}	Back alignment and structure

>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A	Back alignment and structure

>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1	Back alignment and structure

>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1	Back alignment and structure

Back alignment and structure

>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis}	Back alignment and structure

>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae}	Back alignment and structure

>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B*	Back alignment and structure

>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A*	Back alignment and structure

>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans}	Back alignment and structure

>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1	Back alignment and structure

>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A	Back alignment and structure

>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus}	Back alignment and structure

>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus}	Back alignment and structure

>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens}	Back alignment and structure

>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans}	Back alignment and structure

>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris}	Back alignment and structure

>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A	Back alignment and structure

>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A*	Back alignment and structure

>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B*	Back alignment and structure

>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris}	Back alignment and structure

>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens}	Back alignment and structure

>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A	Back alignment and structure

>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus}	Back alignment and structure

>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A*	Back alignment and structure

>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A	Back alignment and structure

>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus}	Back alignment and structure

>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A	Back alignment and structure

>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae}	Back alignment and structure

>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1	Back alignment and structure

>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B*	Back alignment and structure

>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A	Back alignment and structure

>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1	Back alignment and structure

>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A	Back alignment and structure

>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A*	Back alignment and structure

>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A	Back alignment and structure

>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus}	Back alignment and structure

>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1	Back alignment and structure

>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8	Back alignment and structure

>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus}	Back alignment and structure

>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A	Back alignment and structure

>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A*	Back alignment and structure

>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A	Back alignment and structure

>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens}	Back alignment and structure

>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1	Back alignment and structure

>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1	Back alignment and structure

>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A	Back alignment and structure

>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A*	Back alignment and structure

>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A	Back alignment and structure

>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans}	Back alignment and structure

>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A	Back alignment and structure

>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis}	Back alignment and structure

>3e4b_A ALGK; tetratricopeptide repeat, superhelix, alginate biosynt pseudomonas, protein binding; 2.50A {Pseudomonas fluorescens}	Back alignment and structure

>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A	Back alignment and structure

>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A*	Back alignment and structure

>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis}	Back alignment and structure

>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus}	Back alignment and structure

>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7	Back alignment and structure

>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans}	Back alignment and structure

>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis}	Back alignment and structure

>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A	Back alignment and structure

>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis}	Back alignment and structure

>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8	Back alignment and structure

>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A	Back alignment and structure

>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A	Back alignment and structure

>1xi4_A Clathrin heavy chain; alpha-ZIG-ZAG, beta-propeller, endocytosis-exocyto complex; 7.90A {Bos taurus} SCOP: i.23.1.1 PDB: 1xi5_A 3iyv_A	Back alignment and structure

>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis}	Back alignment and structure

>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2	Back alignment and structure

>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A*	Back alignment and structure

>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus}	Back alignment and structure

>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A*	Back alignment and structure

>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2	Back alignment and structure

>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli}	Back alignment and structure

>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana}	Back alignment and structure

>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae}	Back alignment and structure

>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A	Back alignment and structure

>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1	Back alignment and structure

>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A	Back alignment and structure

>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B	Back alignment and structure

>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A*	Back alignment and structure

>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp}	Back alignment and structure

>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A	Back alignment and structure

>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis}	Back alignment and structure

>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7	Back alignment and structure

>3rjv_A Putative SEL1 repeat protein; alpha-alpha superhelix, structural genomics, joint center FO structural genomics, JCSG; HET: MSE; 1.65A {Klebsiella pneumoniae subsp}	Back alignment and structure

>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A	Back alignment and structure

>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana}	Back alignment and structure

>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7	Back alignment and structure

>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis}	Back alignment and structure

>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A*	Back alignment and structure

>2r5s_A Uncharacterized protein VP0806; APC090868.1, vibrio parahaemolyticus RIMD 22 structural genomics, PSI-2, protein structure initiative; HET: MES; 2.14A {Vibrio parahaemolyticus}	Back alignment and structure

>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3	Back alignment and structure

>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis}	Back alignment and structure

>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3	Back alignment and structure

>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7	Back alignment and structure

>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A	Back alignment and structure

>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens}	Back alignment and structure

>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A	Back alignment and structure

>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis}	Back alignment and structure

>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633}	Back alignment and structure

>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A	Back alignment and structure

>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1	Back alignment and structure

>4f3v_A ESX-1 secretion system protein ECCA1; tetratricopeptide repeat, TPR domain, ATPase, protein secret protein transport; 2.00A {Mycobacterium tuberculosis}	Back alignment and structure

>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B	Back alignment and structure

>1zu2_A Mitochondrial import receptor subunit TOM20-3; TPR, tetratricopeptide repeat like, TPR-like, transport protein; NMR {Arabidopsis thaliana} SCOP: a.118.8.1	Back alignment and structure

>3ffl_A Anaphase-promoting complex subunit 7; tetratricopeptide repeat motif, helis-turn-helix, cell cycle division, mitosis, TPR repeat; 2.50A {Homo sapiens}	Back alignment and structure

>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>3bee_A Putative YFRE protein; putaive YFRE protein, structural GE PSI-2, protein structure initiative; 2.15A {Vibrio parahaemolyticus rimd 2210633}	Back alignment and structure

>3u64_A Protein TP_0956; tetratrico peptide repeat, protein-prote interaction, syphilis, lipoprotein, transport protein; 2.30A {Treponema pallidum subsp} PDB: 4di3_A 4di4_A*	Back alignment and structure

>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A	Back alignment and structure

>3ly7_A Transcriptional activator CADC; alpha/beta domain, alpha domain, DNA-binding, transcription regulation, transmembrane; 1.80A {Escherichia coli} PDB: 3lya_A 3ly8_A 3ly9_A	Back alignment and structure

>1klx_A Cysteine rich protein B; structural genomics, helix-turn-helix, right handed super helix, modular structure', hydrolase; 1.95A {Helicobacter pylori} SCOP: a.118.18.1	Back alignment and structure

>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>3t5v_B Nuclear mRNA export protein THP1; PCI, mRNA nuclear export, mRNA, nuclear, transcription; 2.90A {Saccharomyces cerevisiae}	Back alignment and structure

>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae}	Back alignment and structure

>1b89_A Protein (clathrin heavy chain); triskelion, coated vesicles, endocytosis, SELF- assembly, alpha-alpha superhelix; 2.60A {Bos taurus} SCOP: a.118.1.3	Back alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST

Original result of RPS-BLAST against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	E-value
Query		466
d1hz4a_		366	a.118.8.2 (A:) Transcription factor MalT domain II	2e-10

>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Length = 366	Back information, alignment and structure


class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Transcription factor MalT domain III
domain: Transcription factor MalT domain III
species: Escherichia coli [TaxId: 562]

 Score = 59.5 bits (142), Expect = 2e-10
 Identities = 37/383 (9%), Positives = 106/383 (27%), Gaps = 27/383 (7%)

Query: 58  DDVKFEAASVLAELYETQLLSNLSKPILRRAIEL-SQHSIYWHCRLIFQLAQIHAGEKDY 116
           D +  E  ++ A++       + ++ + + A+E       Y        L ++   + + 
Sbjct: 8   DTMHAEFNALRAQVAINDGNPDEAERLAKLALEELPPGWFYSRIVATSVLGEVLHCKGEL 67

Query: 117 ELASSLLGVGVDYANISNAQYTRVLFLLSRCMLLLIDKKVNDAVQLLTQAGYQVENWTGS 176
             + +L+      A   +  +  +  L+ +  +L     +  A +   +A   +      
Sbjct: 68  TRSLALMQQTEQMARQHDVWHYALWSLIQQSEILFAQGFLQTAWETQEKAFQLINEQHLE 127

Query: 177 QYQKEYLKVFFLVLQVCHYLMAGQVKSVKPCLKQLQQSILTIMQPTWPSDEVVSGPNVGD 236
           Q       V              ++   +   +   + + +           +       
Sbjct: 128 QLPMHEFLVRIRA---QLLWAWARLDEAEASARSGIEVLSSYQPQQQLQCLAMLIQCSLA 184

Query: 237 MFIWMPKEHLYVVVYLVTVIGHLKFFGVTGTAGTEVERLSQERELWTFANLNLAIVYLRG 296
                                              +       +  + AN    I +   
Sbjct: 185 RGDLDNARSQLN------------------RLENLLGNGKYHSDWISNANKVRVIYWQMT 226

Query: 297 KREGDFAALLERINPETLTSHSHSLRAAAYYVQGLQSFFQARYNEAKRYLRETLKMANAE 356
             +   A  L           ++      +            +  A+  L E  + A + 
Sbjct: 227 GDKAAAANWLRHT--AKPEFANNHFLQGQWRNIARAQILLGEFEPAEIVLEELNENARSL 284

Query: 357 DLNRLTSCSLVLLGHIFLSLGNHRESMNMVTPAMQLASKIPDVHVQLWASAILKDLYKIL 416
            L    + +L+LL  ++   G   ++  ++  A++LA++   +   +     +    + L
Sbjct: 285 RLMSDLNRNLLLLNQLYWQAGRKSDAQRVLLDALKLANRTGFISHFVIEGEAMAQQLRQL 344

Query: 417 NDPVRENEALQMHCNFSQMLLKD 439
                  E  Q     +Q +L++
Sbjct: 345 IQLNTLPELEQHR---AQRILRE 364

PyMOL of d1hz4a_

Homologous Domains Detected by HHsearch

Original result of HHsearch against SCOP70(version1.75) database

ID	Alignment Graph	Length	Definition	Probability
Query		466
d1hz4a_		366	Transcription factor MalT domain III {Escherichia	99.61
d1hz4a_		366	Transcription factor MalT domain III {Escherichia	99.23
d1w3ba_		388	O-GlcNAc transferase p110 subunit, OGT {Human (Hom	99.08
d1w3ba_		388	O-GlcNAc transferase p110 subunit, OGT {Human (Hom	99.07
d1fcha_		323	Peroxin pex5 (peroxisomal targeting signal 1 (PTS1	98.97
d1fcha_		323	Peroxin pex5 (peroxisomal targeting signal 1 (PTS1	98.37
d1qqea_		290	Vesicular transport protein sec17 {Baker's yeast (	98.31
d1qqea_		290	Vesicular transport protein sec17 {Baker's yeast (	98.23
d1elra_		128	Hop {Human (Homo sapiens) [TaxId: 9606]}	97.99
d2hr2a1		156	Hypothetical protein CT2138 {Chlorobium tepidum [T	97.87
d2hr2a1		156	Hypothetical protein CT2138 {Chlorobium tepidum [T	97.8
d1xnfa_		259	Lipoprotein NlpI {Escherichia coli [TaxId: 562]}	97.75
d1hxia_		112	Peroxin pex5 (peroxisomal targeting signal 1 (PTS1	97.7
d1xnfa_		259	Lipoprotein NlpI {Escherichia coli [TaxId: 562]}	97.7
d1elra_		128	Hop {Human (Homo sapiens) [TaxId: 9606]}	97.67
d1hxia_		112	Peroxin pex5 (peroxisomal targeting signal 1 (PTS1	97.66
d1p5qa1		170	FKBP52 (FKBP4), C-terminal domain {Human (Homo sap	97.46
d2h6fa1		315	Protein farnesyltransferase alpha-subunit {Human (	97.46
d2c2la1		201	STIP1 homology and U box-containing protein 1, STU	97.45
d1hh8a_		192	Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H	97.42
d2c2la1		201	STIP1 homology and U box-containing protein 1, STU	97.35
d2fbna1		153	Putative 70 kda peptidylprolyl isomerase PFL2275c	97.3
d1a17a_		159	Protein phosphatase 5 {Human (Homo sapiens) [TaxId	97.2
d1elwa_		117	Hop {Human (Homo sapiens) [TaxId: 9606]}	97.17
d1kt1a1		168	FKBP51, C-terminal domain {Monkey (Saimiri bolivie	97.11
d1kt1a1		168	FKBP51, C-terminal domain {Monkey (Saimiri bolivie	97.07
d1a17a_		159	Protein phosphatase 5 {Human (Homo sapiens) [TaxId	97.02
d1hh8a_		192	Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H	96.94
d1p5qa1		170	FKBP52 (FKBP4), C-terminal domain {Human (Homo sap	96.92
d1elwa_		117	Hop {Human (Homo sapiens) [TaxId: 9606]}	96.82
d1ihga1		169	Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]}	96.71
d2fbna1		153	Putative 70 kda peptidylprolyl isomerase PFL2275c	96.55
d1tjca_		95	Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human	96.5
d2h6fa1		315	Protein farnesyltransferase alpha-subunit {Human (	96.41
d1ihga1		169	Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]}	96.39
d1ouva_		265	Cysteine rich protein C (HcpC) {Helicobacter pylor	96.36
d1nzna_		122	Mitochondria fission protein Fis1 {Human (Homo sap	96.1
d1tjca_		95	Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human	95.65
d1nzna_		122	Mitochondria fission protein Fis1 {Human (Homo sap	95.27
d1dcea1		334	Rab geranylgeranyltransferase alpha-subunit, N-ter	94.07
d2ff4a2		179	Probable regulatory protein EmbR, middle domain {M	93.82
d1ya0a1		497	SMG-7 {Human (Homo sapiens) [TaxId: 9606]}	93.32
d1dcea1		334	Rab geranylgeranyltransferase alpha-subunit, N-ter	93.03
d2ff4a2		179	Probable regulatory protein EmbR, middle domain {M	92.15
d1zu2a1		145	Mitochondrial import receptor subunit tom20-3 {Tha	90.95
d2pqrb1		124	Mitochondria fission protein Fis1 {Baker's yeast (	90.58
d1ya0a1		497	SMG-7 {Human (Homo sapiens) [TaxId: 9606]}	87.6
d1zu2a1		145	Mitochondrial import receptor subunit tom20-3 {Tha	86.23
d1zbpa1		264	Hypothetical protein VPA1032 {Vibrio parahaemolyti	85.21
d2onda1		308	Cleavage stimulation factor 77 kDa subunit CSTF3 {	84.04
d1zbpa1		264	Hypothetical protein VPA1032 {Vibrio parahaemolyti	83.88
d1ouva_		265	Cysteine rich protein C (HcpC) {Helicobacter pylor	82.22
d1klxa_		133	Cysteine rich protein B (HcpB) {Helicobacter pylor	82.01
d2onda1		308	Cleavage stimulation factor 77 kDa subunit CSTF3 {	80.91

>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Transcription factor MalT domain III
domain: Transcription factor MalT domain III
species: Escherichia coli [TaxId: 562]

Probab=99.61  E-value=3.9e-12  Score=118.66  Aligned_cols=325  Identities=12%  Similarity=0.096  Sum_probs=217.1

Q ss_pred             HHHHHHHHHHHHHHHHhCCccchhHHHHHHHHhhc-hhhhhHHHHHHHHHHHhcccccHHHHHHHHHhHHHHHHHhcChH
Q psy9584          59 DVKFEAASVLAELYETQLLSNLSKPILRRAIELSQ-HSIYWHCRLIFQLAQIHAGEKDYELASSLLGVGVDYANISNAQY  137 (466)
Q Consensus        59 d~K~~a~slLa~~y~~~~~~~~ak~~l~k~i~~s~-~~~~W~~~~~fqLA~i~~~~~D~~~A~~~L~~g~~~A~~~~d~~  137 (466)
                      .+.-+...+.|+++...|++..|...++++++... +.+......++.+|.++...||++.|++.++.+..++...++..
T Consensus         9 ~~~ae~~~lrA~~~~~~g~~~~A~~~~~~aL~~~~~~~~~~~~~a~~~lg~~~~~~g~~~~A~~~~~~a~~~~~~~~~~~   88 (366)
T d1hz4a_           9 TMHAEFNALRAQVAINDGNPDEAERLAKLALEELPPGWFYSRIVATSVLGEVLHCKGELTRSLALMQQTEQMARQHDVWH   88 (366)
T ss_dssp             HHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTCCTTCHHHHHHHHHHHHHHHHHHTCHHHHHHHHHHHHHHHHHTTCHH
T ss_pred             chhHHHHHHHHHHHHHCCCHHHHHHHHHHHHhhCcCCCcHHHHHHHHHHHHHHHHCCCHHHHHHHHHHHHHHHHhhcchH
Confidence            35667888999999999999999999999999886 34445566778899999999999999999999999999999988


Q ss_pred             HHHHHHHHHHHHHhcccCccHHHHHHHHHhhHhhhhccccchHhhHHHHHHHHHHHhhhhhhhhhhhhHHHHHHHHHHHH
Q psy9584         138 TRVLFLLSRCMLLLIDKKVNDAVQLLTQAGYQVENWTGSQYQKEYLKVFFLVLQVCHYLMAGQVKSVKPCLKQLQQSILT  217 (466)
Q Consensus       138 ~~~lf~ls~~~~ll~~~~~~~v~~al~~~~~l~~~~~g~~~~~e~L~~~~~~L~i~~~l~~g~v~~~k~~lkqLq~~~q~  217 (466)
                      ..+......+.++....+.......+..+-.+.+...+.. .......+.  .....+...|+...+...+.+.......
T Consensus        89 ~~~~~~~~~~~~~~~~~~~~~a~~~~~~al~~~~~~~~~~-~~~~~~~~~--~la~~~~~~~~~~~a~~~~~~~~~~~~~  165 (366)
T d1hz4a_          89 YALWSLIQQSEILFAQGFLQTAWETQEKAFQLINEQHLEQ-LPMHEFLVR--IRAQLLWAWARLDEAEASARSGIEVLSS  165 (366)
T ss_dssp             HHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHTTCTT-STHHHHHHH--HHHHHHHHTTCHHHHHHHHHHHHHHTTT
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHhHhcccch-hhHHHHHHH--HHHHHHHHhcchhhhHHHHHHHHHHhhh
Confidence            7777766666665554444444455555555555432221 111111111  2233445667777776666444322211


Q ss_pred             hcCCCCCCCCccCCCCCCcccccCcchhHHHHHHHHHHhhhhhHHHhcCchhh------HHhhh----hcchhhHHHHHH
Q psy9584         218 IMQPTWPSDEVVSGPNVGDMFIWMPKEHLYVVVYLVTVIGHLKFFGVTGTAGT------EVERL----SQERELWTFANL  287 (466)
Q Consensus       218 i~~~~w~~~~~~~~~~~~~~f~WLpk~~l~aLvyl~tv~~~lk~Flv~G~~~~------eAl~~----~~~~~~~~~~~l  287 (466)
                                            .-+.....++.....+      +...|....      +|...    ...+.....+..
T Consensus       166 ----------------------~~~~~~~~~~~~~~~~------~~~~~~~~~a~~~~~~a~~~~~~~~~~~~~~~~~~~  217 (366)
T d1hz4a_         166 ----------------------YQPQQQLQCLAMLIQC------SLARGDLDNARSQLNRLENLLGNGKYHSDWISNANK  217 (366)
T ss_dssp             ----------------------SCGGGGHHHHHHHHHH------HHHHTCHHHHHHHHHHHHHHHTTSCCCHHHHHHHHH
T ss_pred             ----------------------hhhhhHHHHHHHHHHH------HHhhhhHHHHHHHHHHHHHHHHHhcccCchHHHHHH
Confidence                                  0111223334444444      455555543      23333    112344456778


Q ss_pred             HHHHHHHhCCCchHHHHHHhhhCCCccccccchhhHHHHHHHhHHHhhhhcHHHHHHHHHHHHHhhhhhhhhhHHHhHHH
Q psy9584         288 NLAIVYLRGKREGDFAALLERINPETLTSHSHSLRAAAYYVQGLQSFFQARYNEAKRYLRETLKMANAEDLNRLTSCSLV  367 (466)
Q Consensus       288 Nlai~Yl~~~~~~e~~~~l~~i~~~~~~~~~~~L~a~~~yv~~~~~~~~~~~~eAk~~lre~lk~a~~~~l~~l~~~~l~  367 (466)
                      .++.+|...++..+....+++.-.... ...... ....+.-|...+..|++.+|.+++++++.++...++....+.++.
T Consensus       218 ~~~~~~~~~~~~~~a~~~~~~~~~~~~-~~~~~~-~~~~~~la~~~~~~g~~~~A~~~~~~al~~~~~~~~~~~~~~~~~  295 (366)
T d1hz4a_         218 VRVIYWQMTGDKAAAANWLRHTAKPEF-ANNHFL-QGQWRNIARAQILLGEFEPAEIVLEELNENARSLRLMSDLNRNLL  295 (366)
T ss_dssp             HHHHHHHHTTCHHHHHHHHHHSCCCCC-TTCGGG-HHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHTTCHHHHHHHHH
T ss_pred             HHHHHHHhcccHHHHHHHHHHHHHhcc-ccchHH-HHHHHHHHHHHHHcCCHHHHHHHHHHHHHHHhhcccChHHHHHHH
Confidence            889899887755443333333222110 111111 222233344457899999999999999999999999999999999


Q ss_pred             HHHHHHHhcCChHHHHHhhHHHHHHhhcCCChhHHHHHHHHHHHHHHHc
Q psy9584         368 LLGHIFLSLGNHRESMNMVTPAMQLASKIPDVHVQLWASAILKDLYKIL  416 (466)
Q Consensus       368 llg~i~l~~~~~~ea~~~~~~a~~lAkK~~D~~~qlw~~~lL~~ly~~~  416 (466)
                      .+|.+|...|+.++|.+....|+.++.+++.+...+.....+.++++..
T Consensus       296 ~la~~~~~~g~~~~A~~~l~~Al~l~~~~~~~~~~~~~~~~~~~~~~~l  344 (366)
T d1hz4a_         296 LLNQLYWQAGRKSDAQRVLLDALKLANRTGFISHFVIEGEAMAQQLRQL  344 (366)
T ss_dssp             HHHHHHHHHTCHHHHHHHHHHHHHHHHHHCCCHHHHTTHHHHHHHHHHH
T ss_pred             HHHHHHHHCCCHHHHHHHHHHHHHHhhhcCcHHHHHHHHHHHHHHHHHH
Confidence            9999999999999999999999999999998877665555555555544

PyMOL of d1hz4a_

>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]}	Back information, alignment and structure

>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]}	Back information, alignment and structure

>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]}	Back information, alignment and structure

>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]}	Back information, alignment and structure

>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]}	Back information, alignment and structure

>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]}	Back information, alignment and structure

>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]}	Back information, alignment and structure

>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]}	Back information, alignment and structure

>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]}	Back information, alignment and structure

>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]}	Back information, alignment and structure

>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]}	Back information, alignment and structure

>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1dcea1 a.118.6.1 (A:1-241,A:351-443) Rab geranylgeranyltransferase alpha-subunit, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]}	Back information, alignment and structure

>d2ff4a2 a.118.8.3 (A:105-283) Probable regulatory protein EmbR, middle domain {Mycobacterium tuberculosis [TaxId: 1773]}	Back information, alignment and structure

>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}	Back information, alignment and structure

>d1ya0a1 a.118.8.1 (A:1-497) SMG-7 {Human (Homo sapiens) [TaxId: 9606]}	Back information, alignment and structure

>d1zu2a1 a.118.8.1 (A:1-145) Mitochondrial import receptor subunit tom20-3 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]}	Back information, alignment and structure

>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]}	Back information, alignment and structure

>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure

>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]}	Back information, alignment and structure

>d1ouva_ a.118.18.1 (A:) Cysteine rich protein C (HcpC) {Helicobacter pylori [TaxId: 210]}	Back information, alignment and structure

>d1klxa_ a.118.18.1 (A:) Cysteine rich protein B (HcpB) {Helicobacter pylori [TaxId: 210]}	Back information, alignment and structure

>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]}	Back information, alignment and structure