Psyllid ID: psy9665

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------
MALVPFFHGYGLLLMLQAICMNNKLVVLPHFDGHLFLSSIEKYRVTLLPAVPPLVVFLAKSPLVDQYDLSSLTNIRCGAAPVGKSTLDQVGERLGLSMDSMKQGYGMTELTILVTFSDLDVPSSSVGKVMPSMKMKVLVKSHTMGSQDSFVISGDEIQFAPYCRKMSLGAYLCHWLKLKGKQTVLVLGFGSQSCEENLGADNISLIS
cccccHHHHHHHHHHHHHHHcccEEEEEccccHHHHHHHHHHcccccccccHHHHHHHHHcccccccccccccccccccccccHHHHHHHHHHHccccccEEEEcccccccccccccccccccccEEccccccEEEEEccccccccccEEEEEcccccccccccHHHHHHHcccccccccEEEEEcccccccccccccccccccccc
cccHHHHHHHHHHHHHHHHHHccEEEEEccccHHHHHHHHHHccccEcccccHHHHHHHcccccccccHHHHHHHHcccccccHHHHHHHHHHccccccEEEEcccccccccEEEccccccccccccEEccccEEEEEcccccccccEEEEEEccccccccccccHHHHHHccccccccccEEEcccccEccccHHHcccccEEEcc
malvpffhGYGLLLMLQAICMNnklvvlphfdghlfLSSIEKYRVTllpavpplVVFLaksplvdqydlssltnircgaapvgkstlDQVGERLGLSMdsmkqgygmteLTILVTfsdldvpsssvgkvmpsmKMKVLVKshtmgsqdsfvisgdeiqfapycRKMSLGAYLCHWLKLKGKQTVLVLGFgsqsceenlgadnislis
MALVPFFHGYGLLLMLQAICMNNKLVVLPHFDGHLFLSSIEKYRVTLLPAVPPLVVFLAKSPLVDQYDLSSltnircgaapvgkstldQVGERLGLSMDSMKQGYGMTELTILVTFSDLDVPSSSVGKVMPSMKMKVLVKSHTMGSQDSFVISGDEIQFAPYCRKMSLGAYLCHWLKLKGKQTVLVLGFGSqsceenlgadnislis
MALVPFFHGYGLLLMLQAICMNNKLVVLPHFDGHLFLSSIEKYRVTllpavpplvvFLAKSPLVDQYDLSSLTNIRCGAAPVGKSTLDQVGERLGLSMDSMKQGYGMTELTILVTFSDLDVPSSSVGKVMPSMKMKVLVKSHTMGSQDSFVISGDEIQFAPYCRKMSLGAYLCHWLKLKGKQTVLVLGFGSQSCEENLGADNISLIS
**LVPFFHGYGLLLMLQAICMNNKLVVLPHFDGHLFLSSIEKYRVTLLPAVPPLVVFLAKSPLVDQYDLSSLTNIRCGAAPVGKSTLDQVGERLGLSMDSMKQGYGMTELTILVTFSDLDV**************KVLVKSHTMGSQDSFVISGDEIQFAPYCRKMSLGAYLCHWLKLKGKQTVLVLGFGSQSC*************
MALVPFFHGYGLLLMLQAICMNNKLVVLPHFDGHLFLSSIEKYRVTLLPAVPPLVVFLAKSPLVDQYDLSSLTNIRCGAAPVGKSTLDQVGERLGLSMDSMKQGYGMTELTILVTFSDLDVPSSSVGKVMPSMKMKVLVKSHTMGSQDSFVISGDEIQFAPYCRKMSLGAYLCHWLKLKGKQTVLVLGFGSQSCEENLGADNISLIS
MALVPFFHGYGLLLMLQAICMNNKLVVLPHFDGHLFLSSIEKYRVTLLPAVPPLVVFLAKSPLVDQYDLSSLTNIRCGAAPVGKSTLDQVGERLGLSMDSMKQGYGMTELTILVTFSDLDVPSSSVGKVMPSMKMKVLVKSHTMGSQDSFVISGDEIQFAPYCRKMSLGAYLCHWLKLKGKQTVLVLGFGSQSCEENLGADNISLIS
MALVPFFHGYGLLLMLQAICMNNKLVVLPHFDGHLFLSSIEKYRVTLLPAVPPLVVFLAKSPLVDQYDLSSLTNIRCGAAPVGKSTLDQVGERLGLSMDSMKQGYGMTELTILVTFSDLDVPSSSVGKVMPSMKMKVLVKSHTMGSQDSFVISGDEIQFAPYCRKMSLGAYLCHWLKLKGKQTVLVLGFGSQSCEENLGADNISLIS
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MALVPFFHGYGLLLMLQAICMNNKLVVLPHFDGHLFLSSIEKYRVTLLPAVPPLVVFLAKSPLVDQYDLSSLTNIRCGAAPVGKSTLDQVGERLGLSMDSMKQGYGMTELTILVTFSDLDVPSSSVGKVMPSMKMKVLVKSHTMGSQDSFVISGDEIQFAPYCRKMSLGAYLCHWLKLKGKQTVLVLGFGSQSCEENLGADNISLIS
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query207 2.2.26 [Sep-21-2011]
Q54P79551 Probable 4-coumarate--CoA yes N/A 0.768 0.288 0.376 2e-21
Q54P77551 Probable 4-coumarate--CoA no N/A 0.797 0.299 0.367 2e-20
Q26304 548 Luciferin 4-monooxygenase N/A N/A 0.652 0.246 0.392 3e-20
P08659 550 Luciferin 4-monooxygenase N/A N/A 0.652 0.245 0.392 1e-19
Q01158 548 Luciferin 4-monooxygenase N/A N/A 0.652 0.246 0.378 6e-19
P13129 548 Luciferin 4-monooxygenase N/A N/A 0.652 0.246 0.385 6e-19
P31684 545 4-coumarate--CoA ligase 1 N/A N/A 0.657 0.249 0.393 7e-19
Q54P78551 Probable 4-coumarate--CoA no N/A 0.753 0.283 0.364 1e-18
O24145 547 4-coumarate--CoA ligase 1 N/A N/A 0.657 0.248 0.379 2e-18
Q27757 545 Luciferin 4-monooxygenase N/A N/A 0.652 0.247 0.371 2e-18
>sp|Q54P79|4CL3_DICDI Probable 4-coumarate--CoA ligase 3 OS=Dictyostelium discoideum GN=4cl3 PE=3 SV=2 Back     alignment and function desciption
 Score =  102 bits (254), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 64/170 (37%), Positives = 97/170 (57%), Gaps = 11/170 (6%)

Query: 1   MALVPFFHGYGLLLMLQAICMNN-KLVVLPHFDGHLFLSSIEKYRVTLLPAVPPLVVFLA 59
           + ++PFFH +GL+L +  +     ++V LP F+   FL  I+KY+V +   VPP+ +  A
Sbjct: 244 IGVLPFFHSFGLMLHIMLMVKQGYRIVTLPKFEPVRFLELIKKYKVAMSFIVPPIAIMFA 303

Query: 60  KSPLVDQYDLSSLTNIRCGAAPVGKSTLDQVGERLGLSMDSMKQGYGMTELT--ILVTFS 117
           KSP+VD++DLSSL  + CGAAP+G    D + ER    +  +KQGYG TEL+    VT +
Sbjct: 304 KSPIVDKFDLSSLRTLFCGAAPLGSEIEDLIKERFKGRL-VIKQGYGATELSPCCFVTPN 362

Query: 118 DLDVPSSSVGKVMPSMKMKVLVKSHT-----MGSQDSFVISGDEIQFAPY 162
            L V S S G ++P++  K+ + S T     MG +    I G  +    Y
Sbjct: 363 GL-VKSGSSGTLLPNLLAKI-ISSETGENLGMGEKGEICIKGPNVMLGYY 410

Dictyostelium discoideum (taxid: 44689)
EC: 6EC: .EC: 2EC: .EC: 1EC: .EC: 1EC: 2
>sp|Q54P77|4CL1_DICDI Probable 4-coumarate--CoA ligase 1 OS=Dictyostelium discoideum GN=4cl1 PE=3 SV=1 Back     alignment and function description
>sp|Q26304|LUCI_LUCMI Luciferin 4-monooxygenase OS=Luciola mingrelica PE=1 SV=1 Back     alignment and function description
>sp|P08659|LUCI_PHOPY Luciferin 4-monooxygenase OS=Photinus pyralis PE=1 SV=1 Back     alignment and function description
>sp|Q01158|LUCI_LUCLA Luciferin 4-monooxygenase OS=Luciola lateralis PE=2 SV=1 Back     alignment and function description
>sp|P13129|LUCI_LUCCR Luciferin 4-monooxygenase OS=Luciola cruciata PE=1 SV=1 Back     alignment and function description
>sp|P31684|4CL1_SOLTU 4-coumarate--CoA ligase 1 OS=Solanum tuberosum GN=4CL1 PE=3 SV=1 Back     alignment and function description
>sp|Q54P78|4CL2_DICDI Probable 4-coumarate--CoA ligase 2 OS=Dictyostelium discoideum GN=4cl2 PE=3 SV=1 Back     alignment and function description
>sp|O24145|4CL1_TOBAC 4-coumarate--CoA ligase 1 OS=Nicotiana tabacum GN=4CL1 PE=2 SV=1 Back     alignment and function description
>sp|Q27757|LUCI_PHOPE Luciferin 4-monooxygenase OS=Photuris pennsylvanica PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query207
347969961 374 AGAP003481-PA [Anopheles gambiae str. PE 0.599 0.331 0.541 1e-27
195144898 544 GL23410 [Drosophila persimilis] gi|19410 0.589 0.224 0.492 2e-27
125775131 544 GA19414 [Drosophila pseudoobscura pseudo 0.589 0.224 0.492 2e-27
383854344 537 PREDICTED: luciferin 4-monooxygenase-lik 0.700 0.270 0.442 2e-27
350410978 544 PREDICTED: luciferin 4-monooxygenase-lik 0.657 0.25 0.467 5e-27
194746462 545 GF16109 [Drosophila ananassae] gi|190628 0.589 0.223 0.484 5e-27
340714658 537 PREDICTED: luciferin 4-monooxygenase-lik 0.657 0.253 0.467 5e-27
195037044 544 GH18500 [Drosophila grimshawi] gi|193894 0.541 0.205 0.508 1e-26
170035152 555 luciferin 4-monooxygenase [Culex quinque 0.657 0.245 0.482 1e-26
195400056 544 GJ14206 [Drosophila virilis] gi|19414219 0.589 0.224 0.484 1e-26
>gi|347969961|ref|XP_309687.5| AGAP003481-PA [Anopheles gambiae str. PEST] gi|333466680|gb|EAA05417.6| AGAP003481-PA [Anopheles gambiae str. PEST] Back     alignment and taxonomy information
 Score =  128 bits (322), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 90/133 (67%), Gaps = 9/133 (6%)

Query: 1   MALVPFFH---GYGLLLMLQAICMNNKLVVLPHFDGHLFLSSIEKYRVTLLPAVPPLVVF 57
           +A+ P FH   G GLL M+   C   + VV+P FD HLFLS IEKYRV L+  VPPL+VF
Sbjct: 240 LAVTPLFHVVAGVGLLNMVTNNC---RCVVMPRFDPHLFLSCIEKYRVNLMTLVPPLMVF 296

Query: 58  LAKSPLVDQYDLSSLTNIRCGAAPVGKSTLDQVGERLGLSMDSMKQGYGMTELTILVTFS 117
           LAK P+VD YDLSSL  + CGAAP+ K   DQV ERLG++   ++QGYGM+E T+ V   
Sbjct: 297 LAKHPMVDNYDLSSLMTLFCGAAPLSKEIEDQVRERLGVAF--IRQGYGMSETTLGVLMQ 354

Query: 118 D-LDVPSSSVGKV 129
           D  +  + SVGKV
Sbjct: 355 DGFENKAGSVGKV 367

Source: Anopheles gambiae str. PEST

Species: Anopheles gambiae

Genus: Anopheles

Family: Culicidae

Order: Diptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|195144898|ref|XP_002013433.1| GL23410 [Drosophila persimilis] gi|194102376|gb|EDW24419.1| GL23410 [Drosophila persimilis] Back     alignment and taxonomy information
>gi|125775131|ref|XP_001358817.1| GA19414 [Drosophila pseudoobscura pseudoobscura] gi|54638558|gb|EAL27960.1| GA19414 [Drosophila pseudoobscura pseudoobscura] Back     alignment and taxonomy information
>gi|383854344|ref|XP_003702681.1| PREDICTED: luciferin 4-monooxygenase-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|350410978|ref|XP_003489199.1| PREDICTED: luciferin 4-monooxygenase-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|194746462|ref|XP_001955699.1| GF16109 [Drosophila ananassae] gi|190628736|gb|EDV44260.1| GF16109 [Drosophila ananassae] Back     alignment and taxonomy information
>gi|340714658|ref|XP_003395843.1| PREDICTED: luciferin 4-monooxygenase-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|195037044|ref|XP_001989975.1| GH18500 [Drosophila grimshawi] gi|193894171|gb|EDV93037.1| GH18500 [Drosophila grimshawi] Back     alignment and taxonomy information
>gi|170035152|ref|XP_001845435.1| luciferin 4-monooxygenase [Culex quinquefasciatus] gi|167876987|gb|EDS40370.1| luciferin 4-monooxygenase [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|195400056|ref|XP_002058634.1| GJ14206 [Drosophila virilis] gi|194142194|gb|EDW58602.1| GJ14206 [Drosophila virilis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query207
FB|FBgn0039156 544 CG6178 [Drosophila melanogaste 0.652 0.248 0.421 1.6e-23
DICTYBASE|DDB_G0284743551 4cl3 "4-coumarate-CoA ligase" 0.768 0.288 0.358 1.1e-19
UNIPROTKB|Q26304 548 Q26304 "Luciferin 4-monooxygen 0.652 0.246 0.371 1e-18
DICTYBASE|DDB_G0284831551 4cl1 "4-coumarate-CoA ligase" 0.772 0.290 0.360 1.1e-18
UNIPROTKB|P08659 550 P08659 "Luciferin 4-monooxygen 0.652 0.245 0.371 1.4e-18
WB|WBGene00008669544 acs-14 [Caenorhabditis elegans 0.661 0.251 0.342 9.7e-18
DICTYBASE|DDB_G0284745551 4cl2 "4-coumarate-CoA ligase" 0.772 0.290 0.337 3.5e-17
UNIPROTKB|G4MS65 557 MGG_04548 "4-coumarate-CoA lig 0.652 0.242 0.359 1.5e-15
ASPGD|ASPL0000006875 562 AN5990 [Emericella nidulans (t 0.729 0.268 0.327 1.9e-15
TAIR|locus:2158559 562 AT5G63380 [Arabidopsis thalian 0.642 0.236 0.333 5.3e-15
FB|FBgn0039156 CG6178 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 277 (102.6 bits), Expect = 1.6e-23, P = 1.6e-23
 Identities = 59/140 (42%), Positives = 88/140 (62%)

Query:     1 MALVPFFHGYGLLLMLQAICMNNKLVVLPHFDGHLFLSSIEKYRVTXXXXXXXXXXFLAK 60
             + ++P+FH +G L ++   C+  +LV LP F+  LFLS+IEKYRV           FLAK
Sbjct:   237 LTVIPWFHAFGCLTLITTACVGARLVYLPKFEEKLFLSAIEKYRVMMAFMVPPLMVFLAK 296

Query:    61 SPLVDQYDLSSLTNIRCGAAPVGKSTLDQVGERLGLSMDSMKQGYGMTE--LTILVTFSD 118
              P+VD+YDLSSL  + CGAAP+ + T DQ+ ER+G+    ++QGYG++E  L++LV   +
Sbjct:   297 HPIVDKYDLSSLMVLLCGAAPLSRETEDQIKERIGVPF--IRQGYGLSESTLSVLVQNDE 354

Query:   119 LDVPSSSVGKVMPSMKMKVL 138
                P S VG +   +  KV+
Sbjct:   355 FCKPGS-VGVLKVGIYAKVI 373
GO:0001676 "long-chain fatty acid metabolic process" evidence=IDA
GO:0004467 "long-chain fatty acid-CoA ligase activity" evidence=IDA
GO:0046949 "fatty-acyl-CoA biosynthetic process" evidence=IDA
GO:0045289 "luciferin monooxygenase activity" evidence=IDA
GO:0006637 "acyl-CoA metabolic process" evidence=IDA
GO:0004321 "fatty-acyl-CoA synthase activity" evidence=IDA
DICTYBASE|DDB_G0284743 4cl3 "4-coumarate-CoA ligase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|Q26304 Q26304 "Luciferin 4-monooxygenase" [Luciola mingrelica (taxid:27446)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0284831 4cl1 "4-coumarate-CoA ligase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|P08659 P08659 "Luciferin 4-monooxygenase" [Photinus pyralis (taxid:7054)] Back     alignment and assigned GO terms
WB|WBGene00008669 acs-14 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0284745 4cl2 "4-coumarate-CoA ligase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
UNIPROTKB|G4MS65 MGG_04548 "4-coumarate-CoA ligase" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
ASPGD|ASPL0000006875 AN5990 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
TAIR|locus:2158559 AT5G63380 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query207
cd05911487 cd05911, Firefly_Luc_like, Firefly luciferase of l 3e-42
cd05904504 cd05904, 4CL, 4-Coumarate-CoA Ligase (4CL) 2e-39
cd05929342 cd05929, BACL_like, Bacterial Bile acid CoA ligase 6e-25
PLN02246537 PLN02246, PLN02246, 4-coumarate--CoA ligase 1e-24
cd05917347 cd05917, FACL_like_2, Uncharacterized subfamily of 3e-24
pfam00501412 pfam00501, AMP-binding, AMP-binding enzyme 1e-22
cd05936468 cd05936, FC-FACS_FadD_like, Prokaryotic long-chain 8e-21
PRK06187521 PRK06187, PRK06187, long-chain-fatty-acid--CoA lig 9e-21
COG0318 534 COG0318, CaiC, Acyl-CoA synthetases (AMP-forming)/ 1e-19
cd04433338 cd04433, AFD_class_I, Adenylate forming domain, Cl 3e-18
cd05935430 cd05935, LC_FACS_like, Putative long-chain fatty a 2e-17
PRK08314 546 PRK08314, PRK08314, long-chain-fatty-acid--CoA lig 6e-17
PLN02330 546 PLN02330, PLN02330, 4-coumarate--CoA ligase-like 1 2e-15
PRK06710 563 PRK06710, PRK06710, long-chain-fatty-acid--CoA lig 3e-15
PLN02574 560 PLN02574, PLN02574, 4-coumarate--CoA ligase-like 1e-14
cd05920483 cd05920, 23DHB-AMP_lg, 2,3-dihydroxybenzoate-AMP l 1e-14
cd05903437 cd05903, CHC_CoA_lg, Cyclohexanecarboxylate-CoA li 1e-13
cd05944 359 cd05944, FACL_like_4, Uncharacterized subfamily of 4e-13
PRK05605 573 PRK05605, PRK05605, long-chain-fatty-acid--CoA lig 6e-13
PRK07529 632 PRK07529, PRK07529, AMP-binding domain protein; Va 8e-13
TIGR03205541 TIGR03205, pimA, dicarboxylate--CoA ligase PimA 5e-12
PRK12583 558 PRK12583, PRK12583, acyl-CoA synthetase; Provision 5e-12
PRK07656513 PRK07656, PRK07656, long-chain-fatty-acid--CoA lig 2e-11
cd05931 547 cd05931, FAAL, Fatty acyl-AMP ligase (FAAL) 2e-10
cd05922350 cd05922, FACL_like_6, Uncharacterized subfamily of 2e-10
cd12119517 cd12119, ttLC_FACS_AlkK_like, Fatty acyl-CoA synth 6e-10
PRK12406 509 PRK12406, PRK12406, long-chain-fatty-acid--CoA lig 1e-09
cd05926345 cd05926, FACL_fum10p_like, Subfamily of fatty acid 2e-09
cd05934421 cd05934, FACL_DitJ_like, Uncharacterized subfamily 2e-09
PRK07788549 PRK07788, PRK07788, acyl-CoA synthetase; Validated 4e-09
PRK13295547 PRK13295, PRK13295, cyclohexanecarboxylate-CoA lig 5e-09
cd05909489 cd05909, AAS_C, C-terminal domain of the acyl-acyl 6e-09
cd05970 537 cd05970, MACS_AAE_MA_like, Medium-chain acyl-CoA s 6e-09
PRK08315 559 PRK08315, PRK08315, AMP-binding domain protein; Va 1e-08
PRK08276 502 PRK08276, PRK08276, long-chain-fatty-acid--CoA lig 2e-08
cd05972430 cd05972, MACS_like, Medium-chain acyl-CoA syntheta 3e-08
PRK06188 524 PRK06188, PRK06188, acyl-CoA synthetase; Validated 6e-08
PRK07768 545 PRK07768, PRK07768, long-chain-fatty-acid--CoA lig 7e-08
PTZ00237 647 PTZ00237, PTZ00237, acetyl-CoA synthetase; Provisi 8e-08
PRK07470 528 PRK07470, PRK07470, acyl-CoA synthetase; Validated 1e-07
cd05912407 cd05912, OSB_CoA_lg, O-succinylbenzoate-CoA ligase 2e-07
COG0365 528 COG0365, Acs, Acyl-coenzyme A synthetases/AMP-(fat 4e-07
PRK07798533 PRK07798, PRK07798, acyl-CoA synthetase; Validated 6e-07
PRK06839496 PRK06839, PRK06839, acyl-CoA synthetase; Validated 1e-06
cd05907 456 cd05907, VL_LC_FACS_like, Long-chain fatty acid Co 2e-06
PRK05852534 PRK05852, PRK05852, acyl-CoA synthetase; Validated 2e-06
cd12118 520 cd12118, ttLC_FACS_AEE21_like, Fatty acyl-CoA synt 2e-06
PRK08316 523 PRK08316, PRK08316, acyl-CoA synthetase; Validated 3e-06
PRK13391511 PRK13391, PRK13391, acyl-CoA synthetase; Provision 9e-06
PRK03640483 PRK03640, PRK03640, O-succinylbenzoic acid--CoA li 2e-05
cd05941430 cd05941, MCS, Malonyl-CoA synthetase (MCS) 3e-05
cd05928 530 cd05928, MACS_euk, Eukaryotic Medium-chain acyl-Co 3e-05
PRK06178 567 PRK06178, PRK06178, acyl-CoA synthetase; Validated 7e-05
COG1022 613 COG1022, FAA1, Long-chain acyl-CoA synthetases (AM 7e-05
cd05974433 cd05974, MACS_like_1, Uncharacterized subfamily of 9e-05
cd05930445 cd05930, A_NRPS, The adenylation domain of nonribo 1e-04
cd05932504 cd05932, LC_FACS_bac, Bacterial long-chain fatty a 2e-04
COG1021 542 COG1021, EntE, Peptide arylation enzymes [Secondar 2e-04
cd05908 499 cd05908, A_NRPS_MycA_like, The adenylation domain 2e-04
TIGR02275526 TIGR02275, DHB_AMP_lig, 2,3-dihydroxybenzoate-AMP 2e-04
PRK06334 539 PRK06334, PRK06334, long chain fatty acid--[acyl-c 3e-04
cd05924365 cd05924, FACL_like_5, Uncharacterized subfamily of 3e-04
PRK07786 542 PRK07786, PRK07786, long-chain-fatty-acid--CoA lig 5e-04
PRK13390501 PRK13390, PRK13390, acyl-CoA synthetase; Provision 9e-04
TIGR03208538 TIGR03208, cyc_hxne_CoA_lg, cyclohexanecarboxylate 9e-04
PRK12467 3956 PRK12467, PRK12467, peptide synthase; Provisional 0.001
TIGR01923436 TIGR01923, menE, O-succinylbenzoate-CoA ligase 0.001
PRK10946 536 PRK10946, entE, enterobactin synthase subunit E; P 0.001
PRK12467 3956 PRK12467, PRK12467, peptide synthase; Provisional 0.002
TIGR03098 517 TIGR03098, ligase_PEP_1, acyl-CoA ligase (AMP-form 0.002
COG1020642 COG1020, EntF, Non-ribosomal peptide synthetase mo 0.002
PRK13383516 PRK13383, PRK13383, acyl-CoA synthetase; Provision 0.002
cd05923495 cd05923, CBAL, 4-Chlorobenzoate-CoA ligase (CBAL) 0.003
cd05906 560 cd05906, A_NRPS_TubE_like, The adenylation domain 0.003
PRK10524 629 PRK10524, prpE, propionyl-CoA synthetase; Provisio 0.004
cd05958487 cd05958, ABCL, 2-aminobenzoate-CoA ligase (ABCL) 0.004
PRK08751560 PRK08751, PRK08751, putative long-chain fatty acyl 0.004
PRK12316 5163 PRK12316, PRK12316, peptide synthase; Provisional 0.004
>gnl|CDD|213279 cd05911, Firefly_Luc_like, Firefly luciferase of light emitting insects and 4-Coumarate-CoA Ligase (4CL) Back     alignment and domain information 
 Score =  147 bits (374), Expect = 3e-42
 Identities = 59/139 (42%), Positives = 87/139 (62%), Gaps = 3/139 (2%)

Query: 1   MALVPFFHGYGLLLMLQAICMNNKLVVLPHFDGHLFLSSIEKYRVTLLPAVPPLVVFLAK 60
           +  +PF+H YGL   L ++     ++++P FD   FL  IEKY+VT L  VPP+ V LAK
Sbjct: 194 LTFLPFYHAYGLTTTLASLLCGATVIIMPKFDSETFLKLIEKYKVTSLFLVPPIAVALAK 253

Query: 61  SPLVDQYDLSSLTNIRCGAAPVGKSTLDQVGERLGLSMDSMKQGYGMTELTILVTFSDL- 119
           SPLVD+YDLSSL  I  GAAP+ K   +++ +R      ++KQGYGMTE     T +   
Sbjct: 254 SPLVDKYDLSSLRVIFSGAAPLSKELQEELRKRFPN--TTIKQGYGMTETGPATTLTPPG 311

Query: 120 DVPSSSVGKVMPSMKMKVL 138
           D    SVG+++P+++ K++
Sbjct: 312 DEKPGSVGRLVPNVEAKIV 330

This family contains two functionally unique groups of proteins; one group is insect firefly luciferases and the other is plant 4-coumarate:coenzyme A ligases. However, they share significant sequence similarity in spite of their functional diversity. Luciferase catalyzes the production of light in the presence of MgATP, molecular oxygen, and luciferin. In the first step, luciferin is activated by acylation of its carboxylate group with ATP, resulting in an enzyme-bound luciferyl adenylate. In the second step, luciferyl adenylate reacts with molecular oxygen, producing an enzyme-bound excited state product (Luc=O*) and releasing AMP. This excited-state product then decays to the ground state (Luc=O), emitting a quantum of visible light. 4-coumarate:coenzyme A ligase is a key enzyme in the phenylpropanoid metabolic pathway for monolignol and flavonoid biosynthesis. It catalyzes the synthesis of hydroxycinnamate-CoA thioesters in a two-step reaction, involving the formation of hydroxycinnamate-AMP anhydride and then the nucleophilic substitution of AMP by CoA. The phenylpropanoid pathway is one of the most important secondary metabolism pathways in plants and hydroxycinnamate-CoA thioesters are the precursors of lignin and other important phenylpropanoids. Length = 487
>gnl|CDD|213272 cd05904, 4CL, 4-Coumarate-CoA Ligase (4CL) Back     alignment and domain information
>gnl|CDD|213295 cd05929, BACL_like, Bacterial Bile acid CoA ligases and similar proteins Back     alignment and domain information
>gnl|CDD|215137 PLN02246, PLN02246, 4-coumarate--CoA ligase Back     alignment and domain information
>gnl|CDD|213284 cd05917, FACL_like_2, Uncharacterized subfamily of fatty acid CoA ligase (FACL) Back     alignment and domain information
>gnl|CDD|215954 pfam00501, AMP-binding, AMP-binding enzyme Back     alignment and domain information
>gnl|CDD|213302 cd05936, FC-FACS_FadD_like, Prokaryotic long-chain fatty acid CoA synthetases similar to Escherichia coli FadD Back     alignment and domain information
>gnl|CDD|235730 PRK06187, PRK06187, long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>gnl|CDD|223395 COG0318, CaiC, Acyl-CoA synthetases (AMP-forming)/AMP-acid ligases II [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|213270 cd04433, AFD_class_I, Adenylate forming domain, Class I Back     alignment and domain information
>gnl|CDD|213301 cd05935, LC_FACS_like, Putative long-chain fatty acid CoA ligase Back     alignment and domain information
>gnl|CDD|236235 PRK08314, PRK08314, long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>gnl|CDD|215189 PLN02330, PLN02330, 4-coumarate--CoA ligase-like 1 Back     alignment and domain information
>gnl|CDD|180666 PRK06710, PRK06710, long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>gnl|CDD|215312 PLN02574, PLN02574, 4-coumarate--CoA ligase-like Back     alignment and domain information
>gnl|CDD|213287 cd05920, 23DHB-AMP_lg, 2,3-dihydroxybenzoate-AMP ligase Back     alignment and domain information
>gnl|CDD|213271 cd05903, CHC_CoA_lg, Cyclohexanecarboxylate-CoA ligase (also called cyclohex-1-ene-1-carboxylate:CoA ligase) Back     alignment and domain information
>gnl|CDD|213309 cd05944, FACL_like_4, Uncharacterized subfamily of fatty acid CoA ligase (FACL) Back     alignment and domain information
>gnl|CDD|235531 PRK05605, PRK05605, long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>gnl|CDD|236043 PRK07529, PRK07529, AMP-binding domain protein; Validated Back     alignment and domain information
>gnl|CDD|132249 TIGR03205, pimA, dicarboxylate--CoA ligase PimA Back     alignment and domain information
>gnl|CDD|237145 PRK12583, PRK12583, acyl-CoA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|236072 PRK07656, PRK07656, long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>gnl|CDD|213297 cd05931, FAAL, Fatty acyl-AMP ligase (FAAL) Back     alignment and domain information
>gnl|CDD|213289 cd05922, FACL_like_6, Uncharacterized subfamily of fatty acid CoA ligase (FACL) Back     alignment and domain information
>gnl|CDD|213327 cd12119, ttLC_FACS_AlkK_like, Fatty acyl-CoA synthetases similar to LC-FACS from Thermus thermophiles Back     alignment and domain information
>gnl|CDD|183506 PRK12406, PRK12406, long-chain-fatty-acid--CoA ligase; Provisional Back     alignment and domain information
>gnl|CDD|213292 cd05926, FACL_fum10p_like, Subfamily of fatty acid CoA ligase (FACL) similar to Fum10p of Gibberella moniliformis Back     alignment and domain information
>gnl|CDD|213300 cd05934, FACL_DitJ_like, Uncharacterized subfamily of fatty acid CoA ligase (FACL) Back     alignment and domain information
>gnl|CDD|236097 PRK07788, PRK07788, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|171961 PRK13295, PRK13295, cyclohexanecarboxylate-CoA ligase; Reviewed Back     alignment and domain information
>gnl|CDD|213277 cd05909, AAS_C, C-terminal domain of the acyl-acyl carrier protein synthetase (also called 2-acylglycerophosphoethanolamine acyltransferase, Aas) Back     alignment and domain information
>gnl|CDD|213317 cd05970, MACS_AAE_MA_like, Medium-chain acyl-CoA synthetase (MACS) of AAE_MA like Back     alignment and domain information
>gnl|CDD|236236 PRK08315, PRK08315, AMP-binding domain protein; Validated Back     alignment and domain information
>gnl|CDD|236215 PRK08276, PRK08276, long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>gnl|CDD|213319 cd05972, MACS_like, Medium-chain acyl-CoA synthetase (MACS or ACSM) Back     alignment and domain information
>gnl|CDD|235731 PRK06188, PRK06188, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|236091 PRK07768, PRK07768, long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>gnl|CDD|240325 PTZ00237, PTZ00237, acetyl-CoA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|180988 PRK07470, PRK07470, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|213280 cd05912, OSB_CoA_lg, O-succinylbenzoate-CoA ligase (also known as O-succinylbenzoate-CoA synthase, OSB-CoA synthetase, or MenE) Back     alignment and domain information
>gnl|CDD|223442 COG0365, Acs, Acyl-coenzyme A synthetases/AMP-(fatty) acid ligases [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|236100 PRK07798, PRK07798, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|168698 PRK06839, PRK06839, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|213275 cd05907, VL_LC_FACS_like, Long-chain fatty acid CoA synthetases and Bubblegum-like very long-chain fatty acid CoA synthetases Back     alignment and domain information
>gnl|CDD|235625 PRK05852, PRK05852, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|213326 cd12118, ttLC_FACS_AEE21_like, Fatty acyl-CoA synthetases similar to LC-FACS from Thermus thermophiles and Arabidopsis Back     alignment and domain information
>gnl|CDD|181381 PRK08316, PRK08316, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|184022 PRK13391, PRK13391, acyl-CoA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|235146 PRK03640, PRK03640, O-succinylbenzoic acid--CoA ligase; Provisional Back     alignment and domain information
>gnl|CDD|213307 cd05941, MCS, Malonyl-CoA synthetase (MCS) Back     alignment and domain information
>gnl|CDD|213294 cd05928, MACS_euk, Eukaryotic Medium-chain acyl-CoA synthetase (MACS or ACSM) Back     alignment and domain information
>gnl|CDD|235724 PRK06178, PRK06178, acyl-CoA synthetase; Validated Back     alignment and domain information
>gnl|CDD|223953 COG1022, FAA1, Long-chain acyl-CoA synthetases (AMP-forming) [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|213321 cd05974, MACS_like_1, Uncharacterized subfamily of medium-chain acyl-CoA synthetase (MACS) Back     alignment and domain information
>gnl|CDD|213296 cd05930, A_NRPS, The adenylation domain of nonribosomal peptide synthetases (NRPS) Back     alignment and domain information
>gnl|CDD|213298 cd05932, LC_FACS_bac, Bacterial long-chain fatty acid CoA synthetase (LC-FACS), including Marinobacter hydrocarbonoclasticus isoprenoid Coenzyme A synthetase Back     alignment and domain information
>gnl|CDD|223952 COG1021, EntE, Peptide arylation enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|213276 cd05908, A_NRPS_MycA_like, The adenylation domain of nonribosomal peptide synthetases (NRPS) similar to mycosubtilin synthase subunit A (MycA) Back     alignment and domain information
>gnl|CDD|233807 TIGR02275, DHB_AMP_lig, 2,3-dihydroxybenzoate-AMP ligase Back     alignment and domain information
>gnl|CDD|180533 PRK06334, PRK06334, long chain fatty acid--[acyl-carrier-protein] ligase; Validated Back     alignment and domain information
>gnl|CDD|213291 cd05924, FACL_like_5, Uncharacterized subfamily of fatty acid CoA ligase (FACL) Back     alignment and domain information
>gnl|CDD|169098 PRK07786, PRK07786, long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>gnl|CDD|139538 PRK13390, PRK13390, acyl-CoA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|132252 TIGR03208, cyc_hxne_CoA_lg, cyclohexanecarboxylate-CoA ligase Back     alignment and domain information
>gnl|CDD|237108 PRK12467, PRK12467, peptide synthase; Provisional Back     alignment and domain information
>gnl|CDD|162605 TIGR01923, menE, O-succinylbenzoate-CoA ligase Back     alignment and domain information
>gnl|CDD|236803 PRK10946, entE, enterobactin synthase subunit E; Provisional Back     alignment and domain information
>gnl|CDD|237108 PRK12467, PRK12467, peptide synthase; Provisional Back     alignment and domain information
>gnl|CDD|211788 TIGR03098, ligase_PEP_1, acyl-CoA ligase (AMP-forming), exosortase A-associated Back     alignment and domain information
>gnl|CDD|223951 COG1020, EntF, Non-ribosomal peptide synthetase modules and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|139531 PRK13383, PRK13383, acyl-CoA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|213290 cd05923, CBAL, 4-Chlorobenzoate-CoA ligase (CBAL) Back     alignment and domain information
>gnl|CDD|213274 cd05906, A_NRPS_TubE_like, The adenylation domain (A domain) of a family of nonribosomal peptide synthetases (NRPSs) synthesizing toxins and antitumor agents Back     alignment and domain information
>gnl|CDD|182517 PRK10524, prpE, propionyl-CoA synthetase; Provisional Back     alignment and domain information
>gnl|CDD|213311 cd05958, ABCL, 2-aminobenzoate-CoA ligase (ABCL) Back     alignment and domain information
>gnl|CDD|181546 PRK08751, PRK08751, putative long-chain fatty acyl CoA ligase; Provisional Back     alignment and domain information
>gnl|CDD|237054 PRK12316, PRK12316, peptide synthase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 207
KOG1176|consensus537 100.0
COG0318534 CaiC Acyl-CoA synthetases (AMP-forming)/AMP-acid l 100.0
KOG1177|consensus596 100.0
PRK06334539 long chain fatty acid--[acyl-carrier-protein] liga 100.0
COG0365528 Acs Acyl-coenzyme A synthetases/AMP-(fatty) acid l 99.98
PTZ00342 746 acyl-CoA synthetase; Provisional 99.97
PRK07788549 acyl-CoA synthetase; Validated 99.97
PLN02574560 4-coumarate--CoA ligase-like 99.97
PLN02736 651 long-chain acyl-CoA synthetase 99.97
PLN02860 563 o-succinylbenzoate-CoA ligase 99.97
PLN02614 666 long-chain acyl-CoA synthetase 99.97
PLN02861 660 long-chain-fatty-acid-CoA ligase 99.97
PF00501417 AMP-binding: AMP-binding enzyme; InterPro: IPR0008 99.97
PLN03051 499 acyl-activating enzyme; Provisional 99.97
PRK13295547 cyclohexanecarboxylate-CoA ligase; Reviewed 99.97
PLN02654 666 acetate-CoA ligase 99.97
PTZ00237 647 acetyl-CoA synthetase; Provisional 99.97
PRK06839496 acyl-CoA synthetase; Validated 99.97
PLN02246537 4-coumarate--CoA ligase 99.97
PRK13382537 acyl-CoA synthetase; Provisional 99.96
PRK04319 570 acetyl-CoA synthetase; Provisional 99.96
TIGR03208538 cyc_hxne_CoA_lg cyclohexanecarboxylate-CoA ligase. 99.96
TIGR02188 625 Ac_CoA_lig_AcsA acetate--CoA ligase. This model de 99.96
PRK08314546 long-chain-fatty-acid--CoA ligase; Validated 99.96
PRK06145497 acyl-CoA synthetase; Validated 99.96
PRK07529 632 AMP-binding domain protein; Validated 99.96
PRK086331146 2-acyl-glycerophospho-ethanolamine acyltransferase 99.96
PRK05677562 long-chain-fatty-acid--CoA ligase; Validated 99.96
PRK06060 705 acyl-CoA synthetase; Validated 99.96
TIGR03098515 ligase_PEP_1 acyl-CoA ligase (AMP-forming), exosor 99.96
PRK07656513 long-chain-fatty-acid--CoA ligase; Validated 99.96
PRK00174 637 acetyl-CoA synthetase; Provisional 99.96
TIGR02316 628 propion_prpE propionate--CoA ligase. This family c 99.96
PRK08043718 bifunctional acyl-[acyl carrier protein] synthetas 99.96
COG1021542 EntE Peptide arylation enzymes [Secondary metaboli 99.96
PRK12492562 long-chain-fatty-acid--CoA ligase; Provisional 99.96
TIGR02275527 DHB_AMP_lig 2,3-dihydroxybenzoate-AMP ligase. Prot 99.96
PRK07638487 acyl-CoA synthetase; Validated 99.96
PRK13383516 acyl-CoA synthetase; Provisional 99.96
PRK08316523 acyl-CoA synthetase; Validated 99.96
PRK12583558 acyl-CoA synthetase; Provisional 99.96
COG1022 613 FAA1 Long-chain acyl-CoA synthetases (AMP-forming) 99.96
PLN02387 696 long-chain-fatty-acid-CoA ligase family protein 99.96
PLN02330546 4-coumarate--CoA ligase-like 1 99.96
PRK05851525 long-chain-fatty-acid--[acyl-carrier-protein] liga 99.96
PRK05605573 long-chain-fatty-acid--CoA ligase; Validated 99.96
PRK05857 540 acyl-CoA synthetase; Validated 99.96
PRK13390501 acyl-CoA synthetase; Provisional 99.96
PRK07786 542 long-chain-fatty-acid--CoA ligase; Validated 99.96
PTZ00216 700 acyl-CoA synthetase; Provisional 99.96
PRK08315559 AMP-binding domain protein; Validated 99.96
PRK06188524 acyl-CoA synthetase; Validated 99.96
PRK07787471 acyl-CoA synthetase; Validated 99.96
PRK07008539 long-chain-fatty-acid--CoA ligase; Validated 99.96
PRK06710563 long-chain-fatty-acid--CoA ligase; Validated 99.96
PRK08180 614 feruloyl-CoA synthase; Reviewed 99.95
PRK09088488 acyl-CoA synthetase; Validated 99.95
PRK07059557 Long-chain-fatty-acid--CoA ligase; Validated 99.95
PRK03640483 O-succinylbenzoic acid--CoA ligase; Provisional 99.95
TIGR03205541 pimA dicarboxylate--CoA ligase PimA. PimA, a membe 99.95
TIGR02262508 benz_CoA_lig benzoate-CoA ligase family. Character 99.95
PRK07470528 acyl-CoA synthetase; Validated 99.95
PRK12467 3956 peptide synthase; Provisional 99.95
TIGR01734502 D-ala-DACP-lig D-alanine--poly(phosphoribitol) lig 99.95
PRK07514504 malonyl-CoA synthase; Validated 99.95
PRK12406509 long-chain-fatty-acid--CoA ligase; Provisional 99.95
TIGR01733408 AA-adenyl-dom amino acid adenylation domain. This 99.95
PRK09274552 peptide synthase; Provisional 99.95
PRK06155 542 crotonobetaine/carnitine-CoA ligase; Provisional 99.95
PLN02430 660 long-chain-fatty-acid-CoA ligase 99.95
PRK07769 631 long-chain-fatty-acid--CoA ligase; Validated 99.95
PRK10524 629 prpE propionyl-CoA synthetase; Provisional 99.95
PRK08751560 putative long-chain fatty acyl CoA ligase; Provisi 99.95
PRK06187521 long-chain-fatty-acid--CoA ligase; Validated 99.95
PRK05852534 acyl-CoA synthetase; Validated 99.95
PRK06087547 short chain acyl-CoA synthetase; Reviewed 99.95
PRK08276502 long-chain-fatty-acid--CoA ligase; Validated 99.95
PRK08974560 long-chain-fatty-acid--CoA ligase; Validated 99.95
PRK10946536 entE enterobactin synthase subunit E; Provisional 99.95
PRK12582 624 acyl-CoA synthetase; Provisional 99.95
PRK03584 655 acetoacetyl-CoA synthetase; Provisional 99.95
PRK12476612 putative fatty-acid--CoA ligase; Provisional 99.95
PRK13391511 acyl-CoA synthetase; Provisional 99.95
KOG1256|consensus 691 99.94
PRK10252 1296 entF enterobactin synthase subunit F; Provisional 99.94
TIGR01217 652 ac_ac_CoA_syn acetoacetyl-CoA synthase. This enzym 99.94
PRK05620 576 long-chain-fatty-acid--CoA ligase; Validated 99.94
PRK12316 5163 peptide synthase; Provisional 99.94
PRK08008517 caiC putative crotonobetaine/carnitine-CoA ligase; 99.94
PRK07445452 O-succinylbenzoic acid--CoA ligase; Reviewed 99.94
PLN03052 728 acetate--CoA ligase; Provisional 99.94
PRK068141140 acylglycerophosphoethanolamine acyltransferase; Pr 99.94
TIGR03443 1389 alpha_am_amid L-aminoadipate-semialdehyde dehydrog 99.94
PRK06164540 acyl-CoA synthetase; Validated 99.94
PRK12316 5163 peptide synthase; Provisional 99.94
PRK06178567 acyl-CoA synthetase; Validated 99.94
PRK04813503 D-alanine--poly(phosphoribitol) ligase subunit 1; 99.94
PRK06018542 putative acyl-CoA synthetase; Provisional 99.94
PRK12467 3956 peptide synthase; Provisional 99.93
PRK07868 994 acyl-CoA synthetase; Validated 99.93
PRK05691 4334 peptide synthase; Validated 99.93
PRK13388 540 acyl-CoA synthetase; Provisional 99.93
PLN03102 579 acyl-activating enzyme; Provisional 99.92
PRK05691 4334 peptide synthase; Validated 99.92
TIGR01923436 menE O-succinylbenzoate-CoA ligase. This model rep 99.92
PRK07867 529 acyl-CoA synthetase; Validated 99.92
PLN02479567 acetate-CoA ligase 99.91
PRK07768545 long-chain-fatty-acid--CoA ligase; Validated 99.91
KOG1175|consensus 626 99.91
PRK09192 579 acyl-CoA synthetase; Validated 99.91
PRK08279 600 long-chain-acyl-CoA synthetase; Validated 99.91
PRK05850 578 acyl-CoA synthetase; Validated 99.9
PRK07798533 acyl-CoA synthetase; Validated 99.9
PRK09029458 O-succinylbenzoic acid--CoA ligase; Provisional 99.9
PRK08162545 acyl-CoA synthetase; Validated 99.89
PRK07824358 O-succinylbenzoic acid--CoA ligase; Provisional 99.89
PRK08308414 acyl-CoA synthetase; Validated 99.89
KOG1180|consensus 678 99.88
KOG1179|consensus 649 99.84
TIGR02372386 4_coum_CoA_lig 4-coumarate--CoA ligase, photoactiv 99.78
TIGR02155422 PA_CoA_ligase phenylacetate-CoA ligase. Phenylacet 99.77
COG1020642 EntF Non-ribosomal peptide synthetase modules and 99.66
TIGR03335 445 F390_ftsA coenzyme F390 synthetase. This enzyme, c 99.65
PTZ00297 1452 pantothenate kinase; Provisional 99.55
COG1541438 PaaK Coenzyme F390 synthetase [Coenzyme metabolism 99.46
TIGR02304430 aden_form_hyp probable adenylate-forming enzyme. M 98.96
PF04443365 LuxE: Acyl-protein synthetase, LuxE; InterPro: IPR 97.82
KOG3628|consensus 1363 97.78
KOG3628|consensus 1363 97.38
KOG1178|consensus 1032 97.0
PF03321 528 GH3: GH3 auxin-responsive promoter; InterPro: IPR0 92.5
>KOG1176|consensus Back     alignment and domain information 
Probab=100.00  E-value=3.4e-36  Score=252.42  Aligned_cols=199  Identities=33%  Similarity=0.544  Sum_probs=178.0

Q ss_pred             CcccccchHHHHHHHHH-HHHhCCeEEEeCCCCHHHHHHHHHhcCceEeeccHHHHHHHHhCCCCCCCCCCceeEEEEcc
Q psy9665           1 MALVPFFHGYGLLLMLQ-AICMNNKLVVLPHFDGHLFLSSIEKYRVTLLPAVPPLVVFLAKSPLVDQYDLSSLTNIRCGA   79 (207)
Q Consensus         1 l~~~Pl~h~~g~~~~~~-~l~~G~~~v~~~~~~~~~~~~~i~~~~~t~~~~~P~~~~~l~~~~~~~~~~l~~lr~~~~~G   79 (207)
                      |+++||+|++|+..++. .+..|+++++.+.|+++.+++.+++|++|+++++|+++..|++.+....++++++|.+.+||
T Consensus       229 l~~lPl~H~~Gl~~~~~~~~~~~~~ii~~~~f~~~~~~~~i~kykvt~~~~vP~~~~~l~~~p~~~~~~l~sl~~v~~gg  308 (537)
T KOG1176|consen  229 LCTLPLFHIYGLITLLLSLLAGGTTIICLRKFDAELFLDLIEKYKVTHLFLVPPVLNMLAKSPIVKKYDLSSLRSVLSGG  308 (537)
T ss_pred             EEechHHHHhHHHHHHHHHHhCCceEEECCCCCHHHHHHHHHHhCEEEEEcChHHHHHHhcCCccCcccCCccEEEEecC
Confidence            57899999999997665 67777777777789999999999999999999999999999999877779999999999999


Q ss_pred             CCCCHHHHHHHHHHhCCCcCcceeccccccccceeeccCC-C-CCCCccccccCCceEEEEeCCCC---CCCcceEEEEc
Q psy9665          80 APVGKSTLDQVGERLGLSMDSMKQGYGMTELTILVTFSDL-D-VPSSSVGKVMPSMKMKVLVKSHT---MGSQDSFVISG  154 (207)
Q Consensus        80 ~~~~~~~~~~~~~~~~~~~~~i~~~YG~tE~g~~~~~~~~-~-~~~~~~G~~~~~~~~~i~d~~~~---~g~~Gel~i~g  154 (207)
                      +++++++.+++++++|+.  .+.++||+||+++.++.+.. + ..++++|++++++++++.++.|.   +++.||||+||
T Consensus       309 a~~~~~~~~~~~~~l~~~--~v~q~YGmTE~~~~~~~~~~~~e~k~~svG~~~~g~~~~v~~e~g~~l~~~~~GEI~vrg  386 (537)
T KOG1176|consen  309 APLSPATLEKVKERLPNV--TVIQGYGMTEAGGLITSNDWGPERKPGSVGRLLPGVRVKVLDETGVSLGPNQTGEICVRG  386 (537)
T ss_pred             CCCCHHHHHHHHHhCCCc--eEEEeeccccccCceeecCCCccCcccccCccccceEEEeeCCCCCCCCCCCceEEEEEC
Confidence            999999999999999965  69999999999988777777 4 38999999999999999999887   58999999999


Q ss_pred             CeeeecccccCCCcCcc---------cCCcEEEcCeeEEEEEecCccccccccCCCccc
Q psy9665         155 DEIQFAPYCRKMSLGAY---------LCHWLKLKGKQTVLVLGFGSQSCEENLGADNIS  204 (207)
Q Consensus       155 ~~~~~~gy~~~~~~~~~---------~~d~~~~~~~~~~~i~grg~~~~~~~~~~~~~s  204 (207)
                      +.+ ++||+++|+.|+.         |||..|+++||.++|.+|-+.+.+  .+|++|+
T Consensus       387 ~~i-mkGY~~NpeaT~~~~~~~GW~~TGDiGy~D~DG~l~IvdR~KdlIk--~~G~qv~  442 (537)
T KOG1176|consen  387 PQV-MKGYLKNPEATKEAFDDDGWFHTGDLGYFDEDGYLYIVDRSKDLIK--YGGEQVS  442 (537)
T ss_pred             ccc-chhhcCChHHHHhhcccCCccccCceEEEcCCCeEEEecchhhhee--eCCEEeC
Confidence            999 9999999987652         778889999999999999888884  4777765

>COG0318 CaiC Acyl-CoA synthetases (AMP-forming)/AMP-acid ligases II [Lipid metabolism / Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>KOG1177|consensus Back     alignment and domain information
>PRK06334 long chain fatty acid--[acyl-carrier-protein] ligase; Validated Back     alignment and domain information
>COG0365 Acs Acyl-coenzyme A synthetases/AMP-(fatty) acid ligases [Lipid metabolism] Back     alignment and domain information
>PTZ00342 acyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK07788 acyl-CoA synthetase; Validated Back     alignment and domain information
>PLN02574 4-coumarate--CoA ligase-like Back     alignment and domain information
>PLN02736 long-chain acyl-CoA synthetase Back     alignment and domain information
>PLN02860 o-succinylbenzoate-CoA ligase Back     alignment and domain information
>PLN02614 long-chain acyl-CoA synthetase Back     alignment and domain information
>PLN02861 long-chain-fatty-acid-CoA ligase Back     alignment and domain information
>PF00501 AMP-binding: AMP-binding enzyme; InterPro: IPR000873 A number of prokaryotic and eukaryotic enzymes, which appear to act via an ATP-dependent covalent binding of AMP to their substrate, share a region of sequence similarity [, , ] Back     alignment and domain information
>PLN03051 acyl-activating enzyme; Provisional Back     alignment and domain information
>PRK13295 cyclohexanecarboxylate-CoA ligase; Reviewed Back     alignment and domain information
>PLN02654 acetate-CoA ligase Back     alignment and domain information
>PTZ00237 acetyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK06839 acyl-CoA synthetase; Validated Back     alignment and domain information
>PLN02246 4-coumarate--CoA ligase Back     alignment and domain information
>PRK13382 acyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK04319 acetyl-CoA synthetase; Provisional Back     alignment and domain information
>TIGR03208 cyc_hxne_CoA_lg cyclohexanecarboxylate-CoA ligase Back     alignment and domain information
>TIGR02188 Ac_CoA_lig_AcsA acetate--CoA ligase Back     alignment and domain information
>PRK08314 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK06145 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK07529 AMP-binding domain protein; Validated Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>PRK05677 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK06060 acyl-CoA synthetase; Validated Back     alignment and domain information
>TIGR03098 ligase_PEP_1 acyl-CoA ligase (AMP-forming), exosortase system type 1 associated Back     alignment and domain information
>PRK07656 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK00174 acetyl-CoA synthetase; Provisional Back     alignment and domain information
>TIGR02316 propion_prpE propionate--CoA ligase Back     alignment and domain information
>PRK08043 bifunctional acyl-[acyl carrier protein] synthetase/2-acylglycerophosphoethanolamine acyltransferase; Validated Back     alignment and domain information
>COG1021 EntE Peptide arylation enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PRK12492 long-chain-fatty-acid--CoA ligase; Provisional Back     alignment and domain information
>TIGR02275 DHB_AMP_lig 2,3-dihydroxybenzoate-AMP ligase Back     alignment and domain information
>PRK07638 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK13383 acyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK08316 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK12583 acyl-CoA synthetase; Provisional Back     alignment and domain information
>COG1022 FAA1 Long-chain acyl-CoA synthetases (AMP-forming) [Lipid metabolism] Back     alignment and domain information
>PLN02387 long-chain-fatty-acid-CoA ligase family protein Back     alignment and domain information
>PLN02330 4-coumarate--CoA ligase-like 1 Back     alignment and domain information
>PRK05851 long-chain-fatty-acid--[acyl-carrier-protein] ligase; Validated Back     alignment and domain information
>PRK05605 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK05857 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK13390 acyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK07786 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PTZ00216 acyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK08315 AMP-binding domain protein; Validated Back     alignment and domain information
>PRK06188 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK07787 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK07008 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK06710 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK08180 feruloyl-CoA synthase; Reviewed Back     alignment and domain information
>PRK09088 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK07059 Long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK03640 O-succinylbenzoic acid--CoA ligase; Provisional Back     alignment and domain information
>TIGR03205 pimA dicarboxylate--CoA ligase PimA Back     alignment and domain information
>TIGR02262 benz_CoA_lig benzoate-CoA ligase family Back     alignment and domain information
>PRK07470 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK12467 peptide synthase; Provisional Back     alignment and domain information
>TIGR01734 D-ala-DACP-lig D-alanine--poly(phosphoribitol) ligase, subunit 1 Back     alignment and domain information
>PRK07514 malonyl-CoA synthase; Validated Back     alignment and domain information
>PRK12406 long-chain-fatty-acid--CoA ligase; Provisional Back     alignment and domain information
>TIGR01733 AA-adenyl-dom amino acid adenylation domain Back     alignment and domain information
>PRK09274 peptide synthase; Provisional Back     alignment and domain information
>PRK06155 crotonobetaine/carnitine-CoA ligase; Provisional Back     alignment and domain information
>PLN02430 long-chain-fatty-acid-CoA ligase Back     alignment and domain information
>PRK07769 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK10524 prpE propionyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK08751 putative long-chain fatty acyl CoA ligase; Provisional Back     alignment and domain information
>PRK06187 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK05852 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK06087 short chain acyl-CoA synthetase; Reviewed Back     alignment and domain information
>PRK08276 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK08974 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK10946 entE enterobactin synthase subunit E; Provisional Back     alignment and domain information
>PRK12582 acyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK03584 acetoacetyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK12476 putative fatty-acid--CoA ligase; Provisional Back     alignment and domain information
>PRK13391 acyl-CoA synthetase; Provisional Back     alignment and domain information
>KOG1256|consensus Back     alignment and domain information
>PRK10252 entF enterobactin synthase subunit F; Provisional Back     alignment and domain information
>TIGR01217 ac_ac_CoA_syn acetoacetyl-CoA synthase Back     alignment and domain information
>PRK05620 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>PRK12316 peptide synthase; Provisional Back     alignment and domain information
>PRK08008 caiC putative crotonobetaine/carnitine-CoA ligase; Validated Back     alignment and domain information
>PRK07445 O-succinylbenzoic acid--CoA ligase; Reviewed Back     alignment and domain information
>PLN03052 acetate--CoA ligase; Provisional Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>TIGR03443 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase Back     alignment and domain information
>PRK06164 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK12316 peptide synthase; Provisional Back     alignment and domain information
>PRK06178 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK04813 D-alanine--poly(phosphoribitol) ligase subunit 1; Provisional Back     alignment and domain information
>PRK06018 putative acyl-CoA synthetase; Provisional Back     alignment and domain information
>PRK12467 peptide synthase; Provisional Back     alignment and domain information
>PRK07868 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK05691 peptide synthase; Validated Back     alignment and domain information
>PRK13388 acyl-CoA synthetase; Provisional Back     alignment and domain information
>PLN03102 acyl-activating enzyme; Provisional Back     alignment and domain information
>PRK05691 peptide synthase; Validated Back     alignment and domain information
>TIGR01923 menE O-succinylbenzoate-CoA ligase Back     alignment and domain information
>PRK07867 acyl-CoA synthetase; Validated Back     alignment and domain information
>PLN02479 acetate-CoA ligase Back     alignment and domain information
>PRK07768 long-chain-fatty-acid--CoA ligase; Validated Back     alignment and domain information
>KOG1175|consensus Back     alignment and domain information
>PRK09192 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK08279 long-chain-acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK05850 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK07798 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK09029 O-succinylbenzoic acid--CoA ligase; Provisional Back     alignment and domain information
>PRK08162 acyl-CoA synthetase; Validated Back     alignment and domain information
>PRK07824 O-succinylbenzoic acid--CoA ligase; Provisional Back     alignment and domain information
>PRK08308 acyl-CoA synthetase; Validated Back     alignment and domain information
>KOG1180|consensus Back     alignment and domain information
>KOG1179|consensus Back     alignment and domain information
>TIGR02372 4_coum_CoA_lig 4-coumarate--CoA ligase, photoactive yellow protein activation family Back     alignment and domain information
>TIGR02155 PA_CoA_ligase phenylacetate-CoA ligase Back     alignment and domain information
>COG1020 EntF Non-ribosomal peptide synthetase modules and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR03335 F390_ftsA coenzyme F390 synthetase Back     alignment and domain information
>PTZ00297 pantothenate kinase; Provisional Back     alignment and domain information
>COG1541 PaaK Coenzyme F390 synthetase [Coenzyme metabolism] Back     alignment and domain information
>TIGR02304 aden_form_hyp probable adenylate-forming enzyme Back     alignment and domain information
>PF04443 LuxE: Acyl-protein synthetase, LuxE; InterPro: IPR007534 LuxE is an acyl-protein synthetase found in bioluminescent bacteria Back     alignment and domain information
>KOG3628|consensus Back     alignment and domain information
>KOG3628|consensus Back     alignment and domain information
>KOG1178|consensus Back     alignment and domain information
>PF03321 GH3: GH3 auxin-responsive promoter; InterPro: IPR004993 Transcription of the gene family, GH3, has been shown to be specifically induced by the plant hormone auxin Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query207
4g37_A 555 Structure Of Cross-Linked Firefly Luciferase In Sec 8e-20
1ba3_A 550 Firefly Luciferase In Complex With Bromoform Length 2e-19
3iep_A 551 Firefly Luciferase Apo Structure (P41 Form) Length 2e-19
4g36_A 555 Photinus Pyralis Luciferase In The Adenylate-Formin 2e-19
3qya_A 582 Crystal Structure Of A Red-Emitter Mutant Of Lampyr 9e-19
2d1s_A 548 Crystal Structure Of The Thermostable Japanese Fire 3e-18
2d1q_A 548 Crystal Structure Of The Thermostable Japanese Fire 3e-18
2d1t_A 548 Crystal Structure Of The Thermostable Japanese Fire 3e-18
3a9u_A536 Crystal Structures And Enzymatic Mechanisms Of A Po 8e-14
3tsy_A 979 4-Coumaroyl-Coa Ligase::stilbene Synthase Fusion Pr 4e-12
>pdb|4G37|A Chain A, Structure Of Cross-Linked Firefly Luciferase In Second Catalytic Conformation Length = 555 Back     alignment and structure 
Iteration: 1

 Score = 93.6 bits (231), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 53/140 (37%), Positives = 82/140 (58%), Gaps = 5/140 (3%)
Query: 1   MALVPFFHGYGLLLMLQAICMNNKLVVLPHFDGHLFLSSIEKYRVTXXXXXXXXXXFLAK 60
           +++VPF HG+G+   L  +    ++V++  F+  LFL S++ Y++           FLAK
Sbjct: 243 LSVVPFHHGFGMFTTLGYLISGFRVVLMYRFEEELFLRSLQDYKIQSALLVPTLFSFLAK 302
Query: 61  SPLVDQYDLSSLTNIRCGAAPVGKSTLDQVGERLGLSMDSMKQGYGMTELT--ILVTFSD 118
           S L+D+YDLS+L  I  G AP+ K   + V +R  L    ++QGYG+TE T  IL+T   
Sbjct: 303 STLIDKYDLSNLHEIASGGAPLSKEVGEAVAKRFHLP--GIRQGYGLTETTSAILITPKG 360
Query: 119 LDVPSSSVGKVMPSMKMKVL 138
            D P  +VGKV+P  + KV+
Sbjct: 361 DDKP-GAVGKVVPFFEAKVV 379
>pdb|1BA3|A Chain A, Firefly Luciferase In Complex With Bromoform Length = 550 Back     alignment and structure
>pdb|3IEP|A Chain A, Firefly Luciferase Apo Structure (P41 Form) Length = 551 Back     alignment and structure
>pdb|4G36|A Chain A, Photinus Pyralis Luciferase In The Adenylate-Forming Conformation Bound To Dlsa Length = 555 Back     alignment and structure
>pdb|3QYA|A Chain A, Crystal Structure Of A Red-Emitter Mutant Of Lampyris Turkestanicus Luciferase Length = 582 Back     alignment and structure
>pdb|2D1S|A Chain A, Crystal Structure Of The Thermostable Japanese Firefly Luciferase Complexed With High-Energy Intermediate Analogue Length = 548 Back     alignment and structure
>pdb|2D1Q|A Chain A, Crystal Structure Of The Thermostable Japanese Firefly Luciferase Complexed With Mgatp Length = 548 Back     alignment and structure
>pdb|2D1T|A Chain A, Crystal Structure Of The Thermostable Japanese Firefly Luciferase Red-Color Emission S286n Mutant Complexed With High-Energy Intermediate Analogue Length = 548 Back     alignment and structure
>pdb|3A9U|A Chain A, Crystal Structures And Enzymatic Mechanisms Of A Populus Tomentosa 4- Coumarate--Coa Ligase Length = 536 Back     alignment and structure
>pdb|3TSY|A Chain A, 4-Coumaroyl-Coa Ligase::stilbene Synthase Fusion Protein Length = 979 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query207
3rix_A 550 Luciferase, luciferin 4-monooxygenase; oxidoreduct 2e-51
2d1s_A 548 Luciferase, luciferin 4-monooxygenase; alpha/beta, 2e-51
3tsy_A 979 Fusion protein 4-coumarate--COA ligase 1, resvera 5e-50
3ni2_A536 4-coumarate:COA ligase; 4CL, phenylpropanoid biosy 1e-49
3g7s_A 549 Long-chain-fatty-acid--COA ligase (FADD-1); protei 5e-42
3r44_A517 Fatty acyl COA synthetase FADD13 (fatty-acyl-COA s 2e-28
3ivr_A 509 Putative long-chain-fatty-acid COA ligase; structu 5e-27
3ipl_A501 2-succinylbenzoate--COA ligase; structural genomic 7e-27
4fuq_A503 Malonyl COA synthetase; ANL superfamily, methylma 1e-26
1t5h_X504 4-chlorobenzoyl COA ligase; adenylate-forming coen 1e-26
1mdb_A 539 2,3-dihydroxybenzoate-AMP ligase; adenylation doma 8e-26
3o83_A 544 Peptide arylation enzyme; ligase, adenylation of 2 3e-25
3rg2_A 617 Enterobactin synthase component E (ENTE), 2,3-DIH 2e-24
2v7b_A529 Benzoate-coenzyme A ligase; benzoate oxidation, be 3e-21
3nyq_A505 Malonyl-COA ligase; A/B topology ababa sandwich be 1e-20
3gqw_A 576 Fatty acid AMP ligase; FAAL, E. coli, ATP-dependen 2e-15
3t5a_A480 Long-chain-fatty-acid--AMP ligase FADD28; acetyl-C 7e-15
3kxw_A 590 Saframycin MX1 synthetase B; fatty acid AMP ligase 3e-14
1v25_A 541 Long-chain-fatty-acid-COA synthetase; ligase, stru 2e-12
3c5e_A 570 Acyl-coenzyme A synthetase ACSM2A, mitochondrial; 4e-11
3hgu_A369 EHPF; phenazine, antibiotic, biosynthetic protein; 5e-10
3etc_A 580 AMP-binding protein; adenylate-forming acyl-COA sy 2e-09
3l8c_A 521 D-alanine--poly(phosphoribitol) ligase subunit 1; 7e-07
3fce_A 512 D-alanine--poly(phosphoribitol) ligase subunit 1; 9e-07
3e7w_A 511 D-alanine--poly(phosphoribitol) ligase subunit 1; 2e-06
2vsq_A 1304 Surfactin synthetase subunit 3; ligase, peptidyl c 2e-05
1amu_A 563 GRSA, gramicidin synthetase 1; peptide synthetase, 1e-04
3ite_A 562 SIDN siderophore synthetase; ligase, non-ribosomal 2e-04
>3rix_A Luciferase, luciferin 4-monooxygenase; oxidoreductase, photoprotein, luminescence, aspulvinone, natural product extracts; HET: 923; 1.70A {Photinus pyralis} PDB: 1ba3_A 1lci_A* 3ies_A* 3iep_A* 3ier_A* 3qya_A Length = 550 Back     alignment and structure
 Score =  173 bits (440), Expect = 2e-51
 Identities = 51/138 (36%), Positives = 80/138 (57%), Gaps = 3/138 (2%)

Query: 1   MALVPFFHGYGLLLMLQAICMNNKLVVLPHFDGHLFLSSIEKYRVTLLPAVPPLVVFLAK 60
           +++VPF HG+G+   L  +    ++V++  F+  LFL S++ Y++     VP L  F AK
Sbjct: 238 LSVVPFHHGFGMFTTLGYLICGFRVVLMYRFEEELFLRSLQDYKIQSALLVPTLFSFFAK 297

Query: 61  SPLVDQYDLSSLTNIRCGAAPVGKSTLDQVGERLGLSMDSMKQGYGMTELTILVTFSDL- 119
           S L+D+YDLS+L  I  G AP+ K   + V +R  L    ++QGYG+TE T  +  +   
Sbjct: 298 STLIDKYDLSNLHEIASGGAPLSKEVGEAVAKRFHLP--GIRQGYGLTETTSAILITPEG 355

Query: 120 DVPSSSVGKVMPSMKMKV 137
           D    +VGKV+P  + KV
Sbjct: 356 DDKPGAVGKVVPFFEAKV 373
>2d1s_A Luciferase, luciferin 4-monooxygenase; alpha/beta, beta barrel, alpha+beta, riken structural genomics/proteomics initiative, RSGI; HET: SLU; 1.30A {Luciola cruciata} PDB: 2d1q_A* 2d1r_A* 2d1t_A* Length = 548 Back     alignment and structure
>3tsy_A Fusion protein 4-coumarate--COA ligase 1, resvera synthase; transferase; 3.10A {Arabidospis thaliana} Length = 979 Back     alignment and structure
>3ni2_A 4-coumarate:COA ligase; 4CL, phenylpropanoid biosynthesis; HET: AYL EPE; 1.90A {Populus tomentosa} PDB: 3a9v_A* 3a9u_A* Length = 536 Back     alignment and structure
>3g7s_A Long-chain-fatty-acid--COA ligase (FADD-1); protein structure initiative, PSI-II, NYSGXRC, 11193J, structural genomics; 2.15A {Archaeoglobus fulgidus dsm 4304} Length = 549 Back     alignment and structure
>3r44_A Fatty acyl COA synthetase FADD13 (fatty-acyl-COA synthetase); ligase; HET: HIS; 1.80A {Mycobacterium tuberculosis} PDB: 3t5c_A 3t5b_A Length = 517 Back     alignment and structure
>3ivr_A Putative long-chain-fatty-acid COA ligase; structural genomics, PSI-2, protein S initiative, fatty acid synthesis; HET: GOL; 2.00A {Rhodopseudomonas palustris} Length = 509 Back     alignment and structure
>3ipl_A 2-succinylbenzoate--COA ligase; structural genomics, acyl-protein synthetase, PSI-2, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Length = 501 Back     alignment and structure
>4fuq_A Malonyl COA synthetase; ANL superfamily, methylma malonate, ligase; HET: MSE; 1.70A {Rhodopseudomonas palustris} PDB: 4fut_A* Length = 503 Back     alignment and structure
>1t5h_X 4-chlorobenzoyl COA ligase; adenylate-forming coenzyme A ligase domain alternation confo change; 2.00A {Alcaligenes SP} SCOP: e.23.1.1 PDB: 1t5d_X 3cw9_A* 3cw8_X* 2qvz_X* 2qw0_X* 3dlp_X* 2qvx_X* 2qvy_X* Length = 504 Back     alignment and structure
>1mdb_A 2,3-dihydroxybenzoate-AMP ligase; adenylation domain, peptide synthetase, antibiotic biosynthesis, siderophore formation; HET: AMP DBH; 2.15A {Bacillus subtilis} SCOP: e.23.1.1 PDB: 1md9_A* 1mdf_A Length = 539 Back     alignment and structure
>3o83_A Peptide arylation enzyme; ligase, adenylation of 2,3-dihydroxybenzoate and transfer to pantetheine cofactor of BASF; HET: IXN; 1.90A {Acinetobacter baumannii} PDB: 3o82_A* 3o84_A* Length = 544 Back     alignment and structure
>3rg2_A Enterobactin synthase component E (ENTE), 2,3-DIH dihydroxybenzoate synthetase, isochroismatase...; adenylate-forming enzymes, ANL superfamily; HET: SVS PNS; 3.10A {Escherichia coli} Length = 617 Back     alignment and structure
>2v7b_A Benzoate-coenzyme A ligase; benzoate oxidation, benzoate COA ligase; 1.84A {Burkholderia xenovorans} Length = 529 Back     alignment and structure
>3nyq_A Malonyl-COA ligase; A/B topology ababa sandwich beta-barrel adenylate-forming EN fold; HET: MCA AMP; 1.43A {Streptomyces coelicolor} PDB: 3nyr_A* Length = 505 Back     alignment and structure
>3t5a_A Long-chain-fatty-acid--AMP ligase FADD28; acetyl-COA synthetase like fold, AMP-binding; 2.05A {Mycobacterium tuberculosis} PDB: 3e53_A Length = 480 Back     alignment and structure
>3kxw_A Saframycin MX1 synthetase B; fatty acid AMP ligase, SGX, acyl adenylate, structural genom 2, protein structure initiative; HET: 1ZZ; 1.85A {Legionella pneumophila subsp} PDB: 3lnv_A* Length = 590 Back     alignment and structure
>1v25_A Long-chain-fatty-acid-COA synthetase; ligase, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.30A {Thermus thermophilus} SCOP: e.23.1.1 PDB: 1ult_A* 1v26_A* Length = 541 Back     alignment and structure
>3c5e_A Acyl-coenzyme A synthetase ACSM2A, mitochondrial; middle-chain acyl-COA synthetase, xenobiotic/medium-chain FA COA ligase; HET: ATP; 1.60A {Homo sapiens} PDB: 2vze_A 3b7w_A* 3day_A* 3eq6_A* 3eyn_A* 3gpc_A* 2wd9_A* Length = 570 Back     alignment and structure
>3hgu_A EHPF; phenazine, antibiotic, biosynthetic protein; 1.95A {Pantoea agglomerans} PDB: 3hgv_A 3l2k_A* Length = 369 Back     alignment and structure
>3etc_A AMP-binding protein; adenylate-forming acyl-COA synthetase ligase, ligase; HET: PGE 1PE EPE; 2.10A {Methanosarcina acetivorans} Length = 580 Back     alignment and structure
>3l8c_A D-alanine--poly(phosphoribitol) ligase subunit 1; structural genomics, DLTA, ATP-binding, cytoplasm, nucleotide-binding; 2.41A {Streptococcus pyogenes serotype M6} PDB: 3lgx_A* Length = 521 Back     alignment and structure
>3fce_A D-alanine--poly(phosphoribitol) ligase subunit 1; DLTA, AMP-forming domain, adenylation, D-alanine protein ligase, ATP complex; HET: ATP; 1.90A {Bacillus cereus} PDB: 3fcc_A* 3dhv_A* Length = 512 Back     alignment and structure
>3e7w_A D-alanine--poly(phosphoribitol) ligase subunit 1; DLTA, non-ribosomal peptide synthetase, NRPS, adenylation domain, D-alanylation; HET: AMP; 2.28A {Bacillus subtilis} PDB: 3e7x_A* Length = 511 Back     alignment and structure
>2vsq_A Surfactin synthetase subunit 3; ligase, peptidyl carrier protein, ligase phosphoprotein, TER module, phosphopantetheine; 2.60A {Bacillus subtilis} Length = 1304 Back     alignment and structure
>1amu_A GRSA, gramicidin synthetase 1; peptide synthetase, adenylate forming; HET: PHE AMP; 1.90A {Brevibacillus brevis} SCOP: e.23.1.1 Length = 563 Back     alignment and structure
>3ite_A SIDN siderophore synthetase; ligase, non-ribosomal peptide synthesis, NRPS, sidna3, fungal, endophyte; HET: MSE; 2.00A {Neotyphodium lolii} Length = 562 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query207
3rix_A550 Luciferase, luciferin 4-monooxygenase; oxidoreduct 100.0
3ni2_A536 4-coumarate:COA ligase; 4CL, phenylpropanoid biosy 100.0
2d1s_A548 Luciferase, luciferin 4-monooxygenase; alpha/beta, 100.0
3g7s_A549 Long-chain-fatty-acid--COA ligase (FADD-1); protei 100.0
3etc_A580 AMP-binding protein; adenylate-forming acyl-COA sy 100.0
3e7w_A511 D-alanine--poly(phosphoribitol) ligase subunit 1; 100.0
4fuq_A503 Malonyl COA synthetase; ANL superfamily, methylma 100.0
1pg4_A 652 Acetyl-COA synthetase; AMP-forming, adenylate-form 100.0
1mdb_A539 2,3-dihydroxybenzoate-AMP ligase; adenylation doma 100.0
1v25_A541 Long-chain-fatty-acid-COA synthetase; ligase, stru 100.0
3c5e_A570 Acyl-coenzyme A synthetase ACSM2A, mitochondrial; 100.0
3fce_A512 D-alanine--poly(phosphoribitol) ligase subunit 1; 100.0
2v7b_A529 Benzoate-coenzyme A ligase; benzoate oxidation, be 100.0
3ipl_A501 2-succinylbenzoate--COA ligase; structural genomic 100.0
3r44_A517 Fatty acyl COA synthetase FADD13 (fatty-acyl-COA s 99.98
3l8c_A 521 D-alanine--poly(phosphoribitol) ligase subunit 1; 99.98
3o83_A544 Peptide arylation enzyme; ligase, adenylation of 2 99.97
4gr5_A570 Non-ribosomal peptide synthetase; MBTH-like domain 99.97
1t5h_X504 4-chlorobenzoyl COA ligase; adenylate-forming coen 99.97
4dg8_A 620 PA1221; ANL superfamily, adenylation domain, pepti 99.97
1ry2_A 663 Acetyl-coenzyme A synthetase 1, acyl-activating en 99.97
3tsy_A 979 Fusion protein 4-coumarate--COA ligase 1, resvera 99.97
3nyq_A505 Malonyl-COA ligase; A/B topology ababa sandwich be 99.97
3ivr_A509 Putative long-chain-fatty-acid COA ligase; structu 99.97
1amu_A 563 GRSA, gramicidin synthetase 1; peptide synthetase, 99.97
3rg2_A 617 Enterobactin synthase component E (ENTE), 2,3-DIH 99.97
3ite_A 562 SIDN siderophore synthetase; ligase, non-ribosomal 99.97
3gqw_A 576 Fatty acid AMP ligase; FAAL, E. coli, ATP-dependen 99.96
3kxw_A 590 Saframycin MX1 synthetase B; fatty acid AMP ligase 99.96
3t5a_A480 Long-chain-fatty-acid--AMP ligase FADD28; acetyl-C 99.96
2vsq_A 1304 Surfactin synthetase subunit 3; ligase, peptidyl c 99.95
3qov_A436 Phenylacetate-coenzyme A ligase; acetyl-COA synthe 99.93
4gs5_A358 Acyl-COA synthetase (AMP-forming)/AMP-acid ligase 99.92
2y27_A437 Phenylacetate-coenzyme A ligase; phenylacetic acid 99.92
2y4o_A443 Phenylacetate-coenzyme A ligase; phenylacetic acid 99.92
3hgu_A369 EHPF; phenazine, antibiotic, biosynthetic protein; 99.89
4eql_A 581 4-substituted benzoates-glutamate ligase GH3.12; f 96.05
4epl_A 581 Jasmonic acid-amido synthetase JAR1; ANL adenylati 95.38
4b2g_A 609 GH3-1 auxin conjugating enzyme; signaling protein, 95.32
4gs5_A358 Acyl-COA synthetase (AMP-forming)/AMP-acid ligase 94.66
3ezx_A215 MMCP 1, monomethylamine corrinoid protein 1; N ter 87.23
>3rix_A Luciferase, luciferin 4-monooxygenase; oxidoreductase, photoprotein, luminescence, aspulvinone, natural product extracts; HET: 923; 1.70A {Photinus pyralis} SCOP: e.23.1.1 PDB: 1ba3_A 1lci_A* 4e5d_A* 3ies_A* 3iep_A* 3ier_A* 4g36_A* 4g37_A* 3qya_A Back     alignment and structure
Probab=100.00  E-value=4.9e-34  Score=242.84  Aligned_cols=200  Identities=27%  Similarity=0.470  Sum_probs=166.7

Q ss_pred             CcccccchHHHHHHHHHHHHhCCeEEEeCCCCHHHHHHHHHhcCceEeeccHHHHHHHHhCCCCCCCCCCceeEEEEccC
Q psy9665           1 MALVPFFHGYGLLLMLQAICMNNKLVVLPHFDGHLFLSSIEKYRVTLLPAVPPLVVFLAKSPLVDQYDLSSLTNIRCGAA   80 (207)
Q Consensus         1 l~~~Pl~h~~g~~~~~~~l~~G~~~v~~~~~~~~~~~~~i~~~~~t~~~~~P~~~~~l~~~~~~~~~~l~~lr~~~~~G~   80 (207)
                      ++++|++|.+|+...+.+++.|+++++.+++++..+++.++++++|++.++|+++..+.+.......+++++|.+++||+
T Consensus       238 l~~~p~~~~~g~~~~~~~l~~G~~~~~~~~~~~~~~~~~i~~~~~t~~~~~P~~~~~l~~~~~~~~~~l~~lr~i~~gG~  317 (550)
T 3rix_A          238 LSVVPFHHGFGMFTTLGYLICGFRVVLMYRFEEELFLRSLQDYKIQSALLVPTLFSFFAKSTLIDKYDLSNLHEIASGGA  317 (550)
T ss_dssp             EECSCTTSHHHHHHHHHHHHHTCEEEECSSCCHHHHHHHHHHTTCSEEEECHHHHHHHHHCCGGGGSCCTTCCEEEECSS
T ss_pred             EEechHHHHHHHHHHHHHHHcCCEEEEeCCCCHHHHHHHHHHcCCeEEEeCcHHHHHHHhCccccccCcccccEEEEecC
Confidence            35789999999988888999999999999999999999999999999999999999999987766778899999999999


Q ss_pred             CCCHHHHHHHHHHhCCCcCcceeccccccccceeeccCC-CCCCCccccccCCceEEEEeCC-CC---CCCcceEEEEcC
Q psy9665          81 PVGKSTLDQVGERLGLSMDSMKQGYGMTELTILVTFSDL-DVPSSSVGKVMPSMKMKVLVKS-HT---MGSQDSFVISGD  155 (207)
Q Consensus        81 ~~~~~~~~~~~~~~~~~~~~i~~~YG~tE~g~~~~~~~~-~~~~~~~G~~~~~~~~~i~d~~-~~---~g~~Gel~i~g~  155 (207)
                      ++++++.+++++.++..  .+++.||+||++..++..+. ....+++|+|+|+++++|+|++ ++   +|+.|||+|+|+
T Consensus       318 ~l~~~~~~~~~~~~~~~--~v~~~YG~TE~~~~~~~~~~~~~~~~~vG~~~~~~~~~i~d~~~~~~~~~g~~GEl~v~g~  395 (550)
T 3rix_A          318 PLSKEVGEAVAKRFHLP--GIRQGYGLTETTSAILITPEGDDKPGAVGKVVPFFEAKVVDLDTGKTLGVNQRGELCVRGP  395 (550)
T ss_dssp             CCCHHHHHHHHHHTTCS--CCEEEEECGGGSSEEEECCTTCCCTTEEEEECTTCEEEEECTTTCCBCCTTCCEEEEEEST
T ss_pred             CCCHHHHHHHHHHcCCC--ccccccCcCccccceecCCCCCCCCCCcccccCCcEEEEEeCCCCcCCCCCCCeEEEEeCC
Confidence            99999999999999976  68999999999988877766 6778899999999999999954 44   489999999999


Q ss_pred             eeeecccccCCCcC---------cccCCcEEEcCeeEEEEEecCccccccccCCCcccc
Q psy9665         156 EIQFAPYCRKMSLG---------AYLCHWLKLKGKQTVLVLGFGSQSCEENLGADNISL  205 (207)
Q Consensus       156 ~~~~~gy~~~~~~~---------~~~~d~~~~~~~~~~~i~grg~~~~~~~~~~~~~s~  205 (207)
                      .+ +.|||++|+.+         +.|||..+++.+|.+.+.||.++..+  ++|+||++
T Consensus       396 ~v-~~GY~~~~~~t~~~~~~~g~~~TGDl~~~~~dG~l~~~GR~dd~ik--~~G~~v~p  451 (550)
T 3rix_A          396 MI-MSGYVNNPEATNALIDKDGWLHSGDIAYWDEDEHFFIVDRLKSLIK--YKGYQVAP  451 (550)
T ss_dssp             TS-CSEETTCHHHHHHHBCTTSCEEEEEEEEECTTCCEEEC------------------
T ss_pred             Cc-chhhcCChhhhhhhcCCCCCeecCcEEEEeCCceEEEEecchheeE--ECCEEECH
Confidence            99 99999997544         35888889988999999999888875  48999875
>3ni2_A 4-coumarate:COA ligase; 4CL, phenylpropanoid biosynthesis; HET: AYL EPE; 1.90A {Populus tomentosa} PDB: 3a9v_A* 3a9u_A* Back     alignment and structure
>2d1s_A Luciferase, luciferin 4-monooxygenase; alpha/beta, beta barrel, alpha+beta, riken structural genomics/proteomics initiative, RSGI; HET: SLU; 1.30A {Luciola cruciata} PDB: 2d1q_A* 2d1r_A* 2d1t_A* Back     alignment and structure
>3g7s_A Long-chain-fatty-acid--COA ligase (FADD-1); protein structure initiative, PSI-II, NYSGXRC, 11193J, structural genomics; 2.15A {Archaeoglobus fulgidus dsm 4304} Back     alignment and structure
>3etc_A AMP-binding protein; adenylate-forming acyl-COA synthetase ligase, ligase; HET: PGE 1PE EPE; 2.10A {Methanosarcina acetivorans} Back     alignment and structure
>3e7w_A D-alanine--poly(phosphoribitol) ligase subunit 1; DLTA, non-ribosomal peptide synthetase, NRPS, adenylation domain, D-alanylation; HET: AMP; 2.28A {Bacillus subtilis} PDB: 3e7x_A* Back     alignment and structure
>4fuq_A Malonyl COA synthetase; ANL superfamily, methylma malonate, ligase; HET: MSE; 1.70A {Rhodopseudomonas palustris} PDB: 4fut_A* 4gxr_A* 4gxq_A* Back     alignment and structure
>1pg4_A Acetyl-COA synthetase; AMP-forming, adenylate-forming, thioester-forming, ligase; HET: COA PRX; 1.75A {Salmonella enterica} SCOP: e.23.1.1 PDB: 1pg3_A* 2p2f_A* 2p2b_A* 2p2q_A* 2p2j_A* 2p20_A* 2p2m_A* Back     alignment and structure
>1mdb_A 2,3-dihydroxybenzoate-AMP ligase; adenylation domain, peptide synthetase, antibiotic biosynthesis, siderophore formation; HET: AMP DBH; 2.15A {Bacillus subtilis} SCOP: e.23.1.1 PDB: 1md9_A* 1mdf_A Back     alignment and structure
>1v25_A Long-chain-fatty-acid-COA synthetase; ligase, structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: ANP; 2.30A {Thermus thermophilus} SCOP: e.23.1.1 PDB: 1ult_A* 1v26_A* Back     alignment and structure
>3c5e_A Acyl-coenzyme A synthetase ACSM2A, mitochondrial; middle-chain acyl-COA synthetase, xenobiotic/medium-chain FA COA ligase; HET: ATP; 1.60A {Homo sapiens} PDB: 2vze_A 3b7w_A* 3day_A* 3eq6_A* 3eyn_A* 3gpc_A* 2wd9_A* Back     alignment and structure
>3fce_A D-alanine--poly(phosphoribitol) ligase subunit 1; DLTA, AMP-forming domain, adenylation, D-alanine protein ligase, ATP complex; HET: ATP; 1.90A {Bacillus cereus} PDB: 3fcc_A* 3dhv_A* Back     alignment and structure
>2v7b_A Benzoate-coenzyme A ligase; benzoate oxidation, benzoate COA ligase; 1.84A {Burkholderia xenovorans} Back     alignment and structure
>3ipl_A 2-succinylbenzoate--COA ligase; structural genomics, acyl-protein synthetase, PSI-2, protein structure initiative; 2.30A {Staphylococcus aureus subsp} Back     alignment and structure
>3r44_A Fatty acyl COA synthetase FADD13 (fatty-acyl-COA synthetase); ligase; HET: HIS; 1.80A {Mycobacterium tuberculosis} PDB: 3t5c_A 3t5b_A Back     alignment and structure
>3l8c_A D-alanine--poly(phosphoribitol) ligase subunit 1; structural genomics, DLTA, ATP-binding, cytoplasm, nucleotide-binding; 2.41A {Streptococcus pyogenes serotype M6} PDB: 3lgx_A* Back     alignment and structure
>3o83_A Peptide arylation enzyme; ligase, adenylation of 2,3-dihydroxybenzoate and transfer to pantetheine cofactor of BASF; HET: IXN; 1.90A {Acinetobacter baumannii} SCOP: e.23.1.0 PDB: 3o82_A* 3o84_A* 3u16_A* 3u17_A* Back     alignment and structure
>4gr5_A Non-ribosomal peptide synthetase; MBTH-like domain, adenylation domain, ligase, rossmann fold, binding; HET: APC TLA; 1.92A {Streptomyces lydicus} PDB: 4gr4_A Back     alignment and structure
>1t5h_X 4-chlorobenzoyl COA ligase; adenylate-forming coenzyme A ligase domain alternation confo change; 2.00A {Alcaligenes SP} SCOP: e.23.1.1 PDB: 1t5d_X 3cw9_A* 3cw8_X* 2qvz_X* 2qw0_X* 3dlp_X* 2qvx_X* 2qvy_X* Back     alignment and structure
>4dg8_A PA1221; ANL superfamily, adenylation domain, peptidyl carrier protei ribosomal peptide synthetase, NRPS, valine adenylation, LIG; HET: AMP; 2.15A {Pseudomonas aeruginosa} PDB: 4dg9_A* Back     alignment and structure
>1ry2_A Acetyl-coenzyme A synthetase 1, acyl-activating enzyme 1; AMP forming, related to firefly luciferase, ligase; HET: AMP; 2.30A {Saccharomyces cerevisiae} SCOP: e.23.1.1 Back     alignment and structure
>3tsy_A Fusion protein 4-coumarate--COA ligase 1, resvera synthase; transferase; 3.10A {Arabidospis thaliana} Back     alignment and structure
>3nyq_A Malonyl-COA ligase; A/B topology ababa sandwich beta-barrel adenylate-forming EN fold; HET: MCA AMP; 1.43A {Streptomyces coelicolor} PDB: 3nyr_A* Back     alignment and structure
>3ivr_A Putative long-chain-fatty-acid COA ligase; structural genomics, PSI-2, protein S initiative, fatty acid synthesis; HET: GOL; 2.00A {Rhodopseudomonas palustris} SCOP: e.23.1.0 Back     alignment and structure
>1amu_A GRSA, gramicidin synthetase 1; peptide synthetase, adenylate forming; HET: PHE AMP; 1.90A {Brevibacillus brevis} SCOP: e.23.1.1 Back     alignment and structure
>3rg2_A Enterobactin synthase component E (ENTE), 2,3-DIH dihydroxybenzoate synthetase, isochroismatase...; adenylate-forming enzymes, ANL superfamily; HET: SVS PNS; 3.10A {Escherichia coli} Back     alignment and structure
>3ite_A SIDN siderophore synthetase; ligase, non-ribosomal peptide synthesis, NRPS, sidna3, fungal, endophyte; HET: MSE; 2.00A {Neotyphodium lolii} Back     alignment and structure
>3kxw_A Saframycin MX1 synthetase B; fatty acid AMP ligase, SGX, acyl adenylate, structural genom 2, protein structure initiative; HET: 1ZZ; 1.85A {Legionella pneumophila subsp} PDB: 3lnv_A* Back     alignment and structure
>3t5a_A Long-chain-fatty-acid--AMP ligase FADD28; acetyl-COA synthetase like fold, AMP-binding; 2.05A {Mycobacterium tuberculosis} PDB: 3e53_A Back     alignment and structure
>2vsq_A Surfactin synthetase subunit 3; ligase, peptidyl carrier protein, ligase phosphoprotein, TER module, phosphopantetheine; 2.60A {Bacillus subtilis} Back     alignment and structure
>3qov_A Phenylacetate-coenzyme A ligase; acetyl-COA synthetase-like, structural genomics, joint cente structural genomics, JCSG; HET: MSE ADP COA; 2.20A {Bacteroides thetaiotaomicron} PDB: 3s89_A* Back     alignment and structure
>4gs5_A Acyl-COA synthetase (AMP-forming)/AMP-acid ligase protein; structural genomics, PSI-biology; 2.02A {Dyadobacter fermentans} Back     alignment and structure
>2y27_A Phenylacetate-coenzyme A ligase; phenylacetic acid degradation pathway; HET: MSE PG4 ATP; 1.60A {Burkholderia cenocepacia} PDB: 2y4n_A* Back     alignment and structure
>2y4o_A Phenylacetate-coenzyme A ligase; phenylacetic acid degradation pathway; HET: DLL; 1.90A {Burkholderia cenocepacia} Back     alignment and structure
>3hgu_A EHPF; phenazine, antibiotic, biosynthetic protein; 1.95A {Pantoea agglomerans} PDB: 3hgv_A 3l2k_A* Back     alignment and structure
>4eql_A 4-substituted benzoates-glutamate ligase GH3.12; firefly luciferase family, acyl adenylase, amino acid conjug ligase; HET: AMP SAL; 1.80A {Arabidopsis thaliana} PDB: 4epm_A* 4eq4_A* 4ewv_A* Back     alignment and structure
>4epl_A Jasmonic acid-amido synthetase JAR1; ANL adenylating enzyme, acyl acid-amido synthetase, adenylat ligase; HET: JAI; 2.01A {Arabidopsis thaliana} Back     alignment and structure
>4b2g_A GH3-1 auxin conjugating enzyme; signaling protein, ignaling protein, adenylate, amino acid conjugation, plant growth; HET: V1N; 2.40A {Vitis vinifera} Back     alignment and structure
>4gs5_A Acyl-COA synthetase (AMP-forming)/AMP-acid ligase protein; structural genomics, PSI-biology; 2.02A {Dyadobacter fermentans} Back     alignment and structure
>3ezx_A MMCP 1, monomethylamine corrinoid protein 1; N terminal all helical bundle C terminal rossmann fold, cobalt, metal-binding; HET: HCB; 2.56A {Methanosarcina barkeri} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 207
d1pg4a_ 643 e.23.1.1 (A:) Acetyl-CoA synthetase {Salmonella en 6e-22
d1ry2a_ 640 e.23.1.1 (A:) Acetyl-CoA synthetase {Baker's yeast 1e-14
>d1pg4a_ e.23.1.1 (A:) Acetyl-CoA synthetase {Salmonella enterica [TaxId: 28901]} Length = 643 Back     information, alignment and structure

class: Multi-domain proteins (alpha and beta)
fold: Acetyl-CoA synthetase-like
superfamily: Acetyl-CoA synthetase-like
family: Acetyl-CoA synthetase-like
domain: Acetyl-CoA synthetase
species: Salmonella enterica [TaxId: 28901]

 Score = 90.9 bits (225), Expect = 6e-22
 Identities = 16/148 (10%), Positives = 46/148 (31%), Gaps = 10/148 (6%)

Query: 1   MALVPFFHGYGL-LLMLQAICMNNKLVVLP----HFDGHLFLSSIEKYRVTLLPAVPPLV 55
                     G   L+   +      ++                ++K++V +L   P  +
Sbjct: 298 WCTADVGWVTGHSYLLYGPLACGATTLMFEGVPNWPTPARMCQVVDKHQVNILYTAPTAI 357

Query: 56  VFLAKSP--LVDQYDLSSLTNIRCGAAPVGKSTLDQVGERLGLSMDSMKQGYGMTELTIL 113
             L       ++  D SSL  +     P+     +   +++G     +   +  TE    
Sbjct: 358 RALMAEGDKAIEGTDRSSLRILGSVGEPINPEAWEWYWKKIGKEKCPVVDTWWQTETGGF 417

Query: 114 VTFS---DLDVPSSSVGKVMPSMKMKVL 138
           +       +++ + S  +    ++  ++
Sbjct: 418 MITPLPGAIELKAGSATRPFFGVQPALV 445
>d1ry2a_ e.23.1.1 (A:) Acetyl-CoA synthetase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 640 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query207
d1pg4a_ 643 Acetyl-CoA synthetase {Salmonella enterica [TaxId: 99.98
d1ry2a_ 640 Acetyl-CoA synthetase {Baker's yeast (Saccharomyce 99.97
d1lcia_541 Luciferase {Firefly (Photinus pyralis) [TaxId: 705 99.96
d1v25a_534 Long chain fatty acid-CoA ligase TT0168 {Thermus t 99.96
d1amua_514 Phenylalanine activating domain of gramicidin synt 99.88
d1mdba_536 Dihydroxybenzoate-AMP ligase DhbE {Bacillus subtil 99.87
d3cw9a1503 4-chlorobenzoyl CoA ligase {Alcaligenes sp. [TaxId 99.77
>d1pg4a_ e.23.1.1 (A:) Acetyl-CoA synthetase {Salmonella enterica [TaxId: 28901]} Back     information, alignment and structure
class: Multi-domain proteins (alpha and beta)
fold: Acetyl-CoA synthetase-like
superfamily: Acetyl-CoA synthetase-like
family: Acetyl-CoA synthetase-like
domain: Acetyl-CoA synthetase
species: Salmonella enterica [TaxId: 28901]

Probab=99.98  E-value=2.4e-32  Score=234.32  Aligned_cols=202  Identities=9%  Similarity=0.046  Sum_probs=173.1

Q ss_pred             CcccccchHHHHHH-HHHHHHhCCeEEEeCC----CCHHHHHHHHHhcCceEeeccHHHHHHHHhCCC--CCCCCCCcee
Q psy9665           1 MALVPFFHGYGLLL-MLQAICMNNKLVVLPH----FDGHLFLSSIEKYRVTLLPAVPPLVVFLAKSPL--VDQYDLSSLT   73 (207)
Q Consensus         1 l~~~Pl~h~~g~~~-~~~~l~~G~~~v~~~~----~~~~~~~~~i~~~~~t~~~~~P~~~~~l~~~~~--~~~~~l~~lr   73 (207)
                      ++++|++|++|+.. ++.+|+.|+++++++.    +++..+++.++++++|++.++|++++.|++...  ....++++||
T Consensus       298 ~~~~p~~~~~g~~~~l~~~L~~G~t~vl~~~~~~~~~~~~~~~~i~~~~vt~~~~~P~~l~~l~~~~~~~~~~~dl~sLr  377 (643)
T d1pg4a_         298 WCTADVGWVTGHSYLLYGPLACGATTLMFEGVPNWPTPARMCQVVDKHQVNILYTAPTAIRALMAEGDKAIEGTDRSSLR  377 (643)
T ss_dssp             EECSCTTSHHHHHHTTHHHHHTTCEEEEECSCTTSSSTTHHHHHHHHHTCSEEEECHHHHHHHHTTGGGGTTTCCCTTCC
T ss_pred             EEeCChHHHHHHHHHHHHHHHhCCEEEEecCCCCCCCHHHHHHHHHHHCCcEEEehHHHHHHHHhCcchhccccCCCceE
Confidence            35789999999875 7788999999999763    489999999999999999999999999988754  2456789999


Q ss_pred             EEEEccCCCCHHHHHHHHHHhCCCcCcceeccccccccceeeccCC---CCCCCccccccCCceEEEEeCCCCC---CCc
Q psy9665          74 NIRCGAAPVGKSTLDQVGERLGLSMDSMKQGYGMTELTILVTFSDL---DVPSSSVGKVMPSMKMKVLVKSHTM---GSQ  147 (207)
Q Consensus        74 ~~~~~G~~~~~~~~~~~~~~~~~~~~~i~~~YG~tE~g~~~~~~~~---~~~~~~~G~~~~~~~~~i~d~~~~~---g~~  147 (207)
                      .++++|+++++++++++.+.++...+.+++.||+||++..++....   ..+.+++|+|+++++++++|++|++   ++.
T Consensus       378 ~i~~~G~pl~~~~~~~~~~~~g~~~~~i~~~yG~TE~g~~~~~~~~~~~~~~~gs~G~p~~g~~v~ivd~~g~~~~~g~~  457 (643)
T d1pg4a_         378 ILGSVGEPINPEAWEWYWKKIGKEKCPVVDTWWQTETGGFMITPLPGAIELKAGSATRPFFGVQPALVDNEGHPQEGATE  457 (643)
T ss_dssp             EEEEESSCCCHHHHHHHHHHTTTTCSCEEEEBCCGGGSSCSBCCCTTTCCBCTTCCBSBCTTCCEEEECTTCCBCCSSEE
T ss_pred             EEEEEeCCCCHHHHHHHHHHhCCCCceEEEeechhhccceEEecCCCccCCCCCccccccCCCEEEEECCCCCCCCCCce
Confidence            9999999999999999999997554469999999999877665433   4577899999999999999999883   788


Q ss_pred             ceEEEEcC--eeeecccccCCCcC-----------cccCCcEEEcCeeEEEEEecCccccccccCCCcccc
Q psy9665         148 DSFVISGD--EIQFAPYCRKMSLG-----------AYLCHWLKLKGKQTVLVLGFGSQSCEENLGADNISL  205 (207)
Q Consensus       148 Gel~i~g~--~~~~~gy~~~~~~~-----------~~~~d~~~~~~~~~~~i~grg~~~~~~~~~~~~~s~  205 (207)
                      |||+|+++  .+ +.+||++++.+           ++|||+.+++++|.++++||.+.+.  +.+|.||+.
T Consensus       458 Gel~v~~~~p~~-~~~~~~~~~~~~~~~~~~~~g~~~TGDl~~~d~dG~l~i~GR~dd~i--k~~G~ri~p  525 (643)
T d1pg4a_         458 GNLVITDSWPGQ-ARTLFGDHERFEQTYFSTFKNMYFSGDGARRDEDGYYWITGRVDDVL--NVSGHRLGT  525 (643)
T ss_dssp             EEEEECSCCTTC-CCEETTCHHHHHHHHHSSSTTSEEEEEEEEECTTSCEEEEEESSSEE--EETTEEEEH
T ss_pred             EEEEEecCCCcc-cccccCChhhchhhhcccCCCeEEcCCEEEECCCceEEEecccccEE--EECCEEECH
Confidence            99999995  56 78999887432           3489999999999999999988877  568999875
>d1ry2a_ e.23.1.1 (A:) Acetyl-CoA synthetase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lcia_ e.23.1.1 (A:) Luciferase {Firefly (Photinus pyralis) [TaxId: 7054]} Back     information, alignment and structure
>d1v25a_ e.23.1.1 (A:) Long chain fatty acid-CoA ligase TT0168 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1amua_ e.23.1.1 (A:) Phenylalanine activating domain of gramicidin synthetase 1 {Bacillus brevis [TaxId: 1393]} Back     information, alignment and structure
>d1mdba_ e.23.1.1 (A:) Dihydroxybenzoate-AMP ligase DhbE {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d3cw9a1 e.23.1.1 (A:1-503) 4-chlorobenzoyl CoA ligase {Alcaligenes sp. [TaxId: 512]} Back     information, alignment and structure