Psyllid ID: psy9724

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140
MSLVLSVDRLDYTKGLVHRLKAFETLLEKHPEHLEKVTLLQIAVPSRTDVKEYQDLKEEMDQLVGRINGRFTTPNWSPIRYIYGCISQDELASFYRDAAVALVTPLRDEWSNSFSRSGNFRIKSAPSGNRTHDLALTKPL
cEEEEEcccccccccHHHHHHHHHHHHHHcccccccEEEEEEEccccccHHHHHHHHHHHHHHHHHHHccccccccccEEEEcccccHHHHHHHHHHccEEEEccccccHHHHccccccEEEEEcccccccccEEEEccc
cEEEEEccccHHHccHHHHHHHHHHHHHHcccHcccEEEEEEEccccccHHHHHHHHHHHHHHHHHHHcccccccccEEEEEEccccHHHHHHHHHHHHEEEEEccccccEEEEEEccccccccccccccccEEEEEEcc
mslvlsvdrldyTKGLVHRLKAFETLLEKHPEHLEKVTLLQiavpsrtdvkEYQDLKEEMDQLVGRingrfttpnwspiryIYGCISQDELASFYRDAAVALVTPlrdewsnsfsrsgnfriksapsgnrthdlaltkpl
mslvlsvdrldytkgLVHRLKAFETLLEKHPEHLEKvtllqiavpsrtdVKEYQDLKEEMDQLVgringrfttpnwspIRYIYGCISQDELASFYRDAAVALVTPLRdewsnsfsrsgnfriksapsgnrthdlaltkpl
MSLVLSVDRLDYTKGLVHRLKAFETLLEKHPEHLEKVTLLQIAVPSRTDVKEYQDLKEEMDQLVGRINGRFTTPNWSPIRYIYGCISQDELASFYRDAAVALVTPLRDEWSNSFSRSGNFRIKSAPSGNRTHDLALTKPL
***VLSVDRLDYTKGLVHRLKAFETLLEKHPEHLEKVTLLQIAVPSRTDVKEYQDLKEEMDQLVGRINGRFTTPNWSPIRYIYGCISQDELASFYRDAAVALVTPLRDEW******************************
MSLVLSVDRLDYTKGLVHRLKAFETLLEKHPEHLEKVTLLQIAVPSRTDVKEYQDLKEEMDQLVGRINGRFTTPNWSPIRYIYGCISQDELASFYRDAAVALVTPLRDEWSNSFSRSGNFRIKSAPSGNRTHDLALTKPL
MSLVLSVDRLDYTKGLVHRLKAFETLLEKHPEHLEKVTLLQIAVPSRTDVKEYQDLKEEMDQLVGRINGRFTTPNWSPIRYIYGCISQDELASFYRDAAVALVTPLRDEWSNSFSRSGNFRIKSAPSGNRTHDLALTKPL
MSLVLSVDRLDYTKGLVHRLKAFETLLEKHPEHLEKVTLLQIAVPSRTDVKEYQDLKEEMDQLVGRINGRFTTPNWSPIRYIYGCISQDELASFYRDAAVALVTPLRDEWSNSFSRSGNFRIKSAPS*NRTHDLALTKPL
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSLVLSVDRLDYTKGLVHRLKAFETLLEKHPEHLEKVTLLQIAVPSRTDVKEYQDLKEEMDQLVGRINGRFTTPNWSPIRYIYGCISQDELASFYRDAAVALVTPLRDEWSNSFSRSGNFRIKSAPSGNRTHDLALTKPL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query140 2.2.26 [Sep-21-2011]
O94213475 Alpha,alpha-trehalose-pho N/A N/A 0.757 0.223 0.5 1e-25
P40387513 Alpha,alpha-trehalose-pho yes N/A 0.771 0.210 0.462 5e-25
Q00217480 Alpha,alpha-trehalose-pho yes N/A 0.757 0.220 0.481 7e-25
Q92410478 Alpha,alpha-trehalose-pho N/A N/A 0.771 0.225 0.490 2e-24
Q54K57 733 Alpha,alpha-trehalose-pho yes N/A 0.757 0.144 0.462 3e-24
Q2NTK9469 Alpha,alpha-trehalose-pho yes N/A 0.757 0.226 0.481 6e-24
Q93JY3755 Glucosylglycerol-phosphat N/A N/A 0.771 0.143 0.444 1e-23
Q00075517 Alpha,alpha-trehalose-pho no N/A 0.771 0.208 0.453 2e-23
O59921504 Alpha,alpha-trehalose-pho no N/A 0.771 0.214 0.453 3e-23
A7MEE9474 Alpha,alpha-trehalose-pho yes N/A 0.75 0.221 0.476 4e-23
>sp|O94213|TPS1_PICAN Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Pichia angusta GN=TPS1 PE=3 SV=1 Back     alignment and function desciption
 Score =  114 bits (286), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 53/106 (50%), Positives = 75/106 (70%)

Query: 3   LVLSVDRLDYTKGLVHRLKAFETLLEKHPEHLEKVTLLQIAVPSRTDVKEYQDLKEEMDQ 62
           L++ VDRLDY KG+  +L AFE  LE+HPE + KV L+Q+AVPSR DV+EYQ L+  +++
Sbjct: 279 LIIGVDRLDYIKGVPQKLHAFEIFLERHPEWIGKVVLIQVAVPSRGDVEEYQSLRAAVNE 338

Query: 63  LVGRINGRFTTPNWSPIRYIYGCISQDELASFYRDAAVALVTPLRD 108
           LVGRINGRF T  + PI +++  ++  EL S Y  + V +V+  RD
Sbjct: 339 LVGRINGRFGTVEFVPIHFLHKSVNFQELISVYAASDVCVVSSTRD 384

Pichia angusta (taxid: 870730)
EC: 2EC: .EC: 4EC: .EC: 1EC: .EC: 1EC: 5
>sp|P40387|TPS1_SCHPO Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tps1 PE=1 SV=2 Back     alignment and function description
>sp|Q00217|TPSB_ASPNG Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 2 OS=Aspergillus niger GN=tpsB PE=3 SV=1 Back     alignment and function description
>sp|Q92410|TPS1_CANAL Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TPS1 PE=2 SV=1 Back     alignment and function description
>sp|Q54K57|TPSA_DICDI Alpha,alpha-trehalose-phosphate synthase [UDP-forming] A OS=Dictyostelium discoideum GN=tpsA PE=2 SV=1 Back     alignment and function description
>sp|Q2NTK9|OTSA_SODGM Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Sodalis glossinidius (strain morsitans) GN=otsA PE=3 SV=1 Back     alignment and function description
>sp|Q93JY3|GGPS_PSEAG Glucosylglycerol-phosphate synthase OS=Pseudomonas anguilliseptica GN=ggpS PE=3 SV=2 Back     alignment and function description
>sp|Q00075|TPSA_ASPNG Alpha,alpha-trehalose-phosphate synthase [UDP-forming] 1 OS=Aspergillus niger GN=tpsA PE=3 SV=1 Back     alignment and function description
>sp|O59921|TPS1_EMENI Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tpsA PE=3 SV=1 Back     alignment and function description
>sp|A7MEE9|OTSA_CROS8 Alpha,alpha-trehalose-phosphate synthase [UDP-forming] OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=otsA PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query140
388271227150 trehalose-6-phosphate synthase, partial 0.764 0.713 0.887 2e-51
383853810 790 PREDICTED: alpha,alpha-trehalose-phospha 0.757 0.134 0.886 9e-51
198448627 826 trehalose 6-phosphate synthase isoform I 0.757 0.128 0.886 9e-51
256708537 807 trehalose 6-phosphate synthase [Nilaparv 0.757 0.131 0.886 1e-50
357625720 700 trehalose-6-phosphate synthase [Danaus p 0.757 0.151 0.896 1e-50
88698232 536 trehalose 6-phosphate synthase [Helicove 0.757 0.197 0.886 2e-50
380011250 806 PREDICTED: LOW QUALITY PROTEIN: alpha,al 0.757 0.131 0.886 2e-50
388540222 807 trehalose phosphate synthase [Sogatella 0.757 0.131 0.886 2e-50
281372519 826 trehalose-6-phosphate synthase [Spodopte 0.757 0.128 0.886 3e-50
156547621 798 PREDICTED: alpha,alpha-trehalose-phospha 0.757 0.132 0.877 3e-50
>gi|388271227|gb|AFK26603.1| trehalose-6-phosphate synthase, partial [Helicoverpa armigera] Back     alignment and taxonomy information
 Score =  206 bits (525), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 95/107 (88%), Positives = 102/107 (95%)

Query: 2   SLVLSVDRLDYTKGLVHRLKAFETLLEKHPEHLEKVTLLQIAVPSRTDVKEYQDLKEEMD 61
            ++L VDRLDYTKGLVHRLKAFE LLEK+PEH+EKV LLQI+VPSRTDVKEYQDLKEEMD
Sbjct: 38  QIILGVDRLDYTKGLVHRLKAFERLLEKYPEHIEKVVLLQISVPSRTDVKEYQDLKEEMD 97

Query: 62  QLVGRINGRFTTPNWSPIRYIYGCISQDELASFYRDAAVALVTPLRD 108
           QLVGRINGRFTTPNWSPIRYIYGC+ QDELA+FYRDAAVALVTPLRD
Sbjct: 98  QLVGRINGRFTTPNWSPIRYIYGCVGQDELAAFYRDAAVALVTPLRD 144

Source: Helicoverpa armigera

Species: Helicoverpa armigera

Genus: Helicoverpa

Family: Noctuidae

Order: Lepidoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|383853810|ref|XP_003702415.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] A-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|198448627|gb|ACH88521.1| trehalose 6-phosphate synthase isoform I [Helicoverpa armigera] Back     alignment and taxonomy information
>gi|256708537|gb|ACV20871.1| trehalose 6-phosphate synthase [Nilaparvata lugens] Back     alignment and taxonomy information
>gi|357625720|gb|EHJ76070.1| trehalose-6-phosphate synthase [Danaus plexippus] Back     alignment and taxonomy information
>gi|88698232|gb|AAY87162.2| trehalose 6-phosphate synthase [Helicoverpa armigera] Back     alignment and taxonomy information
>gi|380011250|ref|XP_003689723.1| PREDICTED: LOW QUALITY PROTEIN: alpha,alpha-trehalose-phosphate synthase [UDP-forming] A-like [Apis florea] Back     alignment and taxonomy information
>gi|388540222|gb|AFK64819.1| trehalose phosphate synthase [Sogatella furcifera] Back     alignment and taxonomy information
>gi|281372519|gb|ADA63844.1| trehalose-6-phosphate synthase [Spodoptera litura] Back     alignment and taxonomy information
>gi|156547621|ref|XP_001603693.1| PREDICTED: alpha,alpha-trehalose-phosphate synthase [UDP-forming] A-like [Nasonia vitripennis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query140
FB|FBgn0027560 809 Tps1 "Trehalose-6-phosphate sy 0.771 0.133 0.787 1.5e-41
ASPGD|ASPL0000073095474 AN8639 [Emericella nidulans (t 0.764 0.225 0.485 1.6e-24
UNIPROTKB|G4NHF4 529 MGG_03860 "Alpha,alpha-trehalo 0.771 0.204 0.481 5.3e-23
POMBASE|SPAC328.03513 tps1 "alpha,alpha-trehalose-ph 0.771 0.210 0.462 1e-22
CGD|CAL0004028478 TPS1 [Candida albicans (taxid: 0.771 0.225 0.490 1.7e-22
UNIPROTKB|Q92410478 TPS1 "Alpha,alpha-trehalose-ph 0.771 0.225 0.490 1.7e-22
DICTYBASE|DDB_G0287657 733 tpsA "alpha,alpha-trehalose-ph 0.757 0.144 0.462 2e-22
ASPGD|ASPL0000027021504 tpsA [Emericella nidulans (tax 0.771 0.214 0.453 3.3e-21
SGD|S000000330495 TPS1 "Synthase subunit of treh 0.757 0.214 0.481 8.6e-21
UNIPROTKB|P31677474 otsA [Escherichia coli K-12 (t 0.75 0.221 0.447 5.7e-20
FB|FBgn0027560 Tps1 "Trehalose-6-phosphate synthase 1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 448 (162.8 bits), Expect = 1.5e-41, P = 1.5e-41
 Identities = 85/108 (78%), Positives = 97/108 (89%)

Query:     1 MSLVLSVDRLDYTKGLVHRLKAFETLLEKHPEHLEKVTLLQIAVPSRTDVKEYQDLKEEM 60
             M ++L VDRLDYTKGLVHRL AFE LL K+P+H EKV+LLQI+VPSRTDVKEY++LKEE+
Sbjct:   300 MQIILGVDRLDYTKGLVHRLMAFEALLLKYPQHKEKVSLLQISVPSRTDVKEYRELKEEV 359

Query:    61 DQLVGRINGRFTTPNWSPIRYIYGCISQDELASFYRDAAVALVTPLRD 108
             DQLVGRINGRFTT NW+PIRYIY  +SQDELA+ YRDAAV LVTPLRD
Sbjct:   360 DQLVGRINGRFTTANWAPIRYIYDYVSQDELAALYRDAAVCLVTPLRD 407
GO:0003825 "alpha,alpha-trehalose-phosphate synthase (UDP-forming) activity" evidence=ISS;NAS
GO:0005992 "trehalose biosynthetic process" evidence=IEA
GO:0005811 "lipid particle" evidence=IDA
ASPGD|ASPL0000073095 AN8639 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
UNIPROTKB|G4NHF4 MGG_03860 "Alpha,alpha-trehalose-phosphate synthase 1" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
POMBASE|SPAC328.03 tps1 "alpha,alpha-trehalose-phosphate synthase [UDP-forming]" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
CGD|CAL0004028 TPS1 [Candida albicans (taxid:5476)] Back     alignment and assigned GO terms
UNIPROTKB|Q92410 TPS1 "Alpha,alpha-trehalose-phosphate synthase [UDP-forming]" [Candida albicans SC5314 (taxid:237561)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0287657 tpsA "alpha,alpha-trehalose-phosphate synthase" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms
ASPGD|ASPL0000027021 tpsA [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
SGD|S000000330 TPS1 "Synthase subunit of trehalose-6-P synthase/phosphatase complex" [Saccharomyces cerevisiae (taxid:4932)] Back     alignment and assigned GO terms
UNIPROTKB|P31677 otsA [Escherichia coli K-12 (taxid:83333)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query140
cd03788460 cd03788, GT1_TPS, Trehalose-6-Phosphate Synthase ( 2e-60
TIGR02400456 TIGR02400, trehalose_OtsA, alpha,alpha-trehalose-p 3e-53
PRK14501 726 PRK14501, PRK14501, putative bifunctional trehalos 4e-52
pfam00982470 pfam00982, Glyco_transf_20, Glycosyltransferase fa 1e-45
COG0380486 COG0380, OtsA, Trehalose-6-phosphate synthase [Car 1e-43
PLN03063 797 PLN03063, PLN03063, alpha,alpha-trehalose-phosphat 2e-30
TIGR02398487 TIGR02398, gluc_glyc_Psyn, glucosylglycerol-phosph 3e-30
PLN03064 934 PLN03064, PLN03064, alpha,alpha-trehalose-phosphat 3e-29
PRK10117474 PRK10117, PRK10117, trehalose-6-phosphate synthase 3e-29
PLN02205 854 PLN02205, PLN02205, alpha,alpha-trehalose-phosphat 2e-15
pfam00534158 pfam00534, Glycos_transf_1, Glycosyl transferases 0.001
>gnl|CDD|99963 cd03788, GT1_TPS, Trehalose-6-Phosphate Synthase (TPS) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor Back     alignment and domain information 
 Score =  192 bits (490), Expect = 2e-60
 Identities = 66/106 (62%), Positives = 87/106 (82%)

Query: 3   LVLSVDRLDYTKGLVHRLKAFETLLEKHPEHLEKVTLLQIAVPSRTDVKEYQDLKEEMDQ 62
           L++ VDRLDY+KG+  RL AFE LLE++PE   KV L+QIAVPSRTDV EYQ+L+ E+++
Sbjct: 266 LIVGVDRLDYSKGIPERLLAFERLLERYPEWRGKVVLVQIAVPSRTDVPEYQELRREVEE 325

Query: 63  LVGRINGRFTTPNWSPIRYIYGCISQDELASFYRDAAVALVTPLRD 108
           LVGRING+F T +W+P+RY+Y  + ++ELA+ YR A VALVTPLRD
Sbjct: 326 LVGRINGKFGTLDWTPVRYLYRSLPREELAALYRAADVALVTPLRD 371

It is a key enzyme in the trehalose synthesis pathway. Trehalose is a nonreducing disaccharide present in a wide variety of organisms and may serve as a source of energy and carbon. It is characterized most notably in insect, plant, and microbial cells. Its production is often associated with a variety of stress conditions, including desiccation, dehydration, heat, cold, and oxidation. This family represents the catalytic domain of the TPS. Some members of this domain family coexist with a C-terminal trehalose phosphatase domain. Length = 460
>gnl|CDD|233848 TIGR02400, trehalose_OtsA, alpha,alpha-trehalose-phosphate synthase [UDP-forming] Back     alignment and domain information
>gnl|CDD|184712 PRK14501, PRK14501, putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional Back     alignment and domain information
>gnl|CDD|216227 pfam00982, Glyco_transf_20, Glycosyltransferase family 20 Back     alignment and domain information
>gnl|CDD|223457 COG0380, OtsA, Trehalose-6-phosphate synthase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|215555 PLN03063, PLN03063, alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional Back     alignment and domain information
>gnl|CDD|131451 TIGR02398, gluc_glyc_Psyn, glucosylglycerol-phosphate synthase Back     alignment and domain information
>gnl|CDD|215556 PLN03064, PLN03064, alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional Back     alignment and domain information
>gnl|CDD|182249 PRK10117, PRK10117, trehalose-6-phosphate synthase; Provisional Back     alignment and domain information
>gnl|CDD|177855 PLN02205, PLN02205, alpha,alpha-trehalose-phosphate synthase [UDP-forming] Back     alignment and domain information
>gnl|CDD|215979 pfam00534, Glycos_transf_1, Glycosyl transferases group 1 Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 140
PRK10117474 trehalose-6-phosphate synthase; Provisional 100.0
TIGR02398487 gluc_glyc_Psyn glucosylglycerol-phosphate synthase 100.0
PLN02205 854 alpha,alpha-trehalose-phosphate synthase [UDP-form 100.0
COG0380486 OtsA Trehalose-6-phosphate synthase [Carbohydrate 100.0
PF00982474 Glyco_transf_20: Glycosyltransferase family 20; In 100.0
PLN03064 934 alpha,alpha-trehalose-phosphate synthase (UDP-form 100.0
TIGR02400456 trehalose_OtsA alpha,alpha-trehalose-phosphate syn 100.0
PLN03063 797 alpha,alpha-trehalose-phosphate synthase (UDP-form 100.0
PRK14501 726 putative bifunctional trehalose-6-phosphate syntha 99.97
cd03788460 GT1_TPS Trehalose-6-Phosphate Synthase (TPS) is a 99.96
KOG1050|consensus 732 99.92
PRK15484380 lipopolysaccharide 1,2-N-acetylglucosaminetransfer 99.65
cd03792372 GT1_Trehalose_phosphorylase Trehalose phosphorylas 99.61
TIGR03449405 mycothiol_MshA UDP-N-acetylglucosamine: 1L-myo-ino 99.56
TIGR03088374 stp2 sugar transferase, PEP-CTERM/EpsH1 system ass 99.55
cd03796398 GT1_PIG-A_like This family is most closely related 99.55
PLN02949463 transferase, transferring glycosyl groups 99.54
cd03806419 GT1_ALG11_like This family is most closely related 99.54
PHA01633335 putative glycosyl transferase group 1 99.52
PRK15427406 colanic acid biosynthesis glycosyltransferase WcaL 99.52
cd03818396 GT1_ExpC_like This family is most closely related 99.51
TIGR02470784 sucr_synth sucrose synthase. This model represents 99.5
cd03812358 GT1_CapH_like This family is most closely related 99.5
cd03805392 GT1_ALG2_like This family is most closely related 99.49
PLN00142 815 sucrose synthase 99.49
PRK00654466 glgA glycogen synthase; Provisional 99.48
TIGR02149388 glgA_Coryne glycogen synthase, Corynebacterium fam 99.47
cd03821375 GT1_Bme6_like This family is most closely related 99.46
TIGR02468 1050 sucrsPsyn_pln sucrose phosphate synthase/possible 99.45
PLN023161036 synthase/transferase 99.45
cd03800398 GT1_Sucrose_synthase This family is most closely r 99.45
TIGR02095473 glgA glycogen/starch synthases, ADP-glucose type. 99.44
PRK14098489 glycogen synthase; Provisional 99.44
TIGR02472439 sucr_P_syn_N sucrose-phosphate synthase, putative, 99.44
cd04946407 GT1_AmsK_like This family is most closely related 99.43
PRK15179694 Vi polysaccharide biosynthesis protein TviE; Provi 99.42
cd03813475 GT1_like_3 This family is most closely related to 99.42
TIGR02918500 accessory Sec system glycosylation protein GtfA. M 99.41
PLN02939977 transferase, transferring glycosyl groups 99.41
cd05844367 GT1_like_7 Glycosyltransferases catalyze the trans 99.41
cd03791476 GT1_Glycogen_synthase_DULL1_like This family is mo 99.36
PRK15490578 Vi polysaccharide biosynthesis protein TviE; Provi 99.35
PLN02275371 transferase, transferring glycosyl groups 99.34
PF00534172 Glycos_transf_1: Glycosyl transferases group 1; In 99.34
PRK14099485 glycogen synthase; Provisional 99.34
PLN02846 462 digalactosyldiacylglycerol synthase 99.34
PLN02871465 UDP-sulfoquinovose:DAG sulfoquinovosyltransferase 99.33
cd03819355 GT1_WavL_like This family is most closely related 99.32
cd04951360 GT1_WbdM_like This family is most closely related 99.32
PRK10307412 putative glycosyl transferase; Provisional 99.31
cd03816415 GT1_ALG1_like This family is most closely related 99.29
PHA01630331 putative group 1 glycosyl transferase 99.29
cd03820348 GT1_amsD_like This family is most closely related 99.29
cd03817374 GT1_UGDG_like This family is most closely related 99.28
cd03804351 GT1_wbaZ_like This family is most closely related 99.28
cd03809365 GT1_mtfB_like This family is most closely related 99.27
cd03822366 GT1_ecORF704_like This family is most closely rela 99.27
cd03799355 GT1_amsK_like This is a family of GT1 glycosyltran 99.26
cd04955363 GT1_like_6 This family is most closely related to 99.26
PLN02501 794 digalactosyldiacylglycerol synthase 99.25
cd04949372 GT1_gtfA_like This family is most closely related 99.23
PRK10125405 putative glycosyl transferase; Provisional 99.23
cd03798377 GT1_wlbH_like This family is most closely related 99.23
cd04962371 GT1_like_5 This family is most closely related to 99.22
cd03811353 GT1_WabH_like This family is most closely related 99.21
cd03807365 GT1_WbnK_like This family is most closely related 99.21
cd03802335 GT1_AviGT4_like This family is most closely relate 99.2
cd03795357 GT1_like_4 This family is most closely related to 99.2
cd03801374 GT1_YqgM_like This family is most closely related 99.18
PRK09922359 UDP-D-galactose:(glucosyl)lipopolysaccharide-1,6-D 99.16
cd03793590 GT1_Glycogen_synthase_GSY2_like Glycogen synthase, 99.15
cd03823359 GT1_ExpE7_like This family is most closely related 99.14
cd03808359 GT1_cap1E_like This family is most closely related 99.14
KOG1111|consensus 426 99.13
cd03814364 GT1_like_2 This family is most closely related to 99.13
cd03794394 GT1_wbuB_like This family is most closely related 99.06
COG0438381 RfaG Glycosyltransferase [Cell envelope biogenesis 98.97
TIGR03087397 stp1 sugar transferase, PEP-CTERM/EpsH1 system ass 98.96
cd03825365 GT1_wcfI_like This family is most closely related 98.92
COG0297487 GlgA Glycogen synthase [Carbohydrate transport and 98.89
cd01635229 Glycosyltransferase_GTB_type Glycosyltransferases 98.88
PRK05749425 3-deoxy-D-manno-octulosonic-acid transferase; Revi 98.68
KOG0853|consensus495 98.54
PF13692135 Glyco_trans_1_4: Glycosyl transferases group 1; PD 98.26
cd04950373 GT1_like_1 Glycosyltransferases catalyze the trans 98.21
PLN02605382 monogalactosyldiacylglycerol synthase 97.99
TIGR03713519 acc_sec_asp1 accessory Sec system protein Asp1. Th 97.84
cd03786363 GT1_UDP-GlcNAc_2-Epimerase Bacterial members of th 97.63
TIGR00236365 wecB UDP-N-acetylglucosamine 2-epimerase. Epimeras 97.61
PRK00025380 lpxB lipid-A-disaccharide synthase; Reviewed 97.45
PRK13608391 diacylglycerol glucosyltransferase; Provisional 97.4
PRK13609380 diacylglycerol glucosyltransferase; Provisional 97.28
TIGR01133348 murG undecaprenyldiphospho-muramoylpentapeptide be 97.24
TIGR02094601 more_P_ylases alpha-glucan phosphorylases. This fa 97.02
cd03785350 GT1_MurG MurG is an N-acetylglucosaminyltransferas 96.91
PRK00726357 murG undecaprenyldiphospho-muramoylpentapeptide be 96.87
TIGR00215385 lpxB lipid-A-disaccharide synthase. Lipid-A precur 96.64
KOG1387|consensus465 96.64
PRK09814333 beta-1,6-galactofuranosyltransferase; Provisional 96.44
PF05693 633 Glycogen_syn: Glycogen synthase; InterPro: IPR0086 96.32
TIGR02919438 accessory Sec system glycosyltransferase GtfB. Mem 96.03
cd04299 778 GT1_Glycogen_Phosphorylase_like This family is mos 95.11
COG1519419 KdtA 3-deoxy-D-manno-octulosonic-acid transferase 94.92
PF06258311 Mito_fiss_Elm1: Mitochondrial fission ELM1; InterP 94.72
COG0816141 Predicted endonuclease involved in recombination ( 94.49
TIGR03590279 PseG pseudaminic acid biosynthesis-associated prot 93.64
PF13844468 Glyco_transf_41: Glycosyl transferase family 41; P 93.3
PF09949100 DUF2183: Uncharacterized conserved protein (DUF218 87.76
PF07429360 Glyco_transf_56: 4-alpha-L-fucosyltransferase glyc 87.47
PRK02797322 4-alpha-L-fucosyltransferase; Provisional 85.56
PF04577206 DUF563: Protein of unknown function (DUF563); Inte 80.8
TIGR00250130 RNAse_H_YqgF RNAse H-fold protein YqgF. This prote 80.08
>PRK10117 trehalose-6-phosphate synthase; Provisional Back     alignment and domain information 
Probab=100.00  E-value=2.7e-42  Score=297.06  Aligned_cols=128  Identities=38%  Similarity=0.661  Sum_probs=120.0

Q ss_pred             CEEEEEecCccccCCHHHHHHHHHHHHHhCCCCCCCeEEEEEecCCCCChhHHHHHHHHHHHHHHHHhcCCCCCCcccEE
Q psy9724           1 MSLVLSVDRLDYTKGLVHRLKAFETLLEKHPEHLEKVTLLQIAVPSRTDVKEYQDLKEEMDQLVGRINGRFTTPNWSPIR   80 (140)
Q Consensus         1 k~iil~VdRld~~KGi~~kl~A~~~~L~~~P~~~~kv~Lvqi~~psr~~~~~y~~~~~~l~~lv~~IN~~~g~~~~~pv~   80 (140)
                      +++|+||||+||+|||++||+|||+||++||+|++||+|+||+.|||+++++|++++++++++|++||++||+.+|.||+
T Consensus       255 ~~lilgVDRLDytKGi~~rl~Afe~fL~~~Pe~~gkvvlvQia~psR~~v~~Y~~l~~~v~~~vg~INg~fg~~~w~Pv~  334 (474)
T PRK10117        255 VQNIFSVERLDYSKGLPERFLAYEALLEKYPQHHGKIRYTQIAPTSRGDVQAYQDIRHQLETEAGRINGKYGQLGWTPLY  334 (474)
T ss_pred             CeEEEEecccccccCHHHHHHHHHHHHHhChhhcCCEEEEEEcCCCCCccHHHHHHHHHHHHHHHHHHhccCCCCceeEE
Confidence            58999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEeCCCCHHHHHHHHHHcCEEEECCCCCCCcee-----eecC----CceeeecCCCC
Q psy9724          81 YIYGCISQDELASFYRDAAVALVTPLRDEWSNS-----FSRS----GNFRIKSAPSG  128 (140)
Q Consensus        81 ~~~~~~~~~el~aly~~ADv~vvts~rdGmnLv-----A~~~----G~~~v~~~~gg  128 (140)
                      |+++.+++++++|||++|||++|||+|||||||     |||+    |.=+++-.+|.
T Consensus       335 y~~~~~~~~~l~alyr~ADv~lVTplRDGMNLVAkEyva~q~~~~~GvLILSefAGa  391 (474)
T PRK10117        335 YLNQHFDRKLLMKIFRYSDVGLVTPLRDGMNLVAKEYVAAQDPANPGVLVLSQFAGA  391 (474)
T ss_pred             EecCCCCHHHHHHHHHhccEEEecccccccccccchheeeecCCCCccEEEecccch
Confidence            999999999999999999999999999999998     6876    44455555543

>TIGR02398 gluc_glyc_Psyn glucosylglycerol-phosphate synthase Back     alignment and domain information
>PLN02205 alpha,alpha-trehalose-phosphate synthase [UDP-forming] Back     alignment and domain information
>COG0380 OtsA Trehalose-6-phosphate synthase [Carbohydrate transport and metabolism] Back     alignment and domain information
>PF00982 Glyco_transf_20: Glycosyltransferase family 20; InterPro: IPR001830 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>PLN03064 alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional Back     alignment and domain information
>TIGR02400 trehalose_OtsA alpha,alpha-trehalose-phosphate synthase [UDP-forming] Back     alignment and domain information
>PLN03063 alpha,alpha-trehalose-phosphate synthase (UDP-forming); Provisional Back     alignment and domain information
>PRK14501 putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional Back     alignment and domain information
>cd03788 GT1_TPS Trehalose-6-Phosphate Synthase (TPS) is a glycosyltransferase that catalyses the synthesis of alpha,alpha-1,1-trehalose-6-phosphate from glucose-6-phosphate using a UDP-glucose donor Back     alignment and domain information
>KOG1050|consensus Back     alignment and domain information
>PRK15484 lipopolysaccharide 1,2-N-acetylglucosaminetransferase; Provisional Back     alignment and domain information
>cd03792 GT1_Trehalose_phosphorylase Trehalose phosphorylase (TP) reversibly catalyzes trehalose synthesis and degradation from alpha-glucose-1-phosphate (alpha-Glc-1-P) and glucose Back     alignment and domain information
>TIGR03449 mycothiol_MshA UDP-N-acetylglucosamine: 1L-myo-inositol-1-phosphate 1-alpha-D-N-acetylglucosaminyltransferase Back     alignment and domain information
>TIGR03088 stp2 sugar transferase, PEP-CTERM/EpsH1 system associated Back     alignment and domain information
>cd03796 GT1_PIG-A_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PLN02949 transferase, transferring glycosyl groups Back     alignment and domain information
>cd03806 GT1_ALG11_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PHA01633 putative glycosyl transferase group 1 Back     alignment and domain information
>PRK15427 colanic acid biosynthesis glycosyltransferase WcaL; Provisional Back     alignment and domain information
>cd03818 GT1_ExpC_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR02470 sucr_synth sucrose synthase Back     alignment and domain information
>cd03812 GT1_CapH_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03805 GT1_ALG2_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PLN00142 sucrose synthase Back     alignment and domain information
>PRK00654 glgA glycogen synthase; Provisional Back     alignment and domain information
>TIGR02149 glgA_Coryne glycogen synthase, Corynebacterium family Back     alignment and domain information
>cd03821 GT1_Bme6_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR02468 sucrsPsyn_pln sucrose phosphate synthase/possible sucrose phosphate phosphatase, plant Back     alignment and domain information
>PLN02316 synthase/transferase Back     alignment and domain information
>cd03800 GT1_Sucrose_synthase This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR02095 glgA glycogen/starch synthases, ADP-glucose type Back     alignment and domain information
>PRK14098 glycogen synthase; Provisional Back     alignment and domain information
>TIGR02472 sucr_P_syn_N sucrose-phosphate synthase, putative, glycosyltransferase domain Back     alignment and domain information
>cd04946 GT1_AmsK_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK15179 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>cd03813 GT1_like_3 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>TIGR02918 accessory Sec system glycosylation protein GtfA Back     alignment and domain information
>PLN02939 transferase, transferring glycosyl groups Back     alignment and domain information
>cd05844 GT1_like_7 Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds Back     alignment and domain information
>cd03791 GT1_Glycogen_synthase_DULL1_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PRK15490 Vi polysaccharide biosynthesis protein TviE; Provisional Back     alignment and domain information
>PLN02275 transferase, transferring glycosyl groups Back     alignment and domain information
>PF00534 Glycos_transf_1: Glycosyl transferases group 1; InterPro: IPR001296 The biosynthesis of disaccharides, oligosaccharides and polysaccharides involves the action of hundreds of different glycosyltransferases Back     alignment and domain information
>PRK14099 glycogen synthase; Provisional Back     alignment and domain information
>PLN02846 digalactosyldiacylglycerol synthase Back     alignment and domain information
>PLN02871 UDP-sulfoquinovose:DAG sulfoquinovosyltransferase Back     alignment and domain information
>cd03819 GT1_WavL_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd04951 GT1_WbdM_like This family is most closely related to the GT1 family of glycosyltransferases and is named after WbdM in Escherichia coli Back     alignment and domain information
>PRK10307 putative glycosyl transferase; Provisional Back     alignment and domain information
>cd03816 GT1_ALG1_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PHA01630 putative group 1 glycosyl transferase Back     alignment and domain information
>cd03820 GT1_amsD_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03817 GT1_UGDG_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03804 GT1_wbaZ_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03809 GT1_mtfB_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03822 GT1_ecORF704_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03799 GT1_amsK_like This is a family of GT1 glycosyltransferases found specifically in certain bacteria Back     alignment and domain information
>cd04955 GT1_like_6 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>PLN02501 digalactosyldiacylglycerol synthase Back     alignment and domain information
>cd04949 GT1_gtfA_like This family is most closely related to the GT1 family of glycosyltransferases and is named after gtfA in Streptococcus gordonii, where it plays a role in the O-linked glycosylation of GspB, a cell surface glycoprotein involved in platelet binding Back     alignment and domain information
>PRK10125 putative glycosyl transferase; Provisional Back     alignment and domain information
>cd03798 GT1_wlbH_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd04962 GT1_like_5 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03811 GT1_WabH_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03807 GT1_WbnK_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03802 GT1_AviGT4_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03795 GT1_like_4 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03801 GT1_YqgM_like This family is most closely related to the GT1 family of glycosyltransferases and named after YqgM in Bacillus licheniformis about which little is known Back     alignment and domain information
>PRK09922 UDP-D-galactose:(glucosyl)lipopolysaccharide-1,6-D-galactosyltransferase; Provisional Back     alignment and domain information
>cd03793 GT1_Glycogen_synthase_GSY2_like Glycogen synthase, which is most closely related to the GT1 family of glycosyltransferases, catalyzes the transfer of a glucose molecule from UDP-glucose to a terminal branch of a glycogen molecule, a rate-limit step of glycogen biosynthesis Back     alignment and domain information
>cd03823 GT1_ExpE7_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03808 GT1_cap1E_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>KOG1111|consensus Back     alignment and domain information
>cd03814 GT1_like_2 This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>cd03794 GT1_wbuB_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>COG0438 RfaG Glycosyltransferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR03087 stp1 sugar transferase, PEP-CTERM/EpsH1 system associated Back     alignment and domain information
>cd03825 GT1_wcfI_like This family is most closely related to the GT1 family of glycosyltransferases Back     alignment and domain information
>COG0297 GlgA Glycogen synthase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd01635 Glycosyltransferase_GTB_type Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds Back     alignment and domain information
>PRK05749 3-deoxy-D-manno-octulosonic-acid transferase; Reviewed Back     alignment and domain information
>KOG0853|consensus Back     alignment and domain information
>PF13692 Glyco_trans_1_4: Glycosyl transferases group 1; PDB: 3OY2_A 3OY7_B 2Q6V_A 2HY7_A 3CV3_A 3CUY_A Back     alignment and domain information
>cd04950 GT1_like_1 Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds Back     alignment and domain information
>PLN02605 monogalactosyldiacylglycerol synthase Back     alignment and domain information
>TIGR03713 acc_sec_asp1 accessory Sec system protein Asp1 Back     alignment and domain information
>cd03786 GT1_UDP-GlcNAc_2-Epimerase Bacterial members of the UDP-N-Acetylglucosamine (GlcNAc) 2-Epimerase family are known to catalyze the reversible interconversion of UDP-GlcNAc and UDP-N-acetylmannosamine (UDP-ManNAc) Back     alignment and domain information
>TIGR00236 wecB UDP-N-acetylglucosamine 2-epimerase Back     alignment and domain information
>PRK00025 lpxB lipid-A-disaccharide synthase; Reviewed Back     alignment and domain information
>PRK13608 diacylglycerol glucosyltransferase; Provisional Back     alignment and domain information
>PRK13609 diacylglycerol glucosyltransferase; Provisional Back     alignment and domain information
>TIGR01133 murG undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase Back     alignment and domain information
>TIGR02094 more_P_ylases alpha-glucan phosphorylases Back     alignment and domain information
>cd03785 GT1_MurG MurG is an N-acetylglucosaminyltransferase, the last enzyme involved in the intracellular phase of peptidoglycan biosynthesis Back     alignment and domain information
>PRK00726 murG undecaprenyldiphospho-muramoylpentapeptide beta-N- acetylglucosaminyltransferase; Provisional Back     alignment and domain information
>TIGR00215 lpxB lipid-A-disaccharide synthase Back     alignment and domain information
>KOG1387|consensus Back     alignment and domain information
>PRK09814 beta-1,6-galactofuranosyltransferase; Provisional Back     alignment and domain information
>PF05693 Glycogen_syn: Glycogen synthase; InterPro: IPR008631 This family consists of the eukaryotic glycogen synthase proteins GYS1, GYS2 and GYS3 Back     alignment and domain information
>TIGR02919 accessory Sec system glycosyltransferase GtfB Back     alignment and domain information
>cd04299 GT1_Glycogen_Phosphorylase_like This family is most closely related to the oligosaccharide phosphorylase domain family and other unidentified sequences Back     alignment and domain information
>COG1519 KdtA 3-deoxy-D-manno-octulosonic-acid transferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF06258 Mito_fiss_Elm1: Mitochondrial fission ELM1; InterPro: IPR009367 This family consists of several hypothetical eukaryotic and prokaryotic proteins Back     alignment and domain information
>COG0816 Predicted endonuclease involved in recombination (possible Holliday junction resolvase in Mycoplasmas and B Back     alignment and domain information
>TIGR03590 PseG pseudaminic acid biosynthesis-associated protein PseG Back     alignment and domain information
>PF13844 Glyco_transf_41: Glycosyl transferase family 41; PDB: 3PE4_C 3PE3_D 3TAX_C 2XGO_A 2JLB_B 2XGM_A 2VSY_B 2XGS_B 2VSN_A Back     alignment and domain information
>PF09949 DUF2183: Uncharacterized conserved protein (DUF2183); InterPro: IPR019236 This domain, found in various bacterial and fungal proteins, has no known function Back     alignment and domain information
>PF07429 Glyco_transf_56: 4-alpha-L-fucosyltransferase glycosyl transferase group 56; InterPro: IPR009993 This family contains the bacterial enzyme 4-alpha-L-fucosyltransferase (Fuc4NAc transferase) (approximately 360 residues long) Back     alignment and domain information
>PRK02797 4-alpha-L-fucosyltransferase; Provisional Back     alignment and domain information
>PF04577 DUF563: Protein of unknown function (DUF563); InterPro: IPR007657 This is a family of uncharacterised glycosyltransferases belonging to glycosyltransferase family 61 Back     alignment and domain information
>TIGR00250 RNAse_H_YqgF RNAse H-fold protein YqgF Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query140
1uqu_A482 Trehalose-6-Phosphate From E. Coli Bound With Udp-G 2e-22
1gz5_A456 Trehalose-6-Phosphate Synthase. Otsa Length = 456 2e-22
2wtx_A474 Insight Into The Mechanism Of Enzymatic Glycosyltra 2e-22
>pdb|1UQU|A Chain A, Trehalose-6-Phosphate From E. Coli Bound With Udp-Glucose. Length = 482 Back     alignment and structure 
Iteration: 1

 Score =  100 bits (250), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 47/105 (44%), Positives = 68/105 (64%)
Query: 4   VLSVDRLDYTKGLVHRLKAFETLLEKHPEHLEKVTLLQIAVPSRTDVKEYQDLKEEMDQL 63
           + SV+RLDY+KGL  R  A+E LLEK+P+H  K+   QIA  SR DV+ YQD++ +++  
Sbjct: 258 IFSVERLDYSKGLPERFLAYEALLEKYPQHHGKIRYTQIAPTSRGDVQAYQDIRHQLENE 317
Query: 64  VGRINGRFTTPNWSPIRYIYGCISQDELASFYRDAAVALVTPLRD 108
            GRING++    W+P+ Y+     +  L   +R + V LVTPLRD
Sbjct: 318 AGRINGKYGQLGWTPLYYLNQHFDRKLLMKIFRYSDVGLVTPLRD 362
>pdb|1GZ5|A Chain A, Trehalose-6-Phosphate Synthase. Otsa Length = 456 Back     alignment and structure
>pdb|2WTX|A Chain A, Insight Into The Mechanism Of Enzymatic Glycosyltransfer With Retention Through The Synthesis And Analysis Of Bisubstrate Glycomimetics Of Trehalose-6-Phosphate Synthase Length = 474 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query140
1uqt_A482 Alpha, alpha-trehalose-phosphate synthase; glycosy 1e-62
3t5t_A496 Putative glycosyltransferase; GTB fold, pseudoglyc 4e-53
3c48_A438 Predicted glycosyltransferases; retaining glycosyl 2e-06
2r60_A499 Glycosyl transferase, group 1; rossmann-fold; 1.80 6e-06
2x6q_A416 Trehalose-synthase TRET; biosynthetic protein; 2.2 9e-05
2gek_A406 Phosphatidylinositol mannosyltransferase (PIMA); G 1e-04
>1uqt_A Alpha, alpha-trehalose-phosphate synthase; glycosyltransferase, transferase; HET: U2F; 2.0A {Escherichia coli} SCOP: c.87.1.6 PDB: 1uqu_A* 2wtx_A* 1gz5_A* Length = 482 Back     alignment and structure
 Score =  197 bits (504), Expect = 1e-62
 Identities = 47/106 (44%), Positives = 68/106 (64%)

Query: 3   LVLSVDRLDYTKGLVHRLKAFETLLEKHPEHLEKVTLLQIAVPSRTDVKEYQDLKEEMDQ 62
            + SV+RLDY+KGL  R  A+E LLEK+P+H  K+   QIA  SR DV+ YQD++ +++ 
Sbjct: 257 NIFSVERLDYSKGLPERFLAYEALLEKYPQHHGKIRYTQIAPTSRGDVQAYQDIRHQLEN 316

Query: 63  LVGRINGRFTTPNWSPIRYIYGCISQDELASFYRDAAVALVTPLRD 108
             GRING++    W+P+ Y+     +  L   +R + V LVTPLRD
Sbjct: 317 EAGRINGKYGQLGWTPLYYLNQHFDRKLLMKIFRYSDVGLVTPLRD 362
>3t5t_A Putative glycosyltransferase; GTB fold, pseudoglycosyltransferase; 1.70A {Streptomyces hygroscopicus} PDB: 3t7d_A* Length = 496 Back     alignment and structure
>3c48_A Predicted glycosyltransferases; retaining glycosyltransferase, beta alpha beta, substrate AS catalysis; 2.10A {Corynebacterium glutamicum} PDB: 3c4v_A* 3c4q_A* Length = 438 Back     alignment and structure
>2r60_A Glycosyl transferase, group 1; rossmann-fold; 1.80A {Halothermothrix orenii} PDB: 2r66_A* 2r68_A* Length = 499 Back     alignment and structure
>2x6q_A Trehalose-synthase TRET; biosynthetic protein; 2.20A {Pyrococcus horikoshii} PDB: 2x6r_A 2xa1_A 2xa2_A* 2xa9_A* 2xmp_A* Length = 416 Back     alignment and structure
>2gek_A Phosphatidylinositol mannosyltransferase (PIMA); GT4 glycosyltransferase, rossmann fold, complex; HET: GDP; 2.40A {Mycobacterium smegmatis} PDB: 2gej_A* Length = 406 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query140
1uqt_A482 Alpha, alpha-trehalose-phosphate synthase; glycosy 99.97
3t5t_A496 Putative glycosyltransferase; GTB fold, pseudoglyc 99.97
3oy2_A413 Glycosyltransferase B736L; rossmann fold, GDP-mann 99.64
2bfw_A200 GLGA glycogen synthase; glycosyltransferase family 99.54
3qhp_A166 Type 1 capsular polysaccharide biosynthesis prote 99.54
3c48_A438 Predicted glycosyltransferases; retaining glycosyl 99.53
3fro_A439 GLGA glycogen synthase; glycosyltransferase family 99.53
2x6q_A416 Trehalose-synthase TRET; biosynthetic protein; 2.2 99.52
3vue_A536 GBSS-I, granule-bound starch synthase 1, chloropla 99.51
1rzu_A485 Glycogen synthase 1; glycosyl-transferase, GT-B fo 99.49
2qzs_A485 Glycogen synthase; glycosyl-transferase, GT-B fold 99.48
2r60_A499 Glycosyl transferase, group 1; rossmann-fold; 1.80 99.48
3okp_A394 GDP-mannose-dependent alpha-(1-6)-phosphatidylino 99.46
3s28_A 816 Sucrose synthase 1; glycosyltransferase, sucrose m 99.45
2iuy_A342 Avigt4, glycosyltransferase; antibiotics, family G 99.42
2f9f_A177 First mannosyl transferase (WBAZ-1); alpha-beta pr 99.38
2vsy_A568 XCC0866; transferase, glycosyl transferase, GT-B, 99.38
2gek_A406 Phosphatidylinositol mannosyltransferase (PIMA); G 99.37
2x0d_A413 WSAF; GT4 family, transferase; HET: MSE; 2.28A {Ge 99.3
2iw1_A374 Lipopolysaccharide core biosynthesis protein RFAG; 99.28
2jjm_A394 Glycosyl transferase, group 1 family protein; anth 99.27
2hy7_A406 Glucuronosyltransferase GUMK; glycosyltransferases 99.07
3nb0_A 725 Glycogen [starch] synthase isoform 2; glycogen syn 99.0
1vgv_A384 UDP-N-acetylglucosamine 2-epimerase; structural ge 98.99
1v4v_A376 UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, t 98.85
3beo_A375 UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, a 98.82
2xci_A374 KDO-transferase, 3-deoxy-D-manno-2-octulosonic aci 98.65
1f0k_A364 MURG, UDP-N-acetylglucosamine-N-acetylmuramyl- (pe 98.49
3dzc_A396 UDP-N-acetylglucosamine 2-epimerase; structural ge 98.21
3ot5_A403 UDP-N-acetylglucosamine 2-epimerase; structural ge 97.66
3q3e_A631 HMW1C-like glycosyltransferase; N-glycosylation; 2 97.39
2c4m_A 796 Glycogen phosphorylase; allosteric control, phosph 97.07
3rhz_A339 GTF3, nucleotide sugar synthetase-like protein; gl 97.07
1l5w_A 796 Maltodextrin phosphorylase; enzymatic catalysis, s 96.88
2gj4_A 824 Glycogen phosphorylase, muscle form; transferase; 96.74
4hwg_A385 UDP-N-acetylglucosamine 2-epimerase; ssgcid, struc 95.82
2o6l_A170 UDP-glucuronosyltransferase 2B7; drug metabolism, 93.74
3otg_A412 CALG1; calicheamicin, TDP, structural genomics, PS 93.36
2p6p_A384 Glycosyl transferase; X-RAY-diffraction,urdamycina 91.8
4gyw_A723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 90.99
2iyf_A430 OLED, oleandomycin glycosyltransferase; antibiotic 90.92
3tsa_A391 SPNG, NDP-rhamnosyltransferase; glycosyltransferas 89.2
3s2u_A365 UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape 86.1
1psw_A348 ADP-heptose LPS heptosyltransferase II; structural 81.62
>1uqt_A Alpha, alpha-trehalose-phosphate synthase; glycosyltransferase, transferase; HET: U2F; 2.0A {Escherichia coli} SCOP: c.87.1.6 PDB: 1uqu_A* 2wtx_A* 1gz5_A* Back     alignment and structure
Probab=99.97  E-value=1.5e-31  Score=229.01  Aligned_cols=128  Identities=38%  Similarity=0.654  Sum_probs=122.3

Q ss_pred             CEEEEEecCccccCCHHHHHHHHHHHHHhCCCCCCCeEEEEEecCCCCChhHHHHHHHHHHHHHHHHhcCCCCCCcccEE
Q psy9724           1 MSLVLSVDRLDYTKGLVHRLKAFETLLEKHPEHLEKVTLLQIAVPSRTDVKEYQDLKEEMDQLVGRINGRFTTPNWSPIR   80 (140)
Q Consensus         1 k~iil~VdRld~~KGi~~kl~A~~~~L~~~P~~~~kv~Lvqi~~psr~~~~~y~~~~~~l~~lv~~IN~~~g~~~~~pv~   80 (140)
                      +++|++|||+|+.||++.+|+||++|++++|+|+++++|+|+|.|++++.++|+++++++++++++||.+||+.+|.||+
T Consensus       255 ~~vil~VgRl~~~Kgi~~ll~A~~~ll~~~p~~~~~v~Lv~vG~p~~~~~~~~~~l~~~l~~l~~~in~~~g~~~~~~v~  334 (482)
T 1uqt_A          255 VQNIFSVERLDYSKGLPERFLAYEALLEKYPQHHGKIRYTQIAPTSRGDVQAYQDIRHQLENEAGRINGKYGQLGWTPLY  334 (482)
T ss_dssp             CEEEEEECCBCGGGCHHHHHHHHHHHHHHCGGGTTTEEEEEECCBCSTTSHHHHHHHHHHHHHHHHHHHHHCBTTBCSEE
T ss_pred             CEEEEEEeCCcccCCHHHHHHHHHHHHHhCccccCcEEEEEEECCCccchHHHHHHHHHHHHHHHHHhhhcccCCCceEE
Confidence            57999999999999999999999999999999999999999999999888999999999999999999999999999999


Q ss_pred             EEeCCCCHHHHHHHHHHcCEEEECCCCCCCcee-----eecCCc-----eeeecCCCCcc
Q psy9724          81 YIYGCISQDELASFYRDAAVALVTPLRDEWSNS-----FSRSGN-----FRIKSAPSGNR  130 (140)
Q Consensus        81 ~~~~~~~~~el~aly~~ADv~vvts~rdGmnLv-----A~~~G~-----~~v~~~~gg~~  130 (140)
                      |+.+.++++++.++|++|||+++||++||||||     ||  |+     |+|.|+.||..
T Consensus       335 ~~~g~v~~~el~~ly~~ADv~v~pS~~EGfgLv~lEAmA~--g~~~~~gpvV~S~~~G~~  392 (482)
T 1uqt_A          335 YLNQHFDRKLLMKIFRYSDVGLVTPLRDGMNLVAKEYVAA--QDPANPGVLVLSQFAGAA  392 (482)
T ss_dssp             EECSCCCHHHHHHHHHHCSEEEECCSSBSCCHHHHHHHHH--SCTTSCCEEEEETTBGGG
T ss_pred             EeCCCCCHHHHHHHHHHccEEEECCCcccCCchHHHHHHh--CCCCCCCCEEEECCCCCH
Confidence            999999999999999999999999999999998     89  75     89999987754
>3t5t_A Putative glycosyltransferase; GTB fold, pseudoglycosyltransferase; 1.70A {Streptomyces hygroscopicus} PDB: 4f97_A* 4f96_B* 4f9f_A* 3t7d_A* Back     alignment and structure
>3oy2_A Glycosyltransferase B736L; rossmann fold, GDP-mannose, sugar, VIRU proteins, viral protein,transferase; 2.31A {Paramecium bursaria chlorella virus NY} PDB: 3oy7_A* Back     alignment and structure
>2bfw_A GLGA glycogen synthase; glycosyltransferase family 5 UDP/ADP-glucose-glycogen syntha rossman folds, transferase; 1.8A {Pyrococcus abyssi} SCOP: c.87.1.8 Back     alignment and structure
>3qhp_A Type 1 capsular polysaccharide biosynthesis prote (CAPJ); rossmann fold, glycosyltransferase, transferase; 1.50A {Helicobacter pylori} Back     alignment and structure
>3c48_A Predicted glycosyltransferases; retaining glycosyltransferase, beta alpha beta, substrate AS catalysis; 2.10A {Corynebacterium glutamicum} PDB: 3c4v_A* 3c4q_A* Back     alignment and structure
>3fro_A GLGA glycogen synthase; glycosyltransferase family, UDP/ADP-glucose-glycogen synthas rossman folds, transferase; HET: NHF; 2.50A {Pyrococcus abyssi} SCOP: c.87.1.8 PDB: 2bis_A* 3l01_A* Back     alignment and structure
>2x6q_A Trehalose-synthase TRET; biosynthetic protein; 2.20A {Pyrococcus horikoshii} PDB: 2x6r_A 2xa1_A 2xa2_A* 2xa9_A* 2xmp_A* Back     alignment and structure
>3vue_A GBSS-I, granule-bound starch synthase 1, chloroplastic/amyloplastic; rossmann fold, glycosyltransferase, transferase; 2.70A {Oryza sativa japonica group} PDB: 3vuf_A* Back     alignment and structure
>1rzu_A Glycogen synthase 1; glycosyl-transferase, GT-B fold, rossmann fold, ADP-binding, transferase; HET: ADP; 2.30A {Agrobacterium tumefaciens} SCOP: c.87.1.8 PDB: 1rzv_A Back     alignment and structure
>2qzs_A Glycogen synthase; glycosyl-transferase, GT-B fold, rossmann fold, closed-form, ADP and glucose binding, glycogen biosynthesis; HET: GLC ADP 250; 2.20A {Escherichia coli} PDB: 2r4t_A* 2r4u_A* 3guh_A* 3cx4_A* 3cop_A* 3d1j_A Back     alignment and structure
>2r60_A Glycosyl transferase, group 1; rossmann-fold; 1.80A {Halothermothrix orenii} PDB: 2r66_A* 2r68_A* Back     alignment and structure
>3okp_A GDP-mannose-dependent alpha-(1-6)-phosphatidylino monomannoside mannosyltransferase...; GT-B fold, alpha-mannosyltransferase; HET: GDD; 2.00A {Corynebacterium glutamicum} PDB: 3okc_A* 3oka_A* Back     alignment and structure
>3s28_A Sucrose synthase 1; glycosyltransferase, sucrose metabolism, sugar donar complex rossmann fold, GT-B fold, glycosyltansferase, UDP-glucose; HET: UDP LCN NHF; 2.80A {Arabidopsis thaliana} PDB: 3s27_A* 3s29_A* Back     alignment and structure
>2iuy_A Avigt4, glycosyltransferase; antibiotics, family GT-4, avilamycin A; HET: MES; 2.1A {Streptomyces viridochromogenes} PDB: 2iv3_A* Back     alignment and structure
>2f9f_A First mannosyl transferase (WBAZ-1); alpha-beta protein, structural genomics, PSI, protein struct initiative; 1.80A {Archaeoglobus fulgidus} SCOP: c.87.1.8 Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2gek_A Phosphatidylinositol mannosyltransferase (PIMA); GT4 glycosyltransferase, rossmann fold, complex; HET: GDP; 2.40A {Mycobacterium smegmatis} PDB: 2gej_A* Back     alignment and structure
>2x0d_A WSAF; GT4 family, transferase; HET: MSE; 2.28A {Geobacillus stearothermophilus} PDB: 2x0f_A* 2x0e_A* Back     alignment and structure
>2iw1_A Lipopolysaccharide core biosynthesis protein RFAG; transferase, lipopolysaccharide biosynthesis, family GT-4, glycosyltransferase, LPS; HET: U2F; 1.5A {Escherichia coli} SCOP: c.87.1.8 PDB: 2iv7_A* Back     alignment and structure
>2jjm_A Glycosyl transferase, group 1 family protein; anthrax, nucleotide, carbohydrate; 3.10A {Bacillus anthracis} PDB: 3mbo_A* Back     alignment and structure
>2hy7_A Glucuronosyltransferase GUMK; glycosyltransferases, xanthan, membrane-associated proteins; 1.90A {Xanthomonas campestris} PDB: 2q6v_A* 3cv3_A* 3cuy_A* Back     alignment and structure
>3nb0_A Glycogen [starch] synthase isoform 2; glycogen synthase, glucose-6-phosphate, yeast, allosteric AC transferase; HET: G6P; 2.41A {Saccharomyces cerevisiae} PDB: 3rt1_A* 3nch_A 3naz_A 3o3c_A* 3rsz_A* Back     alignment and structure
>1vgv_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, isomerase; HET: UD1; 2.31A {Escherichia coli} SCOP: c.87.1.3 PDB: 1f6d_A* Back     alignment and structure
>1v4v_A UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, two domains, homodimer, riken structural genomics/proteomics initiative, RSGI; HET: MSE; 1.80A {Thermus thermophilus} SCOP: c.87.1.3 Back     alignment and structure
>3beo_A UDP-N-acetylglucosamine 2-epimerase; UDP-GLCNAC, allosteric, regulation, isomerase; HET: UD1 UDP; 1.70A {Bacillus anthracis} PDB: 1o6c_A Back     alignment and structure
>2xci_A KDO-transferase, 3-deoxy-D-manno-2-octulosonic acid transferase; KDTA, GSEA, glycosyltransferase superfamily B,; HET: PG4; 2.00A {Aquifex aeolicus} PDB: 2xcu_A* Back     alignment and structure
>1f0k_A MURG, UDP-N-acetylglucosamine-N-acetylmuramyl- (pentapeptide) pyrophosphoryl-undecaprenol...; rossmann fold, transferase; 1.90A {Escherichia coli} SCOP: c.87.1.2 PDB: 1nlm_A* Back     alignment and structure
>3dzc_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, in diseases, isomerase, center for structural genomics of INFE diseases, csgid; 2.35A {Vibrio cholerae} Back     alignment and structure
>3ot5_A UDP-N-acetylglucosamine 2-epimerase; structural genomics, center for structural genomics of infec diseases, csgid, alpha beta; HET: PGE; 2.20A {Listeria monocytogenes} Back     alignment and structure
>3q3e_A HMW1C-like glycosyltransferase; N-glycosylation; 2.10A {Actinobacillus pleuropneumoniae serovaorganism_taxid} PDB: 3q3h_A* 3q3i_A Back     alignment and structure
>2c4m_A Glycogen phosphorylase; allosteric control, phosphate dependence, starch degrading, transferase, glycosyltransferase; HET: PLP; 1.9A {Corynebacterium callunae} Back     alignment and structure
>3rhz_A GTF3, nucleotide sugar synthetase-like protein; glycosyltransferase, transferase; HET: UDP; 1.90A {Streptococcus parasanguinis} PDB: 3qkw_A* Back     alignment and structure
>1l5w_A Maltodextrin phosphorylase; enzymatic catalysis, substrate complex, trans; HET: GLC PLP; 1.80A {Escherichia coli} SCOP: c.87.1.4 PDB: 1l5v_A* 1l6i_A* 2asv_A* 2av6_A* 2aw3_A* 2azd_A* 1qm5_A* 1e4o_A* 2ecp_A* 1ahp_A* Back     alignment and structure
>2gj4_A Glycogen phosphorylase, muscle form; transferase; HET: PLR 2TH; 1.60A {Oryctolagus cuniculus} SCOP: c.87.1.4 PDB: 2gm9_A* 1abb_A* 3nc4_A* 3l79_A* 2pyd_A* 2pyi_A* 3l7a_A* 3l7b_A* 3l7c_A* 3l7d_A* 2qnb_A* 1c8l_A* 1axr_A* 1gpy_A* 1e1y_A* 1lwo_A* 1pyg_A* 1uzu_A* 1lwn_A* 1xkx_A* ... Back     alignment and structure
>4hwg_A UDP-N-acetylglucosamine 2-epimerase; ssgcid, structural genomics, seattle structural genomics center for infectious disease, isomerase; 2.00A {Rickettsia bellii} Back     alignment and structure
>2o6l_A UDP-glucuronosyltransferase 2B7; drug metabolism, rossman, MAD, enzyme, nucleotide binding, sugar,UDP-glucuronosyltransferase, UGT; 1.80A {Homo sapiens} Back     alignment and structure
>3otg_A CALG1; calicheamicin, TDP, structural genomics, PSI-2, protein STRU initiative, center for eukaryotic structural genomics, CESG fold; HET: TYD; 2.08A {Micromonospora echinospora} PDB: 3oth_A* Back     alignment and structure
>2p6p_A Glycosyl transferase; X-RAY-diffraction,urdamycina-biosynthesis; 1.88A {Streptomyces fradiae} Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>2iyf_A OLED, oleandomycin glycosyltransferase; antibiotic resistance, glycosylation, enzyme, macrolide, carbohydrate; HET: ERY UDP; 1.7A {Streptomyces antibioticus} Back     alignment and structure
>3tsa_A SPNG, NDP-rhamnosyltransferase; glycosyltransferase; HET: GLC; 1.70A {Saccharopolyspora spinosa} PDB: 3uyk_A* 3uyl_A* Back     alignment and structure
>3s2u_A UDP-N-acetylglucosamine--N-acetylmuramyl-(pentape pyrophosphoryl-undecaprenol N-acetylglucosamine...; N-acetylglucosaminyl transferase; HET: UD1; 2.23A {Pseudomonas aeruginosa} Back     alignment and structure
>1psw_A ADP-heptose LPS heptosyltransferase II; structural genomics, NYSGXRC, LPS biosynthetic pathway, PSI, protein structure initiative; 2.00A {Escherichia coli} SCOP: c.87.1.7 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 140
d1uqta_456 c.87.1.6 (A:) Trehalose-6-phosphate synthase, OtsA 3e-21
>d1uqta_ c.87.1.6 (A:) Trehalose-6-phosphate synthase, OtsA {Escherichia coli [TaxId: 562]} Length = 456 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: UDP-Glycosyltransferase/glycogen phosphorylase
superfamily: UDP-Glycosyltransferase/glycogen phosphorylase
family: Trehalose-6-phosphate synthase, OtsA
domain: Trehalose-6-phosphate synthase, OtsA
species: Escherichia coli [TaxId: 562]

 Score = 86.1 bits (212), Expect = 3e-21
 Identities = 47/111 (42%), Positives = 69/111 (62%)

Query: 3   LVLSVDRLDYTKGLVHRLKAFETLLEKHPEHLEKVTLLQIAVPSRTDVKEYQDLKEEMDQ 62
            + SV+RLDY+KGL  R  A+E LLEK+P+H  K+   QIA  SR DV+ YQD++ +++ 
Sbjct: 256 NIFSVERLDYSKGLPERFLAYEALLEKYPQHHGKIRYTQIAPTSRGDVQAYQDIRHQLEN 315

Query: 63  LVGRINGRFTTPNWSPIRYIYGCISQDELASFYRDAAVALVTPLRDEWSNS 113
             GRING++    W+P+ Y+     +  L   +R + V LVTPLRD  +  
Sbjct: 316 EAGRINGKYGQLGWTPLYYLNQHFDRKLLMKIFRYSDVGLVTPLRDGMNLV 366

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query140
d1uqta_456 Trehalose-6-phosphate synthase, OtsA {Escherichia 99.97
d1rzua_477 Glycogen synthase 1, GlgA {Agrobacterium tumefacie 99.55
d2bfwa1196 Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxI 99.51
d2iw1a1370 Lipopolysaccharide core biosynthesis protein RfaG 99.42
d2f9fa1166 First mannosyl transferase WbaZ {Archaeoglobus ful 99.38
d2bisa1437 Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxI 99.27
>d1uqta_ c.87.1.6 (A:) Trehalose-6-phosphate synthase, OtsA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: UDP-Glycosyltransferase/glycogen phosphorylase
superfamily: UDP-Glycosyltransferase/glycogen phosphorylase
family: Trehalose-6-phosphate synthase, OtsA
domain: Trehalose-6-phosphate synthase, OtsA
species: Escherichia coli [TaxId: 562]

Probab=99.97  E-value=2.2e-32  Score=230.12  Aligned_cols=129  Identities=38%  Similarity=0.640  Sum_probs=124.7

Q ss_pred             CEEEEEecCccccCCHHHHHHHHHHHHHhCCCCCCCeEEEEEecCCCCChhHHHHHHHHHHHHHHHHhcCCCCCCcccEE
Q psy9724           1 MSLVLSVDRLDYTKGLVHRLKAFETLLEKHPEHLEKVTLLQIAVPSRTDVKEYQDLKEEMDQLVGRINGRFTTPNWSPIR   80 (140)
Q Consensus         1 k~iil~VdRld~~KGi~~kl~A~~~~L~~~P~~~~kv~Lvqi~~psr~~~~~y~~~~~~l~~lv~~IN~~~g~~~~~pv~   80 (140)
                      +++|++|||+|+.||++.+|+||++||++||+++++++|+|++.|++.+..+|.+++.++.++|++||++|++.+|.|++
T Consensus       254 ~~~il~V~Rld~~KGi~~~l~A~~~~l~~~p~~~~~v~lv~~~~~~~~~~~~~~~~~~ev~~lv~~in~~~~~~~~~~~v  333 (456)
T d1uqta_         254 VQNIFSVERLDYSKGLPERFLAYEALLEKYPQHHGKIRYTQIAPTSRGDVQAYQDIRHQLENEAGRINGKYGQLGWTPLY  333 (456)
T ss_dssp             CEEEEEECCBCGGGCHHHHHHHHHHHHHHCGGGTTTEEEEEECCBCSTTSHHHHHHHHHHHHHHHHHHHHHCBTTBCSEE
T ss_pred             CeEEEEeCCCchhhchHHHHHHHHHHHHhCccccccEEEEEEcCCcccchHHHHHHHHHHHHHHHHHHhhhccCCCCcee
Confidence            57999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEeCCCCHHHHHHHHHHcCEEEECCCCCCCcee-----eecCCce-----eeecCCCCccc
Q psy9724          81 YIYGCISQDELASFYRDAAVALVTPLRDEWSNS-----FSRSGNF-----RIKSAPSGNRT  131 (140)
Q Consensus        81 ~~~~~~~~~el~aly~~ADv~vvts~rdGmnLv-----A~~~G~~-----~v~~~~gg~~~  131 (140)
                      ++.+.++++++.++|+.|||+++||++||||||     ||  |.|     +|.|..||.+.
T Consensus       334 ~~~~~~~~~~l~a~~~~Adv~v~~s~~EG~~lv~~Ea~a~--~~p~~~g~lIlS~~~G~~~  392 (456)
T d1uqta_         334 YLNQHFDRKLLMKIFRYSDVGLVTPLRDGMNLVAKEYVAA--QDPANPGVLVLSQFAGAAN  392 (456)
T ss_dssp             EECSCCCHHHHHHHHHHCSEEEECCSSBSCCHHHHHHHHH--SCTTSCCEEEEETTBGGGG
T ss_pred             eccCCcCHHHHhHHHhhhceeecCCccCCCCcHHHHHHHh--CCCCCCCcEEEeCCCCCHH
Confidence            999999999999999999999999999999998     88  766     89999999875
>d1rzua_ c.87.1.8 (A:) Glycogen synthase 1, GlgA {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2bfwa1 c.87.1.8 (A:218-413) Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure
>d2iw1a1 c.87.1.8 (A:2-371) Lipopolysaccharide core biosynthesis protein RfaG {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f9fa1 c.87.1.8 (A:2-167) First mannosyl transferase WbaZ {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2bisa1 c.87.1.8 (A:1-437) Glycogen synthase 1, GlgA {Pyrococcus abyssi [TaxId: 29292]} Back     information, alignment and structure