Psyllid ID: psy969
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 106 | ||||||
| 389612225 | 134 | deoxyribose-phosphate aldolase [Papilio | 0.971 | 0.768 | 0.453 | 5e-18 | |
| 156542751 | 304 | PREDICTED: putative deoxyribose-phosphat | 0.735 | 0.256 | 0.538 | 1e-17 | |
| 340720128 | 293 | PREDICTED: putative deoxyribose-phosphat | 0.915 | 0.331 | 0.425 | 8e-17 | |
| 350408270 | 293 | PREDICTED: putative deoxyribose-phosphat | 0.915 | 0.331 | 0.425 | 2e-16 | |
| 332017146 | 372 | Putative deoxyribose-phosphate aldolase | 0.924 | 0.263 | 0.470 | 3e-16 | |
| 328786659 | 293 | PREDICTED: putative deoxyribose-phosphat | 0.924 | 0.334 | 0.421 | 5e-16 | |
| 307213992 | 309 | Putative deoxyribose-phosphate aldolase | 0.924 | 0.317 | 0.460 | 2e-15 | |
| 383863182 | 293 | PREDICTED: putative deoxyribose-phosphat | 0.632 | 0.228 | 0.537 | 6e-15 | |
| 242247513 | 327 | deoxyribose-phosphate aldolase-like [Acy | 0.830 | 0.269 | 0.446 | 7e-15 | |
| 255013150 | 312 | deoxyribose-phosphate aldolase [Bacteroi | 0.849 | 0.288 | 0.437 | 9e-15 |
| >gi|389612225|dbj|BAM19626.1| deoxyribose-phosphate aldolase [Papilio xuthus] | Back alignment and taxonomy information |
|---|
Score = 95.1 bits (235), Expect = 5e-18, Method: Compositional matrix adjust.
Identities = 49/108 (45%), Positives = 69/108 (63%), Gaps = 5/108 (4%)
Query: 1 MGRPRKVAFKGSNFRTLHGRGPDSTSYG----NVCNTCGIIMCSAIKHFHKLSGKKIGLK 56
+G R V +K S L G TS G N G++MC AI++F++L+G K+GLK
Sbjct: 19 LGSYRNV-YKASLISMLAGADFIKTSTGKEVVNATLPVGLVMCRAIRYFYQLTGVKVGLK 77
Query: 57 PAGGISTFEDSVRWIYLVLIMLGPDWLNKDLFRIGASSLLNNILQELE 104
PAGGI T D++ W+ LV LGP+W+ DLFRIGASSLL+ +++ L+
Sbjct: 78 PAGGIKTARDAINWLVLVYTELGPEWITPDLFRIGASSLLDVVVKSLD 125
|
Source: Papilio xuthus Species: Papilio xuthus Genus: Papilio Family: Papilionidae Order: Lepidoptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|156542751|ref|XP_001599908.1| PREDICTED: putative deoxyribose-phosphate aldolase-like [Nasonia vitripennis] | Back alignment and taxonomy information |
|---|
| >gi|340720128|ref|XP_003398495.1| PREDICTED: putative deoxyribose-phosphate aldolase-like [Bombus terrestris] | Back alignment and taxonomy information |
|---|
| >gi|350408270|ref|XP_003488356.1| PREDICTED: putative deoxyribose-phosphate aldolase-like [Bombus impatiens] | Back alignment and taxonomy information |
|---|
| >gi|332017146|gb|EGI57945.1| Putative deoxyribose-phosphate aldolase [Acromyrmex echinatior] | Back alignment and taxonomy information |
|---|
| >gi|328786659|ref|XP_624372.2| PREDICTED: putative deoxyribose-phosphate aldolase-like [Apis mellifera] | Back alignment and taxonomy information |
|---|
| >gi|307213992|gb|EFN89199.1| Putative deoxyribose-phosphate aldolase [Harpegnathos saltator] | Back alignment and taxonomy information |
|---|
| >gi|383863182|ref|XP_003707061.1| PREDICTED: putative deoxyribose-phosphate aldolase-like [Megachile rotundata] | Back alignment and taxonomy information |
|---|
| >gi|242247513|ref|NP_001156293.1| deoxyribose-phosphate aldolase-like [Acyrthosiphon pisum] gi|239789796|dbj|BAH71498.1| ACYPI009138 [Acyrthosiphon pisum] | Back alignment and taxonomy information |
|---|
| >gi|255013150|ref|ZP_05285276.1| deoxyribose-phosphate aldolase [Bacteroides sp. 2_1_7] gi|410102612|ref|ZP_11297538.1| deoxyribose-phosphate aldolase [Parabacteroides sp. D25] gi|409238684|gb|EKN31475.1| deoxyribose-phosphate aldolase [Parabacteroides sp. D25] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 106 | ||||||
| WB|WBGene00017283 | 303 | F09E5.3 [Caenorhabditis elegan | 0.632 | 0.221 | 0.552 | 2.9e-16 | |
| UNIPROTKB|F1NT21 | 318 | DERA "Uncharacterized protein" | 0.896 | 0.298 | 0.404 | 1.1e-13 | |
| MGI|MGI:1913762 | 318 | Dera "2-deoxyribose-5-phosphat | 0.896 | 0.298 | 0.424 | 2.3e-13 | |
| UNIPROTKB|G3V158 | 230 | DERA "Putative deoxyribose-pho | 0.896 | 0.413 | 0.414 | 2.7e-13 | |
| ZFIN|ZDB-GENE-041010-200 | 318 | dera "2-deoxyribose-5-phosphat | 0.830 | 0.276 | 0.425 | 3e-13 | |
| RGD|1589836 | 308 | Dera "deoxyribose-phosphate al | 0.896 | 0.308 | 0.424 | 3.4e-13 | |
| UNIPROTKB|E9PPM8 | 275 | DERA "Putative deoxyribose-pho | 0.849 | 0.327 | 0.406 | 5.4e-13 | |
| UNIPROTKB|Q9Y315 | 318 | DERA "Putative deoxyribose-pho | 0.896 | 0.298 | 0.414 | 6.6e-13 | |
| UNIPROTKB|F1PPB6 | 318 | DERA "Uncharacterized protein" | 0.896 | 0.298 | 0.404 | 8.5e-13 | |
| UNIPROTKB|F1SQY2 | 318 | DERA "Uncharacterized protein" | 0.896 | 0.298 | 0.404 | 1.9e-12 |
| WB|WBGene00017283 F09E5.3 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
Score = 202 (76.2 bits), Expect = 2.9e-16, P = 2.9e-16
Identities = 37/67 (55%), Positives = 54/67 (80%)
Query: 37 IMCSAIKHFHKLSGKKIGLKPAGGISTFEDSVRWIYLVLIMLGPDWLNKDLFRIGASSLL 96
+MC+AIK +H+L+GKK+G KPAGGI T ++++ ++ LV +LG +WLN LFRIGASSLL
Sbjct: 237 VMCTAIKRWHELTGKKVGFKPAGGIKTVDEALSYVALVKDILGDEWLNPHLFRIGASSLL 296
Query: 97 NNILQEL 103
++ L+ L
Sbjct: 297 DDCLKGL 303
|
|
| UNIPROTKB|F1NT21 DERA "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:1913762 Dera "2-deoxyribose-5-phosphate aldolase homolog (C. elegans)" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|G3V158 DERA "Putative deoxyribose-phosphate aldolase" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-041010-200 dera "2-deoxyribose-5-phosphate aldolase homolog (C. elegans)" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| RGD|1589836 Dera "deoxyribose-phosphate aldolase (putative)" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|E9PPM8 DERA "Putative deoxyribose-phosphate aldolase" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9Y315 DERA "Putative deoxyribose-phosphate aldolase" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1PPB6 DERA "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1SQY2 DERA "Uncharacterized protein" [Sus scrofa (taxid:9823)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 106 | |||
| PRK05283 | 257 | PRK05283, PRK05283, deoxyribose-phosphate aldolase | 2e-15 | |
| COG0274 | 228 | COG0274, DeoC, Deoxyribose-phosphate aldolase [Nuc | 5e-08 | |
| cd00959 | 203 | cd00959, DeoC, 2-deoxyribose-5-phosphate aldolase | 2e-06 | |
| PRK00507 | 221 | PRK00507, PRK00507, deoxyribose-phosphate aldolase | 8e-05 | |
| cd00945 | 201 | cd00945, Aldolase_Class_I, Class I aldolases | 0.001 |
| >gnl|CDD|235387 PRK05283, PRK05283, deoxyribose-phosphate aldolase; Provisional | Back alignment and domain information |
|---|
Score = 68.8 bits (169), Expect = 2e-15
Identities = 28/68 (41%), Positives = 40/68 (58%), Gaps = 2/68 (2%)
Query: 37 IMCSAIKHFHKLSGKKIGLKPAGGISTFEDSVRWIYLVLIMLGPDWLNKDLFRIGASSLL 96
IM I+ K +G KPAGG+ T ED+ +++ L +LG DW + FR GASSLL
Sbjct: 182 IMLEVIRD--MGVAKTVGFKPAGGVRTAEDAAQYLALADEILGADWADARHFRFGASSLL 239
Query: 97 NNILQELE 104
++L+ L
Sbjct: 240 ASLLKTLG 247
|
Length = 257 |
| >gnl|CDD|223351 COG0274, DeoC, Deoxyribose-phosphate aldolase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|188646 cd00959, DeoC, 2-deoxyribose-5-phosphate aldolase (DERA) of the DeoC family | Back alignment and domain information |
|---|
| >gnl|CDD|234784 PRK00507, PRK00507, deoxyribose-phosphate aldolase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|188634 cd00945, Aldolase_Class_I, Class I aldolases | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 106 | |||
| PRK05283 | 257 | deoxyribose-phosphate aldolase; Provisional | 100.0 | |
| KOG3981|consensus | 326 | 99.94 | ||
| COG0274 | 228 | DeoC Deoxyribose-phosphate aldolase [Nucleotide tr | 99.94 | |
| TIGR00126 | 211 | deoC deoxyribose-phosphate aldolase. Deoxyribose-p | 99.89 | |
| PRK00507 | 221 | deoxyribose-phosphate aldolase; Provisional | 99.89 | |
| cd00959 | 203 | DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of | 99.84 | |
| PF01791 | 236 | DeoC: DeoC/LacD family aldolase; InterPro: IPR0029 | 99.67 | |
| PRK07226 | 267 | fructose-bisphosphate aldolase; Provisional | 98.59 | |
| TIGR01949 | 258 | AroFGH_arch predicted phospho-2-dehydro-3-deoxyhep | 98.06 | |
| cd00945 | 201 | Aldolase_Class_I Class I aldolases. The class I al | 97.77 | |
| cd04738 | 327 | DHOD_2_like Dihydroorotate dehydrogenase (DHOD) cl | 97.45 | |
| PRK05286 | 344 | dihydroorotate dehydrogenase 2; Reviewed | 97.06 | |
| cd00958 | 235 | DhnA Class I fructose-1,6-bisphosphate (FBP) aldol | 96.99 | |
| cd02810 | 289 | DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) | 96.59 | |
| cd02940 | 299 | DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FM | 96.08 | |
| PRK05848 | 273 | nicotinate-nucleotide pyrophosphorylase; Provision | 95.89 | |
| PTZ00314 | 495 | inosine-5'-monophosphate dehydrogenase; Provisiona | 95.69 | |
| cd02809 | 299 | alpha_hydroxyacid_oxid_FMN Family of homologous FM | 95.51 | |
| cd04739 | 325 | DHOD_like Dihydroorotate dehydrogenase (DHOD) like | 95.42 | |
| PF04131 | 192 | NanE: Putative N-acetylmannosamine-6-phosphate epi | 95.32 | |
| TIGR01036 | 335 | pyrD_sub2 dihydroorotate dehydrogenase, subfamily | 95.26 | |
| PF01180 | 295 | DHO_dh: Dihydroorotate dehydrogenase; InterPro: IP | 95.2 | |
| cd04741 | 294 | DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) c | 95.13 | |
| PRK07565 | 334 | dihydroorotate dehydrogenase 2; Reviewed | 95.1 | |
| cd00452 | 190 | KDPG_aldolase KDPG and KHG aldolase. This family b | 95.07 | |
| cd03332 | 383 | LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-bindin | 94.99 | |
| cd02803 | 327 | OYE_like_FMN_family Old yellow enzyme (OYE)-like F | 94.93 | |
| PRK07107 | 502 | inosine 5-monophosphate dehydrogenase; Validated | 94.9 | |
| PLN02826 | 409 | dihydroorotate dehydrogenase | 94.82 | |
| PRK06843 | 404 | inosine 5-monophosphate dehydrogenase; Validated | 94.66 | |
| cd04736 | 361 | MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-bin | 94.56 | |
| TIGR03128 | 206 | RuMP_HxlA 3-hexulose-6-phosphate synthase. at the | 94.32 | |
| PLN02535 | 364 | glycolate oxidase | 94.31 | |
| PLN02274 | 505 | inosine-5'-monophosphate dehydrogenase | 94.3 | |
| COG0167 | 310 | PyrD Dihydroorotate dehydrogenase [Nucleotide tran | 94.27 | |
| PRK08385 | 278 | nicotinate-nucleotide pyrophosphorylase; Provision | 94.11 | |
| PRK05567 | 486 | inosine 5'-monophosphate dehydrogenase; Reviewed | 94.09 | |
| PRK01130 | 221 | N-acetylmannosamine-6-phosphate 2-epimerase; Provi | 93.98 | |
| TIGR01302 | 450 | IMP_dehydrog inosine-5'-monophosphate dehydrogenas | 93.9 | |
| cd02922 | 344 | FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding dom | 93.89 | |
| TIGR00736 | 231 | nifR3_rel_arch TIM-barrel protein, putative. Membe | 93.87 | |
| PRK07807 | 479 | inosine 5-monophosphate dehydrogenase; Validated | 93.86 | |
| TIGR02708 | 367 | L_lactate_ox L-lactate oxidase. Members of this pr | 93.73 | |
| TIGR01037 | 300 | pyrD_sub1_fam dihydroorotate dehydrogenase (subfam | 93.67 | |
| cd04737 | 351 | LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding d | 93.67 | |
| cd04733 | 338 | OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN | 93.61 | |
| cd02932 | 336 | OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN | 93.6 | |
| cd04729 | 219 | NanE N-acetylmannosamine-6-phosphate epimerase (Na | 93.45 | |
| PRK02506 | 310 | dihydroorotate dehydrogenase 1A; Reviewed | 93.43 | |
| cd02801 | 231 | DUS_like_FMN Dihydrouridine synthase-like (DUS-lik | 93.3 | |
| PRK07428 | 288 | nicotinate-nucleotide pyrophosphorylase; Provision | 93.21 | |
| cd00381 | 325 | IMPDH IMPDH: The catalytic domain of the inosine m | 93.06 | |
| cd02803 | 327 | OYE_like_FMN_family Old yellow enzyme (OYE)-like F | 92.9 | |
| COG3010 | 229 | NanE Putative N-acetylmannosamine-6-phosphate epim | 92.86 | |
| cd02808 | 392 | GltS_FMN Glutamate synthase (GltS) FMN-binding dom | 92.74 | |
| TIGR02151 | 333 | IPP_isom_2 isopentenyl-diphosphate delta-isomerase | 92.66 | |
| PF01729 | 169 | QRPTase_C: Quinolinate phosphoribosyl transferase, | 92.63 | |
| PRK05437 | 352 | isopentenyl pyrophosphate isomerase; Provisional | 92.56 | |
| cd04740 | 296 | DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) c | 92.46 | |
| PRK08318 | 420 | dihydropyrimidine dehydrogenase subunit B; Validat | 92.45 | |
| PRK08649 | 368 | inosine 5-monophosphate dehydrogenase; Validated | 92.37 | |
| PF01070 | 356 | FMN_dh: FMN-dependent dehydrogenase; InterPro: IPR | 92.36 | |
| PLN02979 | 366 | glycolate oxidase | 92.35 | |
| PRK04180 | 293 | pyridoxal biosynthesis lyase PdxS; Provisional | 92.33 | |
| PF01645 | 368 | Glu_synthase: Conserved region in glutamate syntha | 92.17 | |
| PRK07259 | 301 | dihydroorotate dehydrogenase 1B; Reviewed | 92.15 | |
| cd04731 | 243 | HisF The cyclase subunit of imidazoleglycerol phos | 92.15 | |
| PLN02495 | 385 | oxidoreductase, acting on the CH-CH group of donor | 92.08 | |
| TIGR01306 | 321 | GMP_reduct_2 guanosine monophosphate reductase, ba | 91.76 | |
| cd02911 | 233 | arch_FMN Archeal FMN-binding domain. This family o | 91.74 | |
| TIGR01304 | 369 | IMP_DH_rel_2 IMP dehydrogenase family protein. Thi | 91.64 | |
| PLN02493 | 367 | probable peroxisomal (S)-2-hydroxy-acid oxidase | 91.53 | |
| PRK09140 | 206 | 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; R | 91.41 | |
| COG0106 | 241 | HisA Phosphoribosylformimino-5-aminoimidazole carb | 91.27 | |
| cd02811 | 326 | IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl di | 91.18 | |
| PRK05742 | 277 | nicotinate-nucleotide pyrophosphorylase; Provision | 91.14 | |
| TIGR00262 | 256 | trpA tryptophan synthase, alpha subunit. Tryptopha | 90.86 | |
| TIGR01768 | 223 | GGGP-family geranylgeranylglyceryl phosphate synth | 90.82 | |
| PRK04128 | 228 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met | 90.73 | |
| COG0069 | 485 | GltB Glutamate synthase domain 2 [Amino acid trans | 90.45 | |
| PRK07107 | 502 | inosine 5-monophosphate dehydrogenase; Validated | 90.41 | |
| PF01884 | 230 | PcrB: PcrB family; InterPro: IPR008205 This entry | 90.24 | |
| cd01573 | 272 | modD_like ModD; Quinolinate phosphoribosyl transfe | 89.84 | |
| cd00331 | 217 | IGPS Indole-3-glycerol phosphate synthase (IGPS); | 89.64 | |
| PRK07455 | 187 | keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog | 89.52 | |
| TIGR01303 | 475 | IMP_DH_rel_1 IMP dehydrogenase family protein. Thi | 89.51 | |
| TIGR00343 | 287 | pyridoxal 5'-phosphate synthase, synthase subunit | 89.5 | |
| cd04747 | 361 | OYE_like_5_FMN Old yellow enzyme (OYE)-related FMN | 89.45 | |
| PRK05458 | 326 | guanosine 5'-monophosphate oxidoreductase; Provisi | 89.35 | |
| PRK14024 | 241 | phosphoribosyl isomerase A; Provisional | 89.3 | |
| cd04723 | 233 | HisA_HisF Phosphoribosylformimino-5-aminoimidazole | 89.26 | |
| PRK13523 | 337 | NADPH dehydrogenase NamA; Provisional | 88.93 | |
| PRK11197 | 381 | lldD L-lactate dehydrogenase; Provisional | 88.93 | |
| TIGR01769 | 205 | GGGP geranylgeranylglyceryl phosphate synthase. Th | 88.68 | |
| cd01571 | 302 | NAPRTase_B Nicotinate phosphoribosyltransferase (N | 88.61 | |
| PRK07028 | 430 | bifunctional hexulose-6-phosphate synthase/ribonuc | 88.27 | |
| cd04722 | 200 | TIM_phosphate_binding TIM barrel proteins share a | 87.7 | |
| PRK07896 | 289 | nicotinate-nucleotide pyrophosphorylase; Provision | 87.68 | |
| PRK00043 | 212 | thiE thiamine-phosphate pyrophosphorylase; Reviewe | 87.64 | |
| PRK13587 | 234 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met | 87.56 | |
| TIGR02129 | 253 | hisA_euk phosphoribosylformimino-5-aminoimidazole | 87.52 | |
| PRK10605 | 362 | N-ethylmaleimide reductase; Provisional | 87.25 | |
| PRK06552 | 213 | keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog | 87.23 | |
| TIGR00078 | 265 | nadC nicotinate-nucleotide pyrophosphorylase. Syno | 86.94 | |
| cd02931 | 382 | ER_like_FMN Enoate reductase (ER)-like FMN-binding | 86.79 | |
| PRK08227 | 264 | autoinducer 2 aldolase; Validated | 86.52 | |
| cd04730 | 236 | NPD_like 2-Nitropropane dioxygenase (NPD), one of | 86.37 | |
| PRK06852 | 304 | aldolase; Validated | 86.37 | |
| cd04728 | 248 | ThiG Thiazole synthase (ThiG) is the tetrameric en | 86.11 | |
| COG0107 | 256 | HisF Imidazoleglycerol-phosphate synthase [Amino a | 86.0 | |
| PRK07695 | 201 | transcriptional regulator TenI; Provisional | 85.95 | |
| PRK10415 | 321 | tRNA-dihydrouridine synthase B; Provisional | 85.79 | |
| PRK04302 | 223 | triosephosphate isomerase; Provisional | 85.77 | |
| cd04727 | 283 | pdxS PdxS is a subunit of the pyridoxal 5'-phospha | 85.72 | |
| cd00956 | 211 | Transaldolase_FSA Transaldolase-like fructose-6-ph | 85.61 | |
| PRK02083 | 253 | imidazole glycerol phosphate synthase subunit HisF | 85.55 | |
| PRK14114 | 241 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met | 85.53 | |
| PRK06096 | 284 | molybdenum transport protein ModD; Provisional | 85.46 | |
| PF00478 | 352 | IMPDH: IMP dehydrogenase / GMP reductase domain; I | 85.26 | |
| cd01572 | 268 | QPRTase Quinolinate phosphoribosyl transferase (QA | 85.05 | |
| cd02812 | 219 | PcrB_like PcrB_like proteins. One member of this f | 84.96 | |
| PRK09016 | 296 | quinolinate phosphoribosyltransferase; Validated | 84.74 | |
| TIGR01334 | 277 | modD putative molybdenum utilization protein ModD. | 84.64 | |
| TIGR00735 | 254 | hisF imidazoleglycerol phosphate synthase, cyclase | 84.58 | |
| PRK09250 | 348 | fructose-bisphosphate aldolase; Provisional | 84.56 | |
| TIGR03151 | 307 | enACPred_II putative enoyl-(acyl-carrier-protein) | 84.52 | |
| PF00977 | 229 | His_biosynth: Histidine biosynthesis protein; Inte | 84.49 | |
| PRK08072 | 277 | nicotinate-nucleotide pyrophosphorylase; Provision | 84.39 | |
| cd04734 | 343 | OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN | 84.36 | |
| PRK00748 | 233 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met | 84.21 | |
| cd02933 | 338 | OYE_like_FMN Old yellow enzyme (OYE)-like FMN bind | 84.1 | |
| TIGR00693 | 196 | thiE thiamine-phosphate pyrophosphorylase. This mo | 84.09 | |
| PRK13585 | 241 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)met | 84.06 | |
| PRK11750 | 1485 | gltB glutamate synthase subunit alpha; Provisional | 83.89 | |
| PRK00208 | 250 | thiG thiazole synthase; Reviewed | 83.85 | |
| PLN02411 | 391 | 12-oxophytodienoate reductase | 83.75 | |
| cd02801 | 231 | DUS_like_FMN Dihydrouridine synthase-like (DUS-lik | 83.57 | |
| cd02810 | 289 | DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) | 83.55 | |
| cd04726 | 202 | KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxyl | 83.43 | |
| cd00564 | 196 | TMP_TenI Thiamine monophosphate synthase (TMP synt | 83.02 | |
| cd02930 | 353 | DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-bindin | 82.99 | |
| TIGR00875 | 213 | fsa_talC_mipB fructose-6-phosphate aldolase, TalC/ | 82.84 | |
| COG1646 | 240 | Predicted phosphate-binding enzymes, TIM-barrel fo | 82.76 | |
| cd04731 | 243 | HisF The cyclase subunit of imidazoleglycerol phos | 82.44 | |
| TIGR01305 | 343 | GMP_reduct_1 guanosine monophosphate reductase, eu | 82.28 | |
| KOG1436|consensus | 398 | 81.7 | ||
| TIGR00737 | 319 | nifR3_yhdG putative TIM-barrel protein, nifR3 fami | 81.63 | |
| PRK06843 | 404 | inosine 5-monophosphate dehydrogenase; Validated | 81.3 | |
| cd04732 | 234 | HisA HisA. Phosphoribosylformimino-5-aminoimidazol | 81.26 | |
| PRK04169 | 232 | geranylgeranylglyceryl phosphate synthase-like pro | 81.21 | |
| PRK06559 | 290 | nicotinate-nucleotide pyrophosphorylase; Provision | 81.1 | |
| PRK08649 | 368 | inosine 5-monophosphate dehydrogenase; Validated | 81.0 | |
| PRK00278 | 260 | trpC indole-3-glycerol-phosphate synthase; Reviewe | 80.98 | |
| TIGR03572 | 232 | WbuZ glycosyl amidation-associated protein WbuZ. T | 80.94 | |
| TIGR01919 | 243 | hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosy | 80.82 | |
| PRK06978 | 294 | nicotinate-nucleotide pyrophosphorylase; Provision | 80.74 | |
| PRK06015 | 201 | keto-hydroxyglutarate-aldolase/keto-deoxy-phosphog | 80.49 | |
| cd00331 | 217 | IGPS Indole-3-glycerol phosphate synthase (IGPS); | 80.14 | |
| TIGR00007 | 230 | phosphoribosylformimino-5-aminoimidazole carboxami | 80.04 |
| >PRK05283 deoxyribose-phosphate aldolase; Provisional | Back alignment and domain information |
|---|
Probab=100.00 E-value=3.5e-35 Score=232.01 Aligned_cols=96 Identities=34% Similarity=0.581 Sum_probs=90.8
Q ss_pred hhhHHHhhCCCc-ccCCCCCCCCCCCCCCCchHHHHHHHHHHHHhhhcCCceeEeecCCCCCHHHHHHHHHHHHhhCCCC
Q psy969 3 RPRKVAFKGSNF-RTLHGRGPDSTSYGNVCNTCGIIMCSAIKHFHKLSGKKIGLKPAGGISTFEDSVRWIYLVLIMLGPD 81 (106)
Q Consensus 3 ~~~iai~aGadF-KTSTG~~~~gat~~~~~~~~v~lm~~~i~~~~~~~~~~vgiKaaGGIrt~~~a~~~i~l~~~~lGa~ 81 (106)
+|++|+++|||| ||||||++.||| +++|++|++.++++ ..++++||||||||||++||++||++++++||.+
T Consensus 152 a~~~a~~aGADFVKTSTGf~~~gAt-----~edv~lm~~~i~~~--~~~~~vgIKAsGGIrt~~~A~~~i~ag~~~lg~~ 224 (257)
T PRK05283 152 ASEIAIKAGADFIKTSTGKVPVNAT-----LEAARIMLEVIRDM--GVAKTVGFKPAGGVRTAEDAAQYLALADEILGAD 224 (257)
T ss_pred HHHHHHHhCCCEEEcCCCCCCCCCC-----HHHHHHHHHHHHhc--ccCCCeeEEccCCCCCHHHHHHHHHHHHHHhChh
Confidence 789999999999 999999999999 99999999999765 2467899999999999999999999999999999
Q ss_pred ccCCCceeEeccchHHHHHHHHhh
Q psy969 82 WLNKDLFRIGASSLLNNILQELEA 105 (106)
Q Consensus 82 w~~~~~~RiGtSs~~~~l~~~l~~ 105 (106)
|++|++||||+||++++|+++|+.
T Consensus 225 ~~~~~~fR~G~Ssll~~~~~~~~~ 248 (257)
T PRK05283 225 WADARHFRFGASSLLASLLKTLGH 248 (257)
T ss_pred hcCcccEeeehHHhHHHHHHHHhc
Confidence 999999999999999999998864
|
|
| >KOG3981|consensus | Back alignment and domain information |
|---|
| >COG0274 DeoC Deoxyribose-phosphate aldolase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >TIGR00126 deoC deoxyribose-phosphate aldolase | Back alignment and domain information |
|---|
| >PRK00507 deoxyribose-phosphate aldolase; Provisional | Back alignment and domain information |
|---|
| >cd00959 DeoC 2-deoxyribose-5-phosphate aldolase (DERA) of the DeoC family | Back alignment and domain information |
|---|
| >PF01791 DeoC: DeoC/LacD family aldolase; InterPro: IPR002915 This family includes the enzyme deoxyribose-phosphate aldolase, which is involved in nucleotide metabolism | Back alignment and domain information |
|---|
| >PRK07226 fructose-bisphosphate aldolase; Provisional | Back alignment and domain information |
|---|
| >TIGR01949 AroFGH_arch predicted phospho-2-dehydro-3-deoxyheptonate aldolase | Back alignment and domain information |
|---|
| >cd00945 Aldolase_Class_I Class I aldolases | Back alignment and domain information |
|---|
| >cd04738 DHOD_2_like Dihydroorotate dehydrogenase (DHOD) class 2 | Back alignment and domain information |
|---|
| >PRK05286 dihydroorotate dehydrogenase 2; Reviewed | Back alignment and domain information |
|---|
| >cd00958 DhnA Class I fructose-1,6-bisphosphate (FBP) aldolases of the archaeal type (DhnA homologs) found in bacteria and archaea | Back alignment and domain information |
|---|
| >cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain | Back alignment and domain information |
|---|
| >cd02940 DHPD_FMN Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain | Back alignment and domain information |
|---|
| >PRK05848 nicotinate-nucleotide pyrophosphorylase; Provisional | Back alignment and domain information |
|---|
| >PTZ00314 inosine-5'-monophosphate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >cd02809 alpha_hydroxyacid_oxid_FMN Family of homologous FMN-dependent alpha-hydroxyacid oxidizing enzymes | Back alignment and domain information |
|---|
| >cd04739 DHOD_like Dihydroorotate dehydrogenase (DHOD) like proteins | Back alignment and domain information |
|---|
| >PF04131 NanE: Putative N-acetylmannosamine-6-phosphate epimerase; InterPro: IPR007260 This family represents a putative ManNAc-6-P-to-GlcNAc-6P epimerase in the N-acetylmannosamine (ManNAc) utilization pathway found mainly in pathogenic bacteria for the reaction: |
Back alignment and domain information |
|---|
| >TIGR01036 pyrD_sub2 dihydroorotate dehydrogenase, subfamily 2 | Back alignment and domain information |
|---|
| >PF01180 DHO_dh: Dihydroorotate dehydrogenase; InterPro: IPR012135 Dihydroorotate dehydrogenase (DHOD), also known as dihydroorotate oxidase, catalyses the fourth step in de novo pyrimidine biosynthesis, the stereospecific oxidation of (S)-dihydroorotate to orotate, which is the only redox reaction in this pathway | Back alignment and domain information |
|---|
| >cd04741 DHOD_1A_like Dihydroorotate dehydrogenase (DHOD) class 1A FMN-binding domain | Back alignment and domain information |
|---|
| >PRK07565 dihydroorotate dehydrogenase 2; Reviewed | Back alignment and domain information |
|---|
| >cd00452 KDPG_aldolase KDPG and KHG aldolase | Back alignment and domain information |
|---|
| >cd03332 LMO_FMN L-Lactate 2-monooxygenase (LMO) FMN-binding domain | Back alignment and domain information |
|---|
| >cd02803 OYE_like_FMN_family Old yellow enzyme (OYE)-like FMN binding domain | Back alignment and domain information |
|---|
| >PRK07107 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PLN02826 dihydroorotate dehydrogenase | Back alignment and domain information |
|---|
| >PRK06843 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd04736 MDH_FMN Mandelate dehydrogenase (MDH)-like FMN-binding domain | Back alignment and domain information |
|---|
| >TIGR03128 RuMP_HxlA 3-hexulose-6-phosphate synthase | Back alignment and domain information |
|---|
| >PLN02535 glycolate oxidase | Back alignment and domain information |
|---|
| >PLN02274 inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >COG0167 PyrD Dihydroorotate dehydrogenase [Nucleotide transport and metabolism] | Back alignment and domain information |
|---|
| >PRK08385 nicotinate-nucleotide pyrophosphorylase; Provisional | Back alignment and domain information |
|---|
| >PRK05567 inosine 5'-monophosphate dehydrogenase; Reviewed | Back alignment and domain information |
|---|
| >PRK01130 N-acetylmannosamine-6-phosphate 2-epimerase; Provisional | Back alignment and domain information |
|---|
| >TIGR01302 IMP_dehydrog inosine-5'-monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >cd02922 FCB2_FMN Flavocytochrome b2 (FCB2) FMN-binding domain | Back alignment and domain information |
|---|
| >TIGR00736 nifR3_rel_arch TIM-barrel protein, putative | Back alignment and domain information |
|---|
| >PRK07807 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >TIGR02708 L_lactate_ox L-lactate oxidase | Back alignment and domain information |
|---|
| >TIGR01037 pyrD_sub1_fam dihydroorotate dehydrogenase (subfamily 1) family protein | Back alignment and domain information |
|---|
| >cd04737 LOX_like_FMN L-Lactate oxidase (LOX) FMN-binding domain | Back alignment and domain information |
|---|
| >cd04733 OYE_like_2_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 2 | Back alignment and domain information |
|---|
| >cd02932 OYE_YqiM_FMN Old yellow enzyme (OYE) YqjM-like FMN binding domain | Back alignment and domain information |
|---|
| >cd04729 NanE N-acetylmannosamine-6-phosphate epimerase (NanE) converts N-acetylmannosamine-6-phosphate to N-acetylglucosamine-6-phosphate | Back alignment and domain information |
|---|
| >PRK02506 dihydroorotate dehydrogenase 1A; Reviewed | Back alignment and domain information |
|---|
| >cd02801 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FMN-binding domain | Back alignment and domain information |
|---|
| >PRK07428 nicotinate-nucleotide pyrophosphorylase; Provisional | Back alignment and domain information |
|---|
| >cd00381 IMPDH IMPDH: The catalytic domain of the inosine monophosphate dehydrogenase | Back alignment and domain information |
|---|
| >cd02803 OYE_like_FMN_family Old yellow enzyme (OYE)-like FMN binding domain | Back alignment and domain information |
|---|
| >COG3010 NanE Putative N-acetylmannosamine-6-phosphate epimerase [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >cd02808 GltS_FMN Glutamate synthase (GltS) FMN-binding domain | Back alignment and domain information |
|---|
| >TIGR02151 IPP_isom_2 isopentenyl-diphosphate delta-isomerase, type 2 | Back alignment and domain information |
|---|
| >PF01729 QRPTase_C: Quinolinate phosphoribosyl transferase, C-terminal domain; InterPro: IPR002638 Quinolinate phosphoribosyl transferase (QPRTase) or nicotinate-nucleotide pyrophosphorylase 2 | Back alignment and domain information |
|---|
| >PRK05437 isopentenyl pyrophosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >cd04740 DHOD_1B_like Dihydroorotate dehydrogenase (DHOD) class 1B FMN-binding domain | Back alignment and domain information |
|---|
| >PRK08318 dihydropyrimidine dehydrogenase subunit B; Validated | Back alignment and domain information |
|---|
| >PRK08649 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PF01070 FMN_dh: FMN-dependent dehydrogenase; InterPro: IPR000262 A number of oxidoreductases that act on alpha-hydroxy acids and which are FMN-containing flavoproteins have been shown [, , ] to be structurally related | Back alignment and domain information |
|---|
| >PLN02979 glycolate oxidase | Back alignment and domain information |
|---|
| >PRK04180 pyridoxal biosynthesis lyase PdxS; Provisional | Back alignment and domain information |
|---|
| >PF01645 Glu_synthase: Conserved region in glutamate synthase; InterPro: IPR002932 Ferredoxin-dependent glutamate synthases have been implicated in a number of functions including photorespiration in Arabidopsis where they may also play a role in primary nitrogen assimilation in roots [] | Back alignment and domain information |
|---|
| >PRK07259 dihydroorotate dehydrogenase 1B; Reviewed | Back alignment and domain information |
|---|
| >cd04731 HisF The cyclase subunit of imidazoleglycerol phosphate synthase (HisF) | Back alignment and domain information |
|---|
| >PLN02495 oxidoreductase, acting on the CH-CH group of donors | Back alignment and domain information |
|---|
| >TIGR01306 GMP_reduct_2 guanosine monophosphate reductase, bacterial | Back alignment and domain information |
|---|
| >cd02911 arch_FMN Archeal FMN-binding domain | Back alignment and domain information |
|---|
| >TIGR01304 IMP_DH_rel_2 IMP dehydrogenase family protein | Back alignment and domain information |
|---|
| >PLN02493 probable peroxisomal (S)-2-hydroxy-acid oxidase | Back alignment and domain information |
|---|
| >PRK09140 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; Reviewed | Back alignment and domain information |
|---|
| >COG0106 HisA Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >cd02811 IDI-2_FMN Isopentenyl-diphosphate:dimethylallyl diphosphate isomerase type 2 (IDI-2) FMN-binding domain | Back alignment and domain information |
|---|
| >PRK05742 nicotinate-nucleotide pyrophosphorylase; Provisional | Back alignment and domain information |
|---|
| >TIGR00262 trpA tryptophan synthase, alpha subunit | Back alignment and domain information |
|---|
| >TIGR01768 GGGP-family geranylgeranylglyceryl phosphate synthase family protein | Back alignment and domain information |
|---|
| >PRK04128 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional | Back alignment and domain information |
|---|
| >COG0069 GltB Glutamate synthase domain 2 [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK07107 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PF01884 PcrB: PcrB family; InterPro: IPR008205 This entry represents geranylgeranylglyceryl phosphate (GGGP) synthase, which is a prenyltransferase that catalyses the transfer of the geranylgeranyl moiety of geranylgeranyl diphosphate (GGPP) to the C3 hydroxyl of sn-glycerol-1-phosphate (G1P) | Back alignment and domain information |
|---|
| >cd01573 modD_like ModD; Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase) present in some modABC operons in bacteria, which are involved in molybdate transport | Back alignment and domain information |
|---|
| >cd00331 IGPS Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water | Back alignment and domain information |
|---|
| >PRK07455 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional | Back alignment and domain information |
|---|
| >TIGR01303 IMP_DH_rel_1 IMP dehydrogenase family protein | Back alignment and domain information |
|---|
| >TIGR00343 pyridoxal 5'-phosphate synthase, synthase subunit Pdx1 | Back alignment and domain information |
|---|
| >cd04747 OYE_like_5_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 5 | Back alignment and domain information |
|---|
| >PRK05458 guanosine 5'-monophosphate oxidoreductase; Provisional | Back alignment and domain information |
|---|
| >PRK14024 phosphoribosyl isomerase A; Provisional | Back alignment and domain information |
|---|
| >cd04723 HisA_HisF Phosphoribosylformimino-5-aminoimidazole carboxamide ribonucleotide (ProFAR) isomerase (HisA) and the cyclase subunit of imidazoleglycerol phosphate synthase (HisF) | Back alignment and domain information |
|---|
| >PRK13523 NADPH dehydrogenase NamA; Provisional | Back alignment and domain information |
|---|
| >PRK11197 lldD L-lactate dehydrogenase; Provisional | Back alignment and domain information |
|---|
| >TIGR01769 GGGP geranylgeranylglyceryl phosphate synthase | Back alignment and domain information |
|---|
| >cd01571 NAPRTase_B Nicotinate phosphoribosyltransferase (NAPRTase), subgroup B | Back alignment and domain information |
|---|
| >PRK07028 bifunctional hexulose-6-phosphate synthase/ribonuclease regulator; Validated | Back alignment and domain information |
|---|
| >cd04722 TIM_phosphate_binding TIM barrel proteins share a structurally conserved phosphate binding motif and in general share an eight beta/alpha closed barrel structure | Back alignment and domain information |
|---|
| >PRK07896 nicotinate-nucleotide pyrophosphorylase; Provisional | Back alignment and domain information |
|---|
| >PRK00043 thiE thiamine-phosphate pyrophosphorylase; Reviewed | Back alignment and domain information |
|---|
| >PRK13587 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional | Back alignment and domain information |
|---|
| >TIGR02129 hisA_euk phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase, eukaryotic type | Back alignment and domain information |
|---|
| >PRK10605 N-ethylmaleimide reductase; Provisional | Back alignment and domain information |
|---|
| >PRK06552 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional | Back alignment and domain information |
|---|
| >TIGR00078 nadC nicotinate-nucleotide pyrophosphorylase | Back alignment and domain information |
|---|
| >cd02931 ER_like_FMN Enoate reductase (ER)-like FMN-binding domain | Back alignment and domain information |
|---|
| >PRK08227 autoinducer 2 aldolase; Validated | Back alignment and domain information |
|---|
| >cd04730 NPD_like 2-Nitropropane dioxygenase (NPD), one of the nitroalkane oxidizing enzyme families, catalyzes oxidative denitrification of nitroalkanes to their corresponding carbonyl compounds and nitrites | Back alignment and domain information |
|---|
| >PRK06852 aldolase; Validated | Back alignment and domain information |
|---|
| >cd04728 ThiG Thiazole synthase (ThiG) is the tetrameric enzyme that is involved in the formation of the thiazole moiety of thiamin pyrophosphate, an essential ubiquitous cofactor that plays an important role in carbohydrate and amino acid metabolism | Back alignment and domain information |
|---|
| >COG0107 HisF Imidazoleglycerol-phosphate synthase [Amino acid transport and metabolism] | Back alignment and domain information |
|---|
| >PRK07695 transcriptional regulator TenI; Provisional | Back alignment and domain information |
|---|
| >PRK10415 tRNA-dihydrouridine synthase B; Provisional | Back alignment and domain information |
|---|
| >PRK04302 triosephosphate isomerase; Provisional | Back alignment and domain information |
|---|
| >cd04727 pdxS PdxS is a subunit of the pyridoxal 5'-phosphate (PLP) synthase, an important enzyme in deoxyxylulose 5-phosphate (DXP)-independent pathway for de novo biosynthesis of PLP, present in some eubacteria, in archaea, fungi, plants, plasmodia, and some metazoa | Back alignment and domain information |
|---|
| >cd00956 Transaldolase_FSA Transaldolase-like fructose-6-phosphate aldolases (FSA) found in bacteria and archaea, which are member of the MipB/TalC subfamily of class I aldolases | Back alignment and domain information |
|---|
| >PRK02083 imidazole glycerol phosphate synthase subunit HisF; Provisional | Back alignment and domain information |
|---|
| >PRK14114 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional | Back alignment and domain information |
|---|
| >PRK06096 molybdenum transport protein ModD; Provisional | Back alignment and domain information |
|---|
| >PF00478 IMPDH: IMP dehydrogenase / GMP reductase domain; InterPro: IPR001093 Synonym(s): Inosine-5'-monophosphate dehydrogenase, Inosinic acid dehydrogenase; Synonym(s): Guanosine 5'-monophosphate oxidoreductase This entry contains two related enzymes IMP dehydrogenase and GMP reducatase | Back alignment and domain information |
|---|
| >cd01572 QPRTase Quinolinate phosphoribosyl transferase (QAPRTase or QPRTase), also called nicotinate-nucleotide pyrophosphorylase, is involved in the de novo synthesis of NAD in both prokaryotes and eukaryotes | Back alignment and domain information |
|---|
| >cd02812 PcrB_like PcrB_like proteins | Back alignment and domain information |
|---|
| >PRK09016 quinolinate phosphoribosyltransferase; Validated | Back alignment and domain information |
|---|
| >TIGR01334 modD putative molybdenum utilization protein ModD | Back alignment and domain information |
|---|
| >TIGR00735 hisF imidazoleglycerol phosphate synthase, cyclase subunit | Back alignment and domain information |
|---|
| >PRK09250 fructose-bisphosphate aldolase; Provisional | Back alignment and domain information |
|---|
| >TIGR03151 enACPred_II putative enoyl-(acyl-carrier-protein) reductase II | Back alignment and domain information |
|---|
| >PF00977 His_biosynth: Histidine biosynthesis protein; InterPro: IPR006062 Histidine is formed by several complex and distinct biochemical reactions catalysed by eight enzymes | Back alignment and domain information |
|---|
| >PRK08072 nicotinate-nucleotide pyrophosphorylase; Provisional | Back alignment and domain information |
|---|
| >cd04734 OYE_like_3_FMN Old yellow enzyme (OYE)-related FMN binding domain, group 3 | Back alignment and domain information |
|---|
| >PRK00748 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Validated | Back alignment and domain information |
|---|
| >cd02933 OYE_like_FMN Old yellow enzyme (OYE)-like FMN binding domain | Back alignment and domain information |
|---|
| >TIGR00693 thiE thiamine-phosphate pyrophosphorylase | Back alignment and domain information |
|---|
| >PRK13585 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase; Provisional | Back alignment and domain information |
|---|
| >PRK11750 gltB glutamate synthase subunit alpha; Provisional | Back alignment and domain information |
|---|
| >PRK00208 thiG thiazole synthase; Reviewed | Back alignment and domain information |
|---|
| >PLN02411 12-oxophytodienoate reductase | Back alignment and domain information |
|---|
| >cd02801 DUS_like_FMN Dihydrouridine synthase-like (DUS-like) FMN-binding domain | Back alignment and domain information |
|---|
| >cd02810 DHOD_DHPD_FMN Dihydroorotate dehydrogenase (DHOD) and Dihydropyrimidine dehydrogenase (DHPD) FMN-binding domain | Back alignment and domain information |
|---|
| >cd04726 KGPDC_HPS 3-Keto-L-gulonate 6-phosphate decarboxylase (KGPDC) and D-arabino-3-hexulose-6-phosphate synthase (HPS) | Back alignment and domain information |
|---|
| >cd00564 TMP_TenI Thiamine monophosphate synthase (TMP synthase)/TenI | Back alignment and domain information |
|---|
| >cd02930 DCR_FMN 2,4-dienoyl-CoA reductase (DCR) FMN-binding domain | Back alignment and domain information |
|---|
| >TIGR00875 fsa_talC_mipB fructose-6-phosphate aldolase, TalC/MipB family | Back alignment and domain information |
|---|
| >COG1646 Predicted phosphate-binding enzymes, TIM-barrel fold [General function prediction only] | Back alignment and domain information |
|---|
| >cd04731 HisF The cyclase subunit of imidazoleglycerol phosphate synthase (HisF) | Back alignment and domain information |
|---|
| >TIGR01305 GMP_reduct_1 guanosine monophosphate reductase, eukaryotic | Back alignment and domain information |
|---|
| >KOG1436|consensus | Back alignment and domain information |
|---|
| >TIGR00737 nifR3_yhdG putative TIM-barrel protein, nifR3 family | Back alignment and domain information |
|---|
| >PRK06843 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >cd04732 HisA HisA | Back alignment and domain information |
|---|
| >PRK04169 geranylgeranylglyceryl phosphate synthase-like protein; Reviewed | Back alignment and domain information |
|---|
| >PRK06559 nicotinate-nucleotide pyrophosphorylase; Provisional | Back alignment and domain information |
|---|
| >PRK08649 inosine 5-monophosphate dehydrogenase; Validated | Back alignment and domain information |
|---|
| >PRK00278 trpC indole-3-glycerol-phosphate synthase; Reviewed | Back alignment and domain information |
|---|
| >TIGR03572 WbuZ glycosyl amidation-associated protein WbuZ | Back alignment and domain information |
|---|
| >TIGR01919 hisA-trpF 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino)methylideneamino] imidazole-4-carboxamide isomerase/N-(5'phosphoribosyl)anthranilate isomerase | Back alignment and domain information |
|---|
| >PRK06978 nicotinate-nucleotide pyrophosphorylase; Provisional | Back alignment and domain information |
|---|
| >PRK06015 keto-hydroxyglutarate-aldolase/keto-deoxy-phosphogluconate aldolase; Provisional | Back alignment and domain information |
|---|
| >cd00331 IGPS Indole-3-glycerol phosphate synthase (IGPS); an enzyme in the tryptophan biosynthetic pathway, catalyzing the ring closure reaction of 1-(o-carboxyphenylamino)-1-deoxyribulose-5-phosphate (CdRP) to indole-3-glycerol phosphate (IGP), accompanied by the release of carbon dioxide and water | Back alignment and domain information |
|---|
| >TIGR00007 phosphoribosylformimino-5-aminoimidazole carboxamide ribotide isomerase | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 106 | ||||
| 1jcl_A | 260 | Observation Of Covalent Intermediates In An Enzyme | 2e-04 | ||
| 1ktn_A | 250 | Structural Genomics, Protein Ec1535 Length = 250 | 3e-04 |
| >pdb|1JCL|A Chain A, Observation Of Covalent Intermediates In An Enzyme Mechanism At Atomic Resolution Length = 260 | Back alignment and structure |
|
| >pdb|1KTN|A Chain A, Structural Genomics, Protein Ec1535 Length = 250 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 106 | |||
| 2a4a_A | 281 | Deoxyribose-phosphate aldolase; lyase, TIM beta/al | 5e-23 | |
| 1p1x_A | 260 | Deoxyribose-phosphate aldolase; alpha-beta barrel, | 2e-22 | |
| 4eiv_A | 297 | Deoxyribose-phosphate aldolase; chemotherapy, brai | 1e-18 | |
| 1vcv_A | 226 | Probable deoxyribose-phosphate aldolase; DERA, hyp | 3e-11 | |
| 3ndo_A | 231 | Deoxyribose-phosphate aldolase; ssgcid, NIH, niaid | 6e-11 | |
| 1mzh_A | 225 | Deoxyribose-phosphate aldolase; alpha-beta barrel, | 9e-09 | |
| 3oa3_A | 288 | Aldolase; structural genomics, seattle structural | 3e-08 | |
| 3ngj_A | 239 | Deoxyribose-phosphate aldolase; lyase, structural | 4e-08 | |
| 3r12_A | 260 | Deoxyribose-phosphate aldolase; TIM beta/alpha-bar | 7e-08 | |
| 1n7k_A | 234 | Deoxyribose-phosphate aldolase; A.pernix, tetramer | 2e-07 | |
| 1ub3_A | 220 | Aldolase protein; schiff base, deoxyribose phospha | 9e-07 |
| >2a4a_A Deoxyribose-phosphate aldolase; lyase, TIM beta/alpha barrel, DEOC, DERA, structur genomics, structural genomics consortium, SGC; 1.84A {Plasmodium yoelii yoelii} SCOP: c.1.10.1 Length = 281 | Back alignment and structure |
|---|
Score = 89.0 bits (221), Expect = 5e-23
Identities = 23/71 (32%), Positives = 35/71 (49%), Gaps = 3/71 (4%)
Query: 37 IMCSAIKHF---HKLSGKKIGLKPAGGISTFEDSVRWIYLVLIMLGPDWLNKDLFRIGAS 93
+ AIK + + KIGLK +GGIS + +I L L + D FRIG+S
Sbjct: 207 YIIKAIKEYIKNNPEKNNKIGLKVSGGISDLNTASHYILLARRFLSSLACHPDNFRIGSS 266
Query: 94 SLLNNILQELE 104
SL+ + + +
Sbjct: 267 SLVIKLRKVIS 277
|
| >1p1x_A Deoxyribose-phosphate aldolase; alpha-beta barrel, TIM barrel, lyase; 0.99A {Escherichia coli} SCOP: c.1.10.1 PDB: 1jcl_A 1jcj_A* 1ktn_A 3npv_B 3npu_A 3npw_A 3nq2_A 3npx_A 3nq8_A 3q2d_A* 3nr0_A 3nqv_A Length = 260 | Back alignment and structure |
|---|
| >4eiv_A Deoxyribose-phosphate aldolase; chemotherapy, brain cysts, bradyzoite, structural genomics, for structural genomics of infectious diseases; 1.37A {Toxoplasma gondii} PDB: 3qyq_A* Length = 297 | Back alignment and structure |
|---|
| >1vcv_A Probable deoxyribose-phosphate aldolase; DERA, hyperthermophIle, archaea, lyase; 2.00A {Pyrobaculum aerophilum} SCOP: c.1.10.1 Length = 226 | Back alignment and structure |
|---|
| >3ndo_A Deoxyribose-phosphate aldolase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography; HET: GOL; 1.25A {Mycobacterium smegmatis} PDB: 3ng3_A Length = 231 | Back alignment and structure |
|---|
| >1mzh_A Deoxyribose-phosphate aldolase; alpha-beta barrel, structural genomics, PSI, protein structure initiative; 2.00A {Aquifex aeolicus} SCOP: c.1.10.1 Length = 225 | Back alignment and structure |
|---|
| >3oa3_A Aldolase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, pathogenic fungus; 1.60A {Coccidioides immitis} Length = 288 | Back alignment and structure |
|---|
| >3ngj_A Deoxyribose-phosphate aldolase; lyase, structural genomics, structural genomics center for infectious disease, ssgcid; 1.70A {Entamoeba histolytica} Length = 239 | Back alignment and structure |
|---|
| >3r12_A Deoxyribose-phosphate aldolase; TIM beta/alpha-barrel, structural genomics, joint center for structural genomics, JCSG; HET: MSE CIT; 1.75A {Thermotoga maritima} PDB: 1o0y_A* 3r13_A* Length = 260 | Back alignment and structure |
|---|
| >1n7k_A Deoxyribose-phosphate aldolase; A.pernix, tetramer, alpha-beta TIM barrel, riken S genomics/proteomics initiative, RSGI, structural genomics,; 2.00A {Aeropyrum pernix} SCOP: c.1.10.1 Length = 234 | Back alignment and structure |
|---|
| >1ub3_A Aldolase protein; schiff base, deoxyribose phosphate, carbinolamine, structural genomics, riken structural genomics/proteomics initiative; HET: HPD; 1.40A {Thermus thermophilus} SCOP: c.1.10.1 PDB: 1j2w_A* Length = 220 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 106 | |||
| 1p1x_A | 260 | Deoxyribose-phosphate aldolase; alpha-beta barrel, | 100.0 | |
| 2a4a_A | 281 | Deoxyribose-phosphate aldolase; lyase, TIM beta/al | 100.0 | |
| 4eiv_A | 297 | Deoxyribose-phosphate aldolase; chemotherapy, brai | 100.0 | |
| 1vcv_A | 226 | Probable deoxyribose-phosphate aldolase; DERA, hyp | 99.94 | |
| 3r12_A | 260 | Deoxyribose-phosphate aldolase; TIM beta/alpha-bar | 99.92 | |
| 3ndo_A | 231 | Deoxyribose-phosphate aldolase; ssgcid, NIH, niaid | 99.92 | |
| 3oa3_A | 288 | Aldolase; structural genomics, seattle structural | 99.91 | |
| 3ngj_A | 239 | Deoxyribose-phosphate aldolase; lyase, structural | 99.91 | |
| 1ub3_A | 220 | Aldolase protein; schiff base, deoxyribose phospha | 99.9 | |
| 1n7k_A | 234 | Deoxyribose-phosphate aldolase; A.pernix, tetramer | 99.87 | |
| 1mzh_A | 225 | Deoxyribose-phosphate aldolase; alpha-beta barrel, | 99.67 | |
| 1w8s_A | 263 | FBP aldolase, fructose-bisphosphate aldolase class | 98.83 | |
| 1qap_A | 296 | Quinolinic acid phosphoribosyltransferase; glycosy | 98.01 | |
| 2b7n_A | 273 | Probable nicotinate-nucleotide pyrophosphorylase; | 97.77 | |
| 2jbm_A | 299 | Nicotinate-nucleotide pyrophosphorylase; NAD, enzy | 97.7 | |
| 3c2e_A | 294 | Nicotinate-nucleotide pyrophosphorylase; qprtase, | 97.44 | |
| 1yxy_A | 234 | Putative N-acetylmannosamine-6-phosphate 2-epimer; | 97.42 | |
| 3glc_A | 295 | Aldolase LSRF; TIM barrel, lyase, schiff base; HET | 97.27 | |
| 1f76_A | 336 | Dihydroorotate dehydrogenase; monomer, alpha-beta- | 97.15 | |
| 2qjg_A | 273 | Putative aldolase MJ0400; beta-alpha barrel, lyase | 96.83 | |
| 3zwt_A | 367 | Dihydroorotate dehydrogenase (quinone), mitochond; | 96.69 | |
| 1jub_A | 311 | Dihydroorotate dehydrogenase A; homodimer, alpha-b | 96.54 | |
| 3sgz_A | 352 | Hydroxyacid oxidase 2; flavoprotein, homology, INH | 96.41 | |
| 3khj_A | 361 | Inosine-5-monophosphate dehydrogenase; enzyme-inhi | 96.32 | |
| 3i65_A | 415 | Dihydroorotate dehydrogenase homolog, mitochondria | 96.22 | |
| 2nzl_A | 392 | Hydroxyacid oxidase 1; HAOX1, glycolate oxidase, G | 96.22 | |
| 2e6f_A | 314 | Dihydroorotate dehydrogenase; chagas disease, pyri | 96.21 | |
| 1me8_A | 503 | Inosine-5'-monophosphate dehydrogenase; alpha beta | 96.11 | |
| 1vrd_A | 494 | Inosine-5'-monophosphate dehydrogenase; TM1347, st | 96.08 | |
| 2nli_A | 368 | Lactate oxidase; flavoenzyme, FMN, D-lactate, oxid | 96.02 | |
| 2qr6_A | 393 | IMP dehydrogenase/GMP reductase; NP_599840.1, G re | 95.95 | |
| 1vcf_A | 332 | Isopentenyl-diphosphate delta-isomerase; TIM barre | 95.74 | |
| 1tv5_A | 443 | Dhodehase, dihydroorotate dehydrogenase homolog, m | 95.71 | |
| 3ffs_A | 400 | Inosine-5-monophosphate dehydrogenase; beta-alpha | 95.59 | |
| 1gox_A | 370 | (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoredu | 95.42 | |
| 1ep3_A | 311 | Dihydroorotate dehydrogenase B (PYRD subunit); het | 95.3 | |
| 2c6q_A | 351 | GMP reductase 2; TIM barrel, metal-binding, NADP, | 95.22 | |
| 4fo4_A | 366 | Inosine 5'-monophosphate dehydrogenase; structural | 95.14 | |
| 1y0e_A | 223 | Putative N-acetylmannosamine-6-phosphate 2-epimer; | 95.09 | |
| 3f4w_A | 211 | Putative hexulose 6 phosphate synthase; humps, mal | 95.05 | |
| 1zfj_A | 491 | Inosine monophosphate dehydrogenase; IMPDH, CBS do | 95.03 | |
| 1ypf_A | 336 | GMP reductase; GUAC, purines, pyrimidines, nucleos | 94.96 | |
| 3vk5_A | 286 | MOEO5; TIM barrel, transferase; HET: FPQ; 1.39A {S | 94.94 | |
| 3igs_A | 232 | N-acetylmannosamine-6-phosphate 2-epimerase 2; ene | 94.62 | |
| 1eep_A | 404 | Inosine 5'-monophosphate dehydrogenase; alpha-beta | 94.51 | |
| 3oix_A | 345 | Putative dihydroorotate dehydrogenase; dihydrooro | 94.48 | |
| 4avf_A | 490 | Inosine-5'-monophosphate dehydrogenase; oxidoreduc | 94.44 | |
| 3q58_A | 229 | N-acetylmannosamine-6-phosphate 2-epimerase; TIM b | 94.39 | |
| 3r2g_A | 361 | Inosine 5'-monophosphate dehydrogenase; structural | 94.27 | |
| 1kbi_A | 511 | Cytochrome B2, L-LCR; flavocytochrome B2, electron | 94.16 | |
| 4fxs_A | 496 | Inosine-5'-monophosphate dehydrogenase; structural | 94.06 | |
| 1jcn_A | 514 | Inosine monophosphate dehydrogenase I; IMPD, IMPDH | 93.93 | |
| 1p0k_A | 349 | Isopentenyl-diphosphate delta-isomerase; terpene b | 93.8 | |
| 3usb_A | 511 | Inosine-5'-monophosphate dehydrogenase; structural | 93.72 | |
| 3vkj_A | 368 | Isopentenyl-diphosphate delta-isomerase; type 2 is | 93.54 | |
| 1z41_A | 338 | YQJM, probable NADH-dependent flavin oxidoreductas | 93.25 | |
| 1p4c_A | 380 | L(+)-mandelate dehydrogenase; TIM barrel, hydroxy | 93.1 | |
| 1h5y_A | 253 | HISF; histidine biosynthesis, TIM-barrel; 2.0A {Py | 92.65 | |
| 2nv1_A | 305 | Pyridoxal biosynthesis lyase PDXS; (beta/alpha)8-b | 92.37 | |
| 3b0p_A | 350 | TRNA-dihydrouridine synthase; TIM barrel, oxidored | 92.29 | |
| 3sr7_A | 365 | Isopentenyl-diphosphate delta-isomerase; isopenten | 92.26 | |
| 2p10_A | 286 | MLL9387 protein; putative phosphonopyruvate hydrol | 91.54 | |
| 1vyr_A | 364 | Pentaerythritol tetranitrate reductase; oxidoreduc | 91.48 | |
| 1icp_A | 376 | OPR1, 12-oxophytodienoate reductase 1; beta-alpha- | 91.26 | |
| 3qja_A | 272 | IGPS, indole-3-glycerol phosphate synthase; struct | 91.03 | |
| 1xm3_A | 264 | Thiazole biosynthesis protein THIG; structural gen | 91.01 | |
| 4ef8_A | 354 | Dihydroorotate dehydrogenase; phenyl isothiocyanat | 90.77 | |
| 1gte_A | 1025 | Dihydropyrimidine dehydrogenase; electron transfer | 90.63 | |
| 3hgj_A | 349 | Chromate reductase; TIM barrel, oxidoreductase; HE | 90.5 | |
| 3l5a_A | 419 | NADH/flavin oxidoreductase/NADH oxidase; OLD yello | 90.2 | |
| 2zbt_A | 297 | Pyridoxal biosynthesis lyase PDXS; pyridoxine bios | 90.16 | |
| 3tqv_A | 287 | Nicotinate-nucleotide pyrophosphorylase; glycosylt | 90.01 | |
| 3tsm_A | 272 | IGPS, indole-3-glycerol phosphate synthase; struct | 89.94 | |
| 3gr7_A | 340 | NADPH dehydrogenase; flavin, FMN, beta-alpha-barre | 89.93 | |
| 1yad_A | 221 | Regulatory protein TENI; TIM barrel, transcription | 89.88 | |
| 3gr7_A | 340 | NADPH dehydrogenase; flavin, FMN, beta-alpha-barre | 89.85 | |
| 3tdn_A | 247 | FLR symmetric alpha-beta TIM barrel; symmetric sup | 89.71 | |
| 3l0g_A | 300 | Nicotinate-nucleotide pyrophosphorylase; ssgcid, N | 89.52 | |
| 2r14_A | 377 | Morphinone reductase; H-tunnelling, flavoprotein, | 88.74 | |
| 1ka9_F | 252 | Imidazole glycerol phosphtate synthase; riken stru | 88.65 | |
| 1vzw_A | 244 | Phosphoribosyl isomerase A; histidine biosynthesis | 88.59 | |
| 1qpo_A | 284 | Quinolinate acid phosphoribosyl transferase; type | 88.15 | |
| 1x1o_A | 286 | Nicotinate-nucleotide pyrophosphorylase; transfera | 88.11 | |
| 3tjx_A | 354 | Dihydroorotate dehydrogenase; PYRD, dhodh, lmdhodh | 87.61 | |
| 4adt_A | 297 | Pyridoxine biosynthetic enzyme PDX1 homologue, PU; | 87.08 | |
| 1ea0_A | 1479 | Glutamate synthase [NADPH] large chain; oxidoreduc | 87.0 | |
| 1z41_A | 338 | YQJM, probable NADH-dependent flavin oxidoreductas | 86.87 | |
| 1ps9_A | 671 | 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel | 86.54 | |
| 3bo9_A | 326 | Putative nitroalkan dioxygenase; TM0800, structura | 86.46 | |
| 3l5l_A | 363 | Xenobiotic reductase A; TIM barrel, oxidoreductase | 86.33 | |
| 3l5l_A | 363 | Xenobiotic reductase A; TIM barrel, oxidoreductase | 86.32 | |
| 3hgj_A | 349 | Chromate reductase; TIM barrel, oxidoreductase; HE | 86.28 | |
| 3gka_A | 361 | N-ethylmaleimide reductase; decode biostructures, | 86.11 | |
| 1xi3_A | 215 | Thiamine phosphate pyrophosphorylase; structural g | 86.0 | |
| 4ab4_A | 362 | Xenobiotic reductase B; oxidoreductase, OLD yellow | 85.74 | |
| 3bw2_A | 369 | 2-nitropropane dioxygenase; TIM barrel, oxidoreduc | 85.72 | |
| 2gjl_A | 328 | Hypothetical protein PA1024; 2-nitropropane dioxyg | 85.71 | |
| 3nav_A | 271 | Tryptophan synthase alpha chain; alpha subunit, st | 85.63 | |
| 2y88_A | 244 | Phosphoribosyl isomerase A; aromatic amino acid bi | 85.42 | |
| 1rvk_A | 382 | Isomerase/lactonizing enzyme; enolase superfamily, | 85.15 | |
| 2gou_A | 365 | Oxidoreductase, FMN-binding; OLD yeallow enzyme, f | 85.08 | |
| 4e38_A | 232 | Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho | 84.96 | |
| 1o4u_A | 285 | Type II quinolic acid phosphoribosyltransferase; s | 84.86 | |
| 2yw3_A | 207 | 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deox | 84.78 | |
| 2z6i_A | 332 | Trans-2-enoyl-ACP reductase II; fatty acid synthes | 84.57 | |
| 2tps_A | 227 | Protein (thiamin phosphate synthase); thiamin bios | 84.5 | |
| 3gnn_A | 298 | Nicotinate-nucleotide pyrophosphorylase; decode bi | 84.49 | |
| 2w6r_A | 266 | Imidazole glycerol phosphate synthase subunit HISF | 84.34 | |
| 4gj1_A | 243 | 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) me | 84.24 | |
| 1ofd_A | 1520 | Ferredoxin-dependent glutamate synthase 2; oxidore | 84.19 | |
| 2y88_A | 244 | Phosphoribosyl isomerase A; aromatic amino acid bi | 83.59 | |
| 3paj_A | 320 | Nicotinate-nucleotide pyrophosphorylase, carboxyl; | 83.51 | |
| 1thf_D | 253 | HISF protein; thermophIle, TIM-barrel, histidine b | 83.34 | |
| 3k30_A | 690 | Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP bi | 82.79 | |
| 3kru_A | 343 | NADH:flavin oxidoreductase/NADH oxidase; homotetra | 82.78 | |
| 3lab_A | 217 | Putative KDPG (2-keto-3-deoxy-6-phosphogluconate) | 82.72 | |
| 1wv2_A | 265 | Thiazole moeity, thiazole biosynthesis protein THI | 81.45 | |
| 4af0_A | 556 | Inosine-5'-monophosphate dehydrogenase; oxidoreduc | 81.3 | |
| 1qo2_A | 241 | Molecule: N-((5-phosphoribosyl)-formimino)-5-amino | 81.04 | |
| 1to3_A | 304 | Putative aldolase YIHT; beta-alpha barrel, structu | 80.89 | |
| 2czd_A | 208 | Orotidine 5'-phosphate decarboxylase; pyrimidine b | 80.87 | |
| 1vhc_A | 224 | Putative KHG/KDPG aldolase; structural genomics, u | 80.69 | |
| 3tdn_A | 247 | FLR symmetric alpha-beta TIM barrel; symmetric sup | 80.62 |
| >1p1x_A Deoxyribose-phosphate aldolase; alpha-beta barrel, TIM barrel, lyase; 0.99A {Escherichia coli} SCOP: c.1.10.1 PDB: 1jcl_A 1jcj_A* 1ktn_A 3npv_B 3npu_A 3npw_A 3nq2_A 3npx_A 3nq8_A 3q2d_A* 3nr0_A 3nqv_A | Back alignment and structure |
|---|
Probab=100.00 E-value=2.7e-33 Score=219.48 Aligned_cols=96 Identities=30% Similarity=0.548 Sum_probs=91.4
Q ss_pred hhhHHHhhCCCc-ccCCCCCCCCCCCCCCCchHHHHHHHHHHHHhhhcCCceeEeecCCCCCHHHHHHHHHHHHhhCCCC
Q psy969 3 RPRKVAFKGSNF-RTLHGRGPDSTSYGNVCNTCGIIMCSAIKHFHKLSGKKIGLKPAGGISTFEDSVRWIYLVLIMLGPD 81 (106)
Q Consensus 3 ~~~iai~aGadF-KTSTG~~~~gat~~~~~~~~v~lm~~~i~~~~~~~~~~vgiKaaGGIrt~~~a~~~i~l~~~~lGa~ 81 (106)
+|++|+++|||| ||||||.++||| +++|++|++.|++|+ ++.+++||+||||||++||++|+++..+++|++
T Consensus 155 a~~ia~eaGADfVKTSTGf~~~gAt-----~e~v~lm~~~I~~~~--~g~~v~VKaaGGIrt~~~al~~i~aga~~lG~~ 227 (260)
T 1p1x_A 155 ASEISIKAGADFIKTSTGKVAVNAT-----PESARIMMEVIRDMG--VEKTVGFKPAGGVRTAEDAQKYLAIADELFGAD 227 (260)
T ss_dssp HHHHHHHTTCSEEECCCSCSSCCCC-----HHHHHHHHHHHHHHT--CTTTCEEECBSSCCSHHHHHHHHHHHHHHHCTT
T ss_pred HHHHHHHhCCCEEEeCCCCCCCCCC-----HHHHHHHHHHHHHhc--CCCCceEEEeCCCCCHHHHHHHHHhhhhhcccc
Confidence 799999999999 999999999999 999999999999885 578999999999999999999999999999999
Q ss_pred ccCCCceeEeccchHHHHHHHHhh
Q psy969 82 WLNKDLFRIGASSLLNNILQELEA 105 (106)
Q Consensus 82 w~~~~~~RiGtSs~~~~l~~~l~~ 105 (106)
|++|++||||+|+++++|+++|+.
T Consensus 228 w~~~~~~RiGtS~~~~~i~~~~~~ 251 (260)
T 1p1x_A 228 WADARHYRFGASSLLASLLKALGH 251 (260)
T ss_dssp SCSTTTBCEEESTHHHHHHHHHTC
T ss_pred ccccCceEeecchhHHHHHHHhcc
Confidence 999999999999999988888753
|
| >2a4a_A Deoxyribose-phosphate aldolase; lyase, TIM beta/alpha barrel, DEOC, DERA, structur genomics, structural genomics consortium, SGC; 1.84A {Plasmodium yoelii yoelii} SCOP: c.1.10.1 | Back alignment and structure |
|---|
| >4eiv_A Deoxyribose-phosphate aldolase; chemotherapy, brain cysts, bradyzoite, structural genomics, for structural genomics of infectious diseases; 1.37A {Toxoplasma gondii} PDB: 3qyq_A* | Back alignment and structure |
|---|
| >1vcv_A Probable deoxyribose-phosphate aldolase; DERA, hyperthermophIle, archaea, lyase; 2.00A {Pyrobaculum aerophilum} SCOP: c.1.10.1 | Back alignment and structure |
|---|
| >3r12_A Deoxyribose-phosphate aldolase; TIM beta/alpha-barrel, structural genomics, joint center for structural genomics, JCSG; HET: MSE CIT; 1.75A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1o0y_A* 3r13_A* | Back alignment and structure |
|---|
| >3ndo_A Deoxyribose-phosphate aldolase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography; HET: GOL; 1.25A {Mycobacterium smegmatis} PDB: 3ng3_A | Back alignment and structure |
|---|
| >3oa3_A Aldolase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, pathogenic fungus; 1.60A {Coccidioides immitis} | Back alignment and structure |
|---|
| >3ngj_A Deoxyribose-phosphate aldolase; lyase, structural genomics, structural genomics center for infectious disease, ssgcid; 1.70A {Entamoeba histolytica} | Back alignment and structure |
|---|
| >1ub3_A Aldolase protein; schiff base, deoxyribose phosphate, carbinolamine, structural genomics, riken structural genomics/proteomics initiative; HET: HPD; 1.40A {Thermus thermophilus} SCOP: c.1.10.1 PDB: 1j2w_A* | Back alignment and structure |
|---|
| >1n7k_A Deoxyribose-phosphate aldolase; A.pernix, tetramer, alpha-beta TIM barrel, riken S genomics/proteomics initiative, RSGI, structural genomics,; 2.00A {Aeropyrum pernix} SCOP: c.1.10.1 | Back alignment and structure |
|---|
| >1mzh_A Deoxyribose-phosphate aldolase; alpha-beta barrel, structural genomics, PSI, protein structure initiative; 2.00A {Aquifex aeolicus} SCOP: c.1.10.1 | Back alignment and structure |
|---|
| >1w8s_A FBP aldolase, fructose-bisphosphate aldolase class I; TIM barrel, glycolytic, archaeal, catalytic mechanism, reaction intermediate, lyase; HET: FBP; 1.85A {Thermoproteus tenax} SCOP: c.1.10.1 PDB: 1w8r_A* 2yce_A* 1ojx_A 1ok4_A 1ok6_A | Back alignment and structure |
|---|
| >1qap_A Quinolinic acid phosphoribosyltransferase; glycosyltransferase, NAD biosynthesis; HET: NTM; 2.80A {Salmonella typhimurium} SCOP: c.1.17.1 d.41.2.1 | Back alignment and structure |
|---|
| >2b7n_A Probable nicotinate-nucleotide pyrophosphorylase; quinolinate phosphoribosyltransferase, quinolinic acid, HELI pylori, transferase; HET: NTM; 2.30A {Helicobacter pylori} PDB: 2b7p_A* 2b7q_A* | Back alignment and structure |
|---|
| >2jbm_A Nicotinate-nucleotide pyrophosphorylase; NAD, enzyme, metabolism, transferase, polymorphism, glycosyltransferase, pyridine nucleotide biosynthesis; HET: SRT; 2.0A {Homo sapiens} PDB: 3lar_A | Back alignment and structure |
|---|
| >3c2e_A Nicotinate-nucleotide pyrophosphorylase; qprtase, prtase, BNA6, mechanism, cytoplasm, glycosyltransferase, nucleus; 1.90A {Saccharomyces cerevisiae} PDB: 3c2f_A* 3c2o_A* 3c2v_A* 3c2r_A* | Back alignment and structure |
|---|
| >1yxy_A Putative N-acetylmannosamine-6-phosphate 2-epimer; structural genomics, epimerase, PSI, structure initiative; 1.60A {Streptococcus pyogenes} SCOP: c.1.2.5 | Back alignment and structure |
|---|
| >3glc_A Aldolase LSRF; TIM barrel, lyase, schiff base; HET: R5P; 2.50A {Escherichia coli} PDB: 3gnd_A* 3gkf_O | Back alignment and structure |
|---|
| >1f76_A Dihydroorotate dehydrogenase; monomer, alpha-beta-barrel, FMN binding domain, orotate complex, oxidoreductase; HET: MSE FMN ORO; 2.50A {Bacteria} SCOP: c.1.4.1 | Back alignment and structure |
|---|
| >2qjg_A Putative aldolase MJ0400; beta-alpha barrel, lyase; HET: F2P; 2.60A {Methanocaldococcus jannaschii} PDB: 2qjh_A 2qji_A | Back alignment and structure |
|---|
| >3zwt_A Dihydroorotate dehydrogenase (quinone), mitochond; oxidoreductase; HET: FMN ORO KFZ; 1.55A {Homo sapiens} PDB: 1d3h_A* 2bxv_A* 2prh_A* 2prl_A* 2prm_A* 3f1q_A* 3fj6_A* 3fjl_A* 3g0u_A* 3g0x_A* 3zws_A* 1d3g_A* 3u2o_A* 2fpv_A* 2fpt_A* 2fpy_A* 2fqi_A* 3kvl_A* 3kvk_A* 3kvj_A* ... | Back alignment and structure |
|---|
| >1jub_A Dihydroorotate dehydrogenase A; homodimer, alpha-beta barrel, flavoprotein, mutant enzyme, oxidoreductase; HET: FMN; 1.40A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ovd_A* 1jue_A* 1dor_A* 2bsl_A* 2bx7_A* 2dor_A* 1jqv_A* 1jrb_A* 1jrc_A* 1jqx_A* | Back alignment and structure |
|---|
| >3sgz_A Hydroxyacid oxidase 2; flavoprotein, homology, INH oxidoreductase-oxidoreductase inhibitor complex; HET: FMN HO6; 1.35A {Rattus norvegicus} PDB: 1tb3_A* | Back alignment and structure |
|---|
| >3khj_A Inosine-5-monophosphate dehydrogenase; enzyme-inhibitor complex, oxidoreductase; HET: IMP C64; 2.80A {Cryptosporidium parvum} | Back alignment and structure |
|---|
| >3i65_A Dihydroorotate dehydrogenase homolog, mitochondrial; triazolopyrimidine,inhibitor, DSM1, FAD, flavoprotein, membrane, mitochondrion; HET: JZ8 FMN ORO LDA; 2.00A {Plasmodium falciparum 3D7} PDB: 3i68_A* 3i6r_A* 3o8a_A* 3sfk_A* | Back alignment and structure |
|---|
| >2nzl_A Hydroxyacid oxidase 1; HAOX1, glycolate oxidase, GOX, GOX1, structural genomics, structural genom consortium, SGC, oxidoreductase; HET: FMN; 1.35A {Homo sapiens} PDB: 2rdu_A* 2rdt_A* 2rdw_A* 2w0u_A* | Back alignment and structure |
|---|
| >2e6f_A Dihydroorotate dehydrogenase; chagas disease, pyrimidine biosynthesis, fumarate reductase, energy metabolism, redox homeostasis, flavoprotein; HET: FMN OXC; 1.26A {Trypanosoma cruzi} PDB: 2e6a_A* 2e6d_A* 2e68_A* 2djl_A* 2djx_A* 3c3n_A* 2b4g_A* 3c61_A* 3mhu_A* 3mjy_A* | Back alignment and structure |
|---|
| >1me8_A Inosine-5'-monophosphate dehydrogenase; alpha beta barrel, oxidoreductase; HET: RVP; 1.90A {Tritrichomonas foetus} SCOP: c.1.5.1 PDB: 1ak5_A* 1me7_A* 1me9_A* 1meh_A* 1mei_A* 1mew_A* 1pvn_A* 1lrt_A* | Back alignment and structure |
|---|
| >1vrd_A Inosine-5'-monophosphate dehydrogenase; TM1347, structural G joint center for structural genomics, JCSG, protein structu initiative, PSI; 2.18A {Thermotoga maritima} SCOP: c.1.5.1 | Back alignment and structure |
|---|
| >2nli_A Lactate oxidase; flavoenzyme, FMN, D-lactate, oxidoreducta; HET: FMN; 1.59A {Aerococcus viridans} PDB: 2zfa_A* 2du2_A* 2e77_A* 2j6x_A* | Back alignment and structure |
|---|
| >2qr6_A IMP dehydrogenase/GMP reductase; NP_599840.1, G reductase domain, structural genomics, joint center for STR genomics, JCSG; HET: MSE; 1.50A {Corynebacterium glutamicum atcc 13032} | Back alignment and structure |
|---|
| >1vcf_A Isopentenyl-diphosphate delta-isomerase; TIM barrel, structural genomics, riken structural genomics/P initiative, RSGI; HET: FMN; 2.60A {Thermus thermophilus} SCOP: c.1.4.1 PDB: 1vcg_A* 3dh7_A* | Back alignment and structure |
|---|
| >1tv5_A Dhodehase, dihydroorotate dehydrogenase homolog, mitochondri, dihydroorotate; alpha-beta barrel, TIM barrel, oxidoreductase; HET: A26 FMN ORO N8E; 2.40A {Plasmodium falciparum} SCOP: c.1.4.1 | Back alignment and structure |
|---|
| >3ffs_A Inosine-5-monophosphate dehydrogenase; beta-alpha barrel, TIM fold, oxidoreductase; 3.19A {Cryptosporidium parvum} | Back alignment and structure |
|---|
| >1gox_A (S)-2-hydroxy-acid oxidase, peroxisomal; oxidoreductase (oxygen(A)); HET: FMN; 2.00A {Spinacia oleracea} SCOP: c.1.4.1 PDB: 1gyl_A* 1al8_A* 1al7_A* 2cdh_0 | Back alignment and structure |
|---|
| >1ep3_A Dihydroorotate dehydrogenase B (PYRD subunit); heterotetramer, alpha-beta barrel, beta sandwich, FAD domain alpha/beta NADP domain; HET: FMN FAD; 2.10A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ep2_A* 1ep1_A* | Back alignment and structure |
|---|
| >2c6q_A GMP reductase 2; TIM barrel, metal-binding, NADP, oxidoreductase, potassium; HET: IMP NDP; 1.70A {Homo sapiens} PDB: 2bzn_A* 2a7r_A* 2ble_A* 2bwg_A* | Back alignment and structure |
|---|
| >4fo4_A Inosine 5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.03A {Vibrio cholerae o1 biovar el tor} PDB: 4ff0_A* 4hlv_A* 4fez_A | Back alignment and structure |
|---|
| >1y0e_A Putative N-acetylmannosamine-6-phosphate 2-epimer; mannac-6-P epimerase, NANE, structural genomics, protein STR initiative, PSI; 1.95A {Staphylococcus aureus subsp} SCOP: c.1.2.5 | Back alignment and structure |
|---|
| >3f4w_A Putative hexulose 6 phosphate synthase; humps, malonate, lyase; 1.65A {Salmonella typhimurium} SCOP: c.1.2.0 | Back alignment and structure |
|---|
| >1zfj_A Inosine monophosphate dehydrogenase; IMPDH, CBS domains, oxidoreductase; HET: IMP; 1.90A {Streptococcus pyogenes} SCOP: c.1.5.1 d.37.1.1 | Back alignment and structure |
|---|
| >1ypf_A GMP reductase; GUAC, purines, pyrimidines, nucleosides, nucleotides, nucleo nucleoside interconversions, spine, structural genomics; 1.80A {Bacillus anthracis} PDB: 2a1y_A* | Back alignment and structure |
|---|
| >3vk5_A MOEO5; TIM barrel, transferase; HET: FPQ; 1.39A {Streptomyces ghanaensis} PDB: 3vka_A* 3vkb_A* 3vkc_A* 3vkd_A* | Back alignment and structure |
|---|
| >3igs_A N-acetylmannosamine-6-phosphate 2-epimerase 2; energy metabolism, sugars, csgid, carbohydrate metabolism, isomerase; HET: MSE 16G; 1.50A {Salmonella enterica subsp} SCOP: c.1.2.0 | Back alignment and structure |
|---|
| >1eep_A Inosine 5'-monophosphate dehydrogenase; alpha-beta barrel, TIM barrel, IMPDH, IMP dehydrogenase, LOO purine biosynthesis, oxidoreductase; 2.40A {Borrelia burgdorferi} SCOP: c.1.5.1 | Back alignment and structure |
|---|
| >3oix_A Putative dihydroorotate dehydrogenase; dihydrooro oxidase; TIM barrel, oxidoreductase; HET: MLY FMN; 2.40A {Streptococcus mutans} | Back alignment and structure |
|---|
| >4avf_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase; 2.23A {Pseudomonas aeruginosa} | Back alignment and structure |
|---|
| >3q58_A N-acetylmannosamine-6-phosphate 2-epimerase; TIM beta/alpha barrel, ribulose-phosphate binding barrel, carbohydrate metabolic process; HET: BTB; 1.80A {Salmonella enterica subsp} | Back alignment and structure |
|---|
| >3r2g_A Inosine 5'-monophosphate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.94A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >1kbi_A Cytochrome B2, L-LCR; flavocytochrome B2, electron transfer, oxidoreductase; HET: HEM FMN; 2.30A {Saccharomyces cerevisiae} SCOP: c.1.4.1 d.120.1.1 PDB: 1fcb_A* 1lco_A* 1ldc_A* 1sze_A* 2oz0_A* 1szf_A* 1szg_A* 1ltd_A* 1kbj_A* 1qcw_A* 3ks0_A* | Back alignment and structure |
|---|
| >4fxs_A Inosine-5'-monophosphate dehydrogenase; structural genomics, IMPDH, IMP, mycophenolic acid, MOA; HET: IMP MOA; 2.24A {Vibrio cholerae o1 biovar el tor} | Back alignment and structure |
|---|
| >1jcn_A Inosine monophosphate dehydrogenase I; IMPD, IMPDH, guanine nucleotide synthesis, oxidoreductase; HET: CPR; 2.50A {Homo sapiens} SCOP: c.1.5.1 d.37.1.1 PDB: 1jr1_A* 1nf7_A* 1b3o_A* 1nfb_A* | Back alignment and structure |
|---|
| >1p0k_A Isopentenyl-diphosphate delta-isomerase; terpene biosynthesis, dimethylallyl diphosphate, flavoprotein; 1.90A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1p0n_A* | Back alignment and structure |
|---|
| >3usb_A Inosine-5'-monophosphate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid, TIM barrel, CBS-domain; HET: MSE IMP; 2.38A {Bacillus anthracis} PDB: 3tsd_A* 3tsb_A* | Back alignment and structure |
|---|
| >3vkj_A Isopentenyl-diphosphate delta-isomerase; type 2 isopentenyl diphosphate isomerase; HET: FNR; 1.70A {Sulfolobus shibatae} PDB: 2zrv_A* 2zrw_A* 2zrx_A* 2zry_A* 2zrz_A* 3b03_A* 3b04_A* 3b05_A* 3b06_A* 2zru_A* | Back alignment and structure |
|---|
| >1z41_A YQJM, probable NADH-dependent flavin oxidoreductase YQJ; FMN, beta-alpha-barrel; HET: FMN; 1.30A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1z42_A* 1z44_A* 1z48_A* | Back alignment and structure |
|---|
| >1p4c_A L(+)-mandelate dehydrogenase; TIM barrel, hydroxy acid oxidizing enzyme, oxidoreductase; HET: FMN MES; 1.35A {Pseudomonas putida} SCOP: c.1.4.1 PDB: 1huv_A* 1p5b_A* 3giy_A* 2a7p_A* 2a85_A* 2a7n_A* | Back alignment and structure |
|---|
| >1h5y_A HISF; histidine biosynthesis, TIM-barrel; 2.0A {Pyrobaculum aerophilum} SCOP: c.1.2.1 | Back alignment and structure |
|---|
| >2nv1_A Pyridoxal biosynthesis lyase PDXS; (beta/alpha)8-barrel, synthase; 2.08A {Bacillus subtilis} PDB: 2nv2_A* 1znn_A | Back alignment and structure |
|---|
| >3b0p_A TRNA-dihydrouridine synthase; TIM barrel, oxidoreductase; HET: FMN; 1.70A {Thermus thermophilus} PDB: 3b0u_X* 3b0v_C* | Back alignment and structure |
|---|
| >3sr7_A Isopentenyl-diphosphate delta-isomerase; isopentenyl pyrophosphate isomerase, TIM-barrel; 2.04A {Streptococcus mutans} | Back alignment and structure |
|---|
| >2p10_A MLL9387 protein; putative phosphonopyruvate hydrolase, structural genomics, J center for structural genomics, JCSG; HET: MSE; 2.15A {Mesorhizobium loti} SCOP: c.1.12.9 | Back alignment and structure |
|---|
| >1vyr_A Pentaerythritol tetranitrate reductase; oxidoreductase, flavoenzyme, explosive degradation, steroid binding; HET: FMN TNF; 0.9A {Enterobacter cloacae} SCOP: c.1.4.1 PDB: 1gvq_A* 1gvr_A* 1gvs_A* 1h50_A* 1h51_A* 1h60_A* 1h61_A* 1h62_A* 1h63_A* 1gvo_A* 2aba_A* 3f03_K* 3kft_A* 3p7y_A* 3p80_A* 3p81_A* 3p62_A* 3p8i_A* 2abb_A* 3p67_A* ... | Back alignment and structure |
|---|
| >1icp_A OPR1, 12-oxophytodienoate reductase 1; beta-alpha-barrel, protein-FMN-PEG complex, oxidoreductase; HET: FMN 2PE; 1.90A {Solanum lycopersicum} SCOP: c.1.4.1 PDB: 1icq_A* 1ics_A* 3hgr_A* 1vji_A* 2q3r_A* | Back alignment and structure |
|---|
| >3qja_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, T structural genomics consortium, TBSGC, lyase; 1.29A {Mycobacterium tuberculosis} PDB: 3t40_A* 3t44_A* 3t55_A* 3t78_A* 4fb7_A* | Back alignment and structure |
|---|
| >1xm3_A Thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI, NESG, northeast structural genomics consortium; 1.80A {Bacillus subtilis} SCOP: c.1.31.1 PDB: 1tyg_A | Back alignment and structure |
|---|
| >4ef8_A Dihydroorotate dehydrogenase; phenyl isothiocyanate, PYRD, oxidoreductase, oxidoreductase-oxidor inhibitor complex; HET: FMN; 1.56A {Leishmania major} PDB: 3gye_A* 3gz3_A* 4ef9_A* 3tro_A* 3tjx_A* | Back alignment and structure |
|---|
| >1gte_A Dihydropyrimidine dehydrogenase; electron transfer, flavin, iron-sulfur clusters, pyrimidine catabolism, 5-fluorouracil degradation, oxidoreductase; HET: FMN FAD; 1.65A {Sus scrofa} SCOP: a.1.2.2 c.1.4.1 c.3.1.1 c.4.1.1 d.58.1.5 PDB: 1gt8_A* 1gth_A* 1h7w_A* 1h7x_A* | Back alignment and structure |
|---|
| >3hgj_A Chromate reductase; TIM barrel, oxidoreductase; HET: FMN; 2.00A {Thermus scotoductus} SCOP: c.1.4.0 PDB: 3hf3_A* | Back alignment and structure |
|---|
| >3l5a_A NADH/flavin oxidoreductase/NADH oxidase; OLD yellow enzyme family, OYE-like FMN-binding domain, TIM B oxidoreductase; HET: PGE; 1.65A {Staphylococcus aureus} | Back alignment and structure |
|---|
| >2zbt_A Pyridoxal biosynthesis lyase PDXS; pyridoxine biosynthesis, structural genomics, NPPSFA; 1.65A {Thermus thermophilus} PDB: 2iss_A* | Back alignment and structure |
|---|
| >3tqv_A Nicotinate-nucleotide pyrophosphorylase; glycosyltransferase, transferase; 2.62A {Francisella tularensis subsp} | Back alignment and structure |
|---|
| >3tsm_A IGPS, indole-3-glycerol phosphate synthase; structural genomics, ssgcid, seattle structural GE center for infectious disease, lyase; 2.15A {Brucella melitensis} SCOP: c.1.2.0 | Back alignment and structure |
|---|
| >3gr7_A NADPH dehydrogenase; flavin, FMN, beta-alpha-barrel, oxidoreductase, flavoprotein; HET: FMN; 2.30A {Geobacillus kaustophilus} PDB: 3gr8_A* | Back alignment and structure |
|---|
| >1yad_A Regulatory protein TENI; TIM barrel, transcription; 2.10A {Bacillus subtilis} PDB: 3qh2_A* | Back alignment and structure |
|---|
| >3gr7_A NADPH dehydrogenase; flavin, FMN, beta-alpha-barrel, oxidoreductase, flavoprotein; HET: FMN; 2.30A {Geobacillus kaustophilus} PDB: 3gr8_A* | Back alignment and structure |
|---|
| >3tdn_A FLR symmetric alpha-beta TIM barrel; symmetric superfold, de novo protein; 1.40A {Synthetic construct} PDB: 3og3_A 3tdm_A | Back alignment and structure |
|---|
| >3l0g_A Nicotinate-nucleotide pyrophosphorylase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography; 2.05A {Ehrlichia chaffeensis} | Back alignment and structure |
|---|
| >2r14_A Morphinone reductase; H-tunnelling, flavoprotein, NADH, hydride transfer, oxidoreductase; HET: FMN TXD; 1.40A {Pseudomonas putida} PDB: 3gx9_A* 1gwj_A* | Back alignment and structure |
|---|
| >1ka9_F Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.1.2.1 | Back alignment and structure |
|---|
| >1vzw_A Phosphoribosyl isomerase A; histidine biosynthesis, tryptophan biosynthesis; 1.8A {Streptomyces coelicolor} SCOP: c.1.2.1 PDB: 2vep_A 2x30_A | Back alignment and structure |
|---|
| >1qpo_A Quinolinate acid phosphoribosyl transferase; type II prtase, de novo NAD biosynthesis, PRPP, phosphoribos transferase; 2.40A {Mycobacterium tuberculosis H37RV} SCOP: c.1.17.1 d.41.2.1 PDB: 1qpn_A 1qpq_A* 1qpr_A* | Back alignment and structure |
|---|
| >1x1o_A Nicotinate-nucleotide pyrophosphorylase; transferase, structural genomics, NPPSFA, national project O structural and functional analyses; 1.90A {Thermus thermophilus} | Back alignment and structure |
|---|
| >3tjx_A Dihydroorotate dehydrogenase; PYRD, dhodh, lmdhodh, oxidored mutation H174A; HET: FMN; 1.64A {Leishmania major} PDB: 3gz3_A* 3gye_A* 3tro_A* | Back alignment and structure |
|---|
| >4adt_A Pyridoxine biosynthetic enzyme PDX1 homologue, PU; transferase, pyridoxal 5-phosphate biosynthesis; 2.42A {Plasmodium berghei} PDB: 4adu_A* 4ads_A | Back alignment and structure |
|---|
| >1ea0_A Glutamate synthase [NADPH] large chain; oxidoreductase, iron sulphur flavoprotein; HET: OMT FMN AKG; 3.0A {Azospirillum brasilense} SCOP: b.80.4.1 c.1.4.1 d.153.1.1 PDB: 2vdc_A* | Back alignment and structure |
|---|
| >1z41_A YQJM, probable NADH-dependent flavin oxidoreductase YQJ; FMN, beta-alpha-barrel; HET: FMN; 1.30A {Bacillus subtilis} SCOP: c.1.4.1 PDB: 1z42_A* 1z44_A* 1z48_A* | Back alignment and structure |
|---|
| >1ps9_A 2,4-dienoyl-COA reductase; iron-sulfur, TIM barrel, flavodoxin, flavin, electron transfer, hydride transfer, oxidoreductase; HET: FAD FMN NAP MDE; 2.20A {Escherichia coli} SCOP: c.1.4.1 c.3.1.1 c.4.1.1 | Back alignment and structure |
|---|
| >3bo9_A Putative nitroalkan dioxygenase; TM0800, structural genomics center for structural genomics, JCSG, protein structure INI PSI-2; HET: MSE 2PE; 2.71A {Thermotoga maritima MSB8} | Back alignment and structure |
|---|
| >3l5l_A Xenobiotic reductase A; TIM barrel, oxidoreductase; HET: BU3 FMN; 1.03A {Pseudomonas putida} SCOP: c.1.4.0 PDB: 3l5m_A* 3n19_B* 3n16_A* 3l68_A* 3l67_A* 3l65_A* 3l66_A* 3n14_A* 2h8z_A* 2h90_A* 2h8x_A* | Back alignment and structure |
|---|
| >3l5l_A Xenobiotic reductase A; TIM barrel, oxidoreductase; HET: BU3 FMN; 1.03A {Pseudomonas putida} SCOP: c.1.4.0 PDB: 3l5m_A* 3n19_B* 3n16_A* 3l68_A* 3l67_A* 3l65_A* 3l66_A* 3n14_A* 2h8z_A* 2h90_A* 2h8x_A* | Back alignment and structure |
|---|
| >3hgj_A Chromate reductase; TIM barrel, oxidoreductase; HET: FMN; 2.00A {Thermus scotoductus} SCOP: c.1.4.0 PDB: 3hf3_A* | Back alignment and structure |
|---|
| >3gka_A N-ethylmaleimide reductase; decode biostructures, ssgcid, niaid, targetdb bupsa00093A, structural genomics; HET: FMN; 2.30A {Burkholderia pseudomallei} SCOP: c.1.4.0 | Back alignment and structure |
|---|
| >1xi3_A Thiamine phosphate pyrophosphorylase; structural genomics, southeast collaboratory for structural genomics, hyperthermophIle; 1.70A {Pyrococcus furiosus} SCOP: c.1.3.1 | Back alignment and structure |
|---|
| >4ab4_A Xenobiotic reductase B; oxidoreductase, OLD yellow enzyme; HET: FMN TNL EDO; 1.50A {Pseudomonas putida KT2440} | Back alignment and structure |
|---|
| >3bw2_A 2-nitropropane dioxygenase; TIM barrel, oxidoreductase; HET: FMN; 2.10A {Streptomyces ansochromogenes} PDB: 3bw4_A* 3bw3_A* | Back alignment and structure |
|---|
| >2gjl_A Hypothetical protein PA1024; 2-nitropropane dioxygenase, 2-nitropropane, FMN, oxidoreduct; HET: FMN; 2.00A {Pseudomonas aeruginosa PAO1} PDB: 2gjn_A* | Back alignment and structure |
|---|
| >3nav_A Tryptophan synthase alpha chain; alpha subunit, structural genomics, CSG center for structural genomics of infectious diseases; 2.10A {Vibrio cholerae o1 biovar el tor} SCOP: c.1.2.4 | Back alignment and structure |
|---|
| >2y88_A Phosphoribosyl isomerase A; aromatic amino acid biosynthesis, TIM-barrel, His biosynthesis, tryptophan biosynthesis; HET: 2ER; 1.33A {Mycobacterium tuberculosis} PDB: 2y89_A 2y85_A* | Back alignment and structure |
|---|
| >1rvk_A Isomerase/lactonizing enzyme; enolase superfamily, MR.GI-17937161, NYSGXRC, target T1522, structural genomics, PSI; 1.70A {Agrobacterium tumefaciens} SCOP: c.1.11.2 d.54.1.1 | Back alignment and structure |
|---|
| >2gou_A Oxidoreductase, FMN-binding; OLD yeallow enzyme, flavoenzyme; HET: BOG FMN PE4; 1.40A {Shewanella oneidensis} PDB: 2gq8_A* 2gq9_A* 2gqa_A* | Back alignment and structure |
|---|
| >4e38_A Keto-hydroxyglutarate-aldolase/keto-deoxy-phospho aldolase; lyase; 1.64A {Vibrionales bacterium swat-3} | Back alignment and structure |
|---|
| >1o4u_A Type II quinolic acid phosphoribosyltransferase; structural genomics, joint center for structural genomics, J protein structure initiative; 2.50A {Thermotoga maritima} SCOP: c.1.17.1 d.41.2.1 | Back alignment and structure |
|---|
| >2yw3_A 4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deoxyphosphogluconate aldolase; structural genomics, NPPSFA; 1.67A {Thermus thermophilus} PDB: 2yw4_A | Back alignment and structure |
|---|
| >2z6i_A Trans-2-enoyl-ACP reductase II; fatty acid synthesis, antibiotics, oxidoreductase, flavoprotein; HET: FMN; 1.70A {Streptococcus pneumoniae} PDB: 2z6j_A* | Back alignment and structure |
|---|
| >2tps_A Protein (thiamin phosphate synthase); thiamin biosynthesis, TIM barrel; HET: TPS; 1.25A {Bacillus subtilis} SCOP: c.1.3.1 PDB: 1g4t_A* 3o15_A* 1g6c_A* 1g4e_A* 1g69_A* 3o16_A 1g4s_A* 1g4p_A* 1g67_A* | Back alignment and structure |
|---|
| >3gnn_A Nicotinate-nucleotide pyrophosphorylase; decode biostructures, ssgcid, niaid, SBRI, UWPPG, glycosyltransferase, transferase, structural genomics; 2.25A {Burkholderia pseudomallei} | Back alignment and structure |
|---|
| >2w6r_A Imidazole glycerol phosphate synthase subunit HISF; lyase, fusion protein, cobalamin, precorrin, novel fold, VIT; 2.10A {Thermotoga maritima} | Back alignment and structure |
|---|
| >4gj1_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; HISA, csgid, niaid,; 2.15A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >1ofd_A Ferredoxin-dependent glutamate synthase 2; oxidoreductase, complex enzyme, substrate channeling, amidotransferase, flavoprotein, iron-sulphur; HET: FMN AKG; 2.00A {Synechocystis SP} SCOP: b.80.4.1 c.1.4.1 d.153.1.1 PDB: 1llz_A* 1lm1_A* 1llw_A* 1ofe_A* | Back alignment and structure |
|---|
| >2y88_A Phosphoribosyl isomerase A; aromatic amino acid biosynthesis, TIM-barrel, His biosynthesis, tryptophan biosynthesis; HET: 2ER; 1.33A {Mycobacterium tuberculosis} PDB: 2y89_A 2y85_A* | Back alignment and structure |
|---|
| >3paj_A Nicotinate-nucleotide pyrophosphorylase, carboxyl; TIM barrel, pyridin dicarboxylate, 5-phospho-alpha-D-ribose 1-diphosphate; 2.00A {Vibrio cholerae o1 biovar el tor} | Back alignment and structure |
|---|
| >1thf_D HISF protein; thermophIle, TIM-barrel, histidine biosynthesis, lyase, phosphate-binding sites; 1.45A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2wjz_A 2a0n_A* 1gpw_A 1vh7_A 2rkx_A 3iio_A 3iip_A* 3iiv_A | Back alignment and structure |
|---|
| >3k30_A Histamine dehydrogenase; 6-S-cysteinyl-FMN, ADP binding site, oxidoreductase; HET: FMN ADP; 2.70A {Pimelobacter simplex} | Back alignment and structure |
|---|
| >3kru_A NADH:flavin oxidoreductase/NADH oxidase; homotetramer, dimer of dimers, TIM barrel, thermophilic, OLD enzyme; HET: FMN; 1.60A {Thermoanaerobacter pseudethanolicus AT} SCOP: c.1.4.0 PDB: 3krz_A* | Back alignment and structure |
|---|
| >1wv2_A Thiazole moeity, thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI; 2.90A {Pseudomonas aeruginosa} SCOP: c.1.31.1 | Back alignment and structure |
|---|
| >4af0_A Inosine-5'-monophosphate dehydrogenase; oxidoreductase, GTP biosynthesis, drug resistance; HET: MOA IMP; 2.20A {Cryptococcus neoformans} PDB: 4af0_B* | Back alignment and structure |
|---|
| >1qo2_A Molecule: N-((5-phosphoribosyl)-formimino)-5-aminoimidazol- 4-carboxamid ribonucleotid...; isomerase, histidine biosynthesis; 1.85A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2cff_A 2w79_A | Back alignment and structure |
|---|
| >1to3_A Putative aldolase YIHT; beta-alpha barrel, structural genomics, PSI, protein structure initiative; 2.70A {Salmonella typhimurium} SCOP: c.1.10.1 | Back alignment and structure |
|---|
| >2czd_A Orotidine 5'-phosphate decarboxylase; pyrimidine biosynthesis, orotidine 5'-phosphate decarboxylas (ompdecase), structural genomics; 1.60A {Pyrococcus horikoshii} SCOP: c.1.2.3 PDB: 2cz5_A 2cze_A* 2czf_A* | Back alignment and structure |
|---|
| >1vhc_A Putative KHG/KDPG aldolase; structural genomics, unknown function; HET: MSE; 1.89A {Haemophilus influenzae} SCOP: c.1.10.1 | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 106 | ||||
| d2a4aa1 | 256 | c.1.10.1 (A:3-258) Fructose-1,6-bisphosphate aldol | 2e-20 | |
| d1p1xa_ | 250 | c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC | 5e-19 | |
| d1vcva1 | 226 | c.1.10.1 (A:1-226) Deoxyribose-phosphate aldolase | 2e-13 | |
| d1mzha_ | 225 | c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC | 2e-11 | |
| d1o0ya_ | 251 | c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC | 3e-10 | |
| d1n7ka_ | 234 | c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC | 4e-10 | |
| d1ub3a_ | 211 | c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC | 5e-07 |
| >d2a4aa1 c.1.10.1 (A:3-258) Fructose-1,6-bisphosphate aldolase {Plasmodium yoelii yoelii [TaxId: 73239]} Length = 256 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: TIM beta/alpha-barrel superfamily: Aldolase family: Class I aldolase domain: Fructose-1,6-bisphosphate aldolase species: Plasmodium yoelii yoelii [TaxId: 73239]
Score = 80.2 bits (197), Expect = 2e-20
Identities = 28/103 (27%), Positives = 47/103 (45%), Gaps = 9/103 (8%)
Query: 5 RKVAFKGSNF-RTLHGRGPDSTSYGNVCNTCGIIMCSAIKHF---HKLSGKKIGLKPAGG 60
V ++F +T G+ + + +V + AIK + + KIGLK +GG
Sbjct: 158 LAVLNGNADFIKTSTGKVQINATPSSV-----EYIIKAIKEYIKNNPEKNNKIGLKVSGG 212
Query: 61 ISTFEDSVRWIYLVLIMLGPDWLNKDLFRIGASSLLNNILQEL 103
IS + +I L L + D FRIG+SSL+ + + +
Sbjct: 213 ISDLNTASHYILLARRFLSSLACHPDNFRIGSSSLVIKLRKVI 255
|
| >d1p1xa_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Escherichia coli [TaxId: 562]} Length = 250 | Back information, alignment and structure |
|---|
| >d1vcva1 c.1.10.1 (A:1-226) Deoxyribose-phosphate aldolase DeoC {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} Length = 226 | Back information, alignment and structure |
|---|
| >d1mzha_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Aquifex aeolicus [TaxId: 63363]} Length = 225 | Back information, alignment and structure |
|---|
| >d1o0ya_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermotoga maritima [TaxId: 2336]} Length = 251 | Back information, alignment and structure |
|---|
| >d1n7ka_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Archaeon Aeropyrum pernix [TaxId: 56636]} Length = 234 | Back information, alignment and structure |
|---|
| >d1ub3a_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermus thermophilus [TaxId: 274]} Length = 211 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 106 | |||
| d1p1xa_ | 250 | Deoxyribose-phosphate aldolase DeoC {Escherichia c | 100.0 | |
| d2a4aa1 | 256 | Fructose-1,6-bisphosphate aldolase {Plasmodium yoe | 100.0 | |
| d1mzha_ | 225 | Deoxyribose-phosphate aldolase DeoC {Aquifex aeoli | 99.93 | |
| d1ub3a_ | 211 | Deoxyribose-phosphate aldolase DeoC {Thermus therm | 99.93 | |
| d1vcva1 | 226 | Deoxyribose-phosphate aldolase DeoC {Archaeon Pyro | 99.92 | |
| d1o0ya_ | 251 | Deoxyribose-phosphate aldolase DeoC {Thermotoga ma | 99.92 | |
| d1n7ka_ | 234 | Deoxyribose-phosphate aldolase DeoC {Archaeon Aero | 99.91 | |
| d1y0ea_ | 222 | Putative N-acetylmannosamine-6-phosphate 2-epimera | 96.88 | |
| d1yxya1 | 230 | Putative N-acetylmannosamine-6-phosphate 2-epimera | 96.55 | |
| d1f76a_ | 336 | Dihydroorotate dehydrogenase {Escherichia coli [Ta | 95.59 | |
| d1juba_ | 311 | Dihydroorotate dehydrogenase {Lactococcus lactis, | 95.53 | |
| d1tv5a1 | 409 | Dihydroorotate dehydrogenase {Plasmodium falciparu | 95.2 | |
| d1tb3a1 | 349 | Hydroxyacid oxidase {Rat (Rattus norvegicus) [TaxI | 94.97 | |
| d1d3ga_ | 367 | Dihydroorotate dehydrogenase {Human (Homo sapiens) | 94.56 | |
| d1p0ka_ | 329 | Isopentenyl-diphosphate delta-isomerase {Bacillus | 93.74 | |
| d1pvna1 | 362 | Inosine monophosphate dehydrogenase (IMPDH) {Tritr | 93.67 | |
| d1vcfa1 | 310 | Isopentenyl-diphosphate delta-isomerase {Thermus t | 93.17 | |
| d1gtea2 | 312 | Dihydropyrimidine dehydrogenase, domain 4 {Pig (Su | 92.7 | |
| d1ep3a_ | 311 | Dihydroorotate dehydrogenase {Lactococcus lactis, | 92.49 | |
| d1goxa_ | 359 | Glycolate oxidase {Spinach (Spinacia oleracea) [Ta | 92.28 | |
| d1ea0a2 | 771 | Alpha subunit of glutamate synthase, central and F | 91.54 | |
| d1eepa_ | 388 | Inosine monophosphate dehydrogenase (IMPDH) {Lyme | 91.03 | |
| d1kbia1 | 414 | Flavocytochrome b2, C-terminal domain {Baker's yea | 90.74 | |
| d1wa3a1 | 202 | KDPG aldolase {Thermotoga maritima [TaxId: 2336]} | 89.9 | |
| d1ofda2 | 809 | Alpha subunit of glutamate synthase, central and F | 89.71 | |
| d1qpoa1 | 169 | Quinolinic acid phosphoribosyltransferase (Nicotin | 89.68 | |
| d1o4ua1 | 170 | Quinolinic acid phosphoribosyltransferase (Nicotin | 89.22 | |
| d2b4ga1 | 312 | Dihydroorotate dehydrogenase {Trypanosoma brucei [ | 88.47 | |
| d1vrda1 | 330 | Inosine monophosphate dehydrogenase (IMPDH) {Therm | 88.27 | |
| d1vyra_ | 363 | Pentaerythritol tetranirate reductase {Enterobacte | 87.16 | |
| d1p4ca_ | 353 | Membrane-associated (S)-mandelate dehydrogenase {P | 84.7 | |
| d1a53a_ | 247 | Indole-3-glycerophosphate synthase, IPGS {Archaeon | 83.32 | |
| d1geqa_ | 248 | Trp synthase alpha-subunit {Archaeon Pyrococcus fu | 82.88 | |
| d1hg3a_ | 224 | Triosephosphate isomerase {Archaeon Pyrococcus woe | 80.78 | |
| d1zfja1 | 365 | Inosine monophosphate dehydrogenase (IMPDH) {Strep | 80.42 |
| >d1p1xa_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: TIM beta/alpha-barrel superfamily: Aldolase family: Class I aldolase domain: Deoxyribose-phosphate aldolase DeoC species: Escherichia coli [TaxId: 562]
Probab=100.00 E-value=3e-33 Score=216.47 Aligned_cols=95 Identities=31% Similarity=0.556 Sum_probs=90.7
Q ss_pred hhhHHHhhCCCc-ccCCCCCCCCCCCCCCCchHHHHHHHHHHHHhhhcCCceeEeecCCCCCHHHHHHHHHHHHhhCCCC
Q psy969 3 RPRKVAFKGSNF-RTLHGRGPDSTSYGNVCNTCGIIMCSAIKHFHKLSGKKIGLKPAGGISTFEDSVRWIYLVLIMLGPD 81 (106)
Q Consensus 3 ~~~iai~aGadF-KTSTG~~~~gat~~~~~~~~v~lm~~~i~~~~~~~~~~vgiKaaGGIrt~~~a~~~i~l~~~~lGa~ 81 (106)
+|++|+++|||| ||||||.++++| ++++++|+++++++. .+.++|||+||||||++||++|+++..+.+|.+
T Consensus 154 a~~ia~~aGadFvKTSTG~~~~gat-----~~~v~~m~~~i~~~~--~~~~vgIKasGGIrt~~~a~~~i~~ga~~iG~~ 226 (250)
T d1p1xa_ 154 ASEISIKAGADFIKTSTGKVAVNAT-----PESARIMMEVIRDMG--VEKTVGFKPAGGVRTAEDAQKYLAIADELFGAD 226 (250)
T ss_dssp HHHHHHHTTCSEEECCCSCSSCCCC-----HHHHHHHHHHHHHHT--CTTTCEEECBSSCCSHHHHHHHHHHHHHHHCTT
T ss_pred HHHHHHHcCcCeEEecCCcCCCCCC-----HHHHHHHHHHhhhhc--cCcceeeEecCCCCCHHHHHHHHHHHHHHhCcc
Confidence 689999999999 999999999999 999999999998763 467999999999999999999999999999999
Q ss_pred ccCCCceeEeccchHHHHHHHHh
Q psy969 82 WLNKDLFRIGASSLLNNILQELE 104 (106)
Q Consensus 82 w~~~~~~RiGtSs~~~~l~~~l~ 104 (106)
|++|++||||+||++++|+++|+
T Consensus 227 ~~~~~~fRiGaSs~l~~l~~~l~ 249 (250)
T d1p1xa_ 227 WADARHYRFGASSLLASLLKALG 249 (250)
T ss_dssp SCSTTTBCEEESTHHHHHHHHHT
T ss_pred ccccCceeeeHHHHHHHHHHHhc
Confidence 99999999999999999999985
|
| >d2a4aa1 c.1.10.1 (A:3-258) Fructose-1,6-bisphosphate aldolase {Plasmodium yoelii yoelii [TaxId: 73239]} | Back information, alignment and structure |
|---|
| >d1mzha_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Aquifex aeolicus [TaxId: 63363]} | Back information, alignment and structure |
|---|
| >d1ub3a_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1vcva1 c.1.10.1 (A:1-226) Deoxyribose-phosphate aldolase DeoC {Archaeon Pyrobaculum aerophilum [TaxId: 13773]} | Back information, alignment and structure |
|---|
| >d1o0ya_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1n7ka_ c.1.10.1 (A:) Deoxyribose-phosphate aldolase DeoC {Archaeon Aeropyrum pernix [TaxId: 56636]} | Back information, alignment and structure |
|---|
| >d1y0ea_ c.1.2.5 (A:) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Staphylococcus aureus [TaxId: 1280]} | Back information, alignment and structure |
|---|
| >d1yxya1 c.1.2.5 (A:4-233) Putative N-acetylmannosamine-6-phosphate 2-epimerase NanE {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|
| >d1f76a_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1juba_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Lactococcus lactis, isozyme A [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1tv5a1 c.1.4.1 (A:158-566) Dihydroorotate dehydrogenase {Plasmodium falciparum [TaxId: 5833]} | Back information, alignment and structure |
|---|
| >d1tb3a1 c.1.4.1 (A:1-349) Hydroxyacid oxidase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1d3ga_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p0ka_ c.1.4.1 (A:) Isopentenyl-diphosphate delta-isomerase {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1pvna1 c.1.5.1 (A:2-99,A:231-494) Inosine monophosphate dehydrogenase (IMPDH) {Tritrichomonas foetus [TaxId: 5724]} | Back information, alignment and structure |
|---|
| >d1vcfa1 c.1.4.1 (A:23-332) Isopentenyl-diphosphate delta-isomerase {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1gtea2 c.1.4.1 (A:533-844) Dihydropyrimidine dehydrogenase, domain 4 {Pig (Sus scrofa) [TaxId: 9823]} | Back information, alignment and structure |
|---|
| >d1ep3a_ c.1.4.1 (A:) Dihydroorotate dehydrogenase {Lactococcus lactis, isozyme B [TaxId: 1358]} | Back information, alignment and structure |
|---|
| >d1goxa_ c.1.4.1 (A:) Glycolate oxidase {Spinach (Spinacia oleracea) [TaxId: 3562]} | Back information, alignment and structure |
|---|
| >d1ea0a2 c.1.4.1 (A:423-1193) Alpha subunit of glutamate synthase, central and FMN domains {Azospirillum brasilense [TaxId: 192]} | Back information, alignment and structure |
|---|
| >d1eepa_ c.1.5.1 (A:) Inosine monophosphate dehydrogenase (IMPDH) {Lyme disease spirochete (Borrelia burgdorferi) [TaxId: 139]} | Back information, alignment and structure |
|---|
| >d1kbia1 c.1.4.1 (A:98-511) Flavocytochrome b2, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1wa3a1 c.1.10.1 (A:2-203) KDPG aldolase {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1ofda2 c.1.4.1 (A:431-1239) Alpha subunit of glutamate synthase, central and FMN domains {Synechocystis sp. [TaxId: 1143]} | Back information, alignment and structure |
|---|
| >d1qpoa1 c.1.17.1 (A:117-285) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1o4ua1 c.1.17.1 (A:104-273) Quinolinic acid phosphoribosyltransferase (Nicotinate-nucleotide pyrophosphorylase, NadC), C-terminal domain {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d2b4ga1 c.1.4.1 (A:2-313) Dihydroorotate dehydrogenase {Trypanosoma brucei [TaxId: 5691]} | Back information, alignment and structure |
|---|
| >d1vrda1 c.1.5.1 (A:1-85,A:213-457) Inosine monophosphate dehydrogenase (IMPDH) {Thermotoga maritima [TaxId: 2336]} | Back information, alignment and structure |
|---|
| >d1vyra_ c.1.4.1 (A:) Pentaerythritol tetranirate reductase {Enterobacter cloacae [TaxId: 550]} | Back information, alignment and structure |
|---|
| >d1p4ca_ c.1.4.1 (A:) Membrane-associated (S)-mandelate dehydrogenase {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1a53a_ c.1.2.4 (A:) Indole-3-glycerophosphate synthase, IPGS {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1geqa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Archaeon Pyrococcus furiosus [TaxId: 2261]} | Back information, alignment and structure |
|---|
| >d1hg3a_ c.1.1.1 (A:) Triosephosphate isomerase {Archaeon Pyrococcus woesei [TaxId: 2262]} | Back information, alignment and structure |
|---|
| >d1zfja1 c.1.5.1 (A:2-94,A:221-492) Inosine monophosphate dehydrogenase (IMPDH) {Streptococcus pyogenes [TaxId: 1314]} | Back information, alignment and structure |
|---|