Psyllid ID: psy9754


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300------
MSEIWDWELICKEGTEGIKLLVIWIMDIVTYDLSIERVSQRYDVKINSLAGGVDPSSDEKTTDIVSNSVWSFNPNNKQWTQEPNMTYPRKIFSFVSCLDKIYAIGGQDCKTLLSSVECYDPVAHTWEDVAPLKIARMGMAVAEINDKIWIAGGYTGDKMNPVTDKVECYDPRTNTWTTLATKLRYPRYLATLVSVNNEKLYIIGGASQTDATNTQKMYSVSDLDVFVSNEKEWKFVTELVVPRHAHSASVLSSQILIIGGVTTVYKRTLKSVECWCFDRQAWIKGVSGLPATILGHSSVALPLKSN
ccEEEEcEEEEEEccccccEEEEEEcccccccccccccccccccEEEEEEcccccccccccccccccEEEEEEcccccccccccccccccEEEEEEEccEEEEEccccccccccEEEEEEccccEEEEEcccccccEEEEEEEEccEEEEEcccccccccccccEEEEEEcccccEEEccccccccccccEEEEEEccEEEEEccccccccccccccccccEEEEEEcccccEEEcccccccccccEEEEEccEEEEEccccccccccccEEEEEEcccccEEEcccccccccEEcEEEEEEcccc
cccccEEEEccccccccccEEEEEccccccEEEEccccccccccEEEEEccEEEEEEccccccccccEEEEEccccccEEEEcccccccccEEEEEEccEEEEEEcccccccccEEEEEccccccEEEEcccccccccEEEEEEccEEEEEEccccccccccccEEEEEcccccccEEEcccccccccccEEEEEEccEEEEEEcccccccccccccccccEEEEEccccccEEEEccccccccccEEEEEccEEEEEEccccccccEEcEEEEEcccccccEEccccccccccccEEEEEEcccc
MSEIWDWELICKEGTEGIKLLVIWIMDIVTYDLSIERVSQRYDVKinslaggvdpssdekttdiVSNSVwsfnpnnkqwtqepnmtyprkiFSFVSCLDKIYAIGGQDCKTLlssvecydpvahtwedvAPLKIARMGMAVAEINDKIwiaggytgdkmnpvtdkvecydprtntwttlatklrypRYLATLVSVNNEKLYIIggasqtdatntqkmysvsDLDVFVSNEKEWKFVTELvvprhahsasvlsSQILIIGGVTTVYKRTLKSVEcwcfdrqawikgvsglpatilghssvalplksn
MSEIWDWELICKEGTEGIKLLVIWIMDIVTYDLSIERVSQRYDVKINslaggvdpssdeKTTDIVSNSvwsfnpnnkqwtqepnmtyPRKIFSFVSCLDKIYAIGGQDCKTLLSSVECYDPVAHTWEDVAPLKIARMGMAVAEINDKIWIAGgytgdkmnpvtdkvecydprtntwttlatklrypRYLATLVSVNNEKLYIIGGAsqtdatntQKMYSVSDLDVFVSNEKEWKFVTELVVPRHahsasvlssqiliIGGVTTVYKRTLKSVECWCFDRQAWIKGVSGLPATIlghssvalplksn
MSEIWDWELICKEGTEGIKLLVIWIMDIVTYDLSIERVSQRYDVKINSLAGGVDPSSDEKTTDIVSNSVWSFNPNNKQWTQEPNMTYPRKIFSFVSCLDKIYAIGGQDCKTLLSSVECYDPVAHTWEDVAPLKIARMGMAVAEINDKIWIAGGYTGDKMNPVTDKVECYDPRTNTWTTLATKLRYPRYLATLVSVNNEKLYIIGGASQTDATNTQKMYSVSDLDVFVSNEKEWKFVTELVVPRHAHSASVLSSQILIIGGVTTVYKRTLKSVECWCFDRQAWIKGVSGLPATILGHSSVALPLKSN
***IWDWELICKEGTEGIKLLVIWIMDIVTYDLSIERVSQRYDVKINSLAG************IVSNSVWSFNPNNKQWTQEPNMTYPRKIFSFVSCLDKIYAIGGQDCKTLLSSVECYDPVAHTWEDVAPLKIARMGMAVAEINDKIWIAGGYTGDKMNPVTDKVECYDPRTNTWTTLATKLRYPRYLATLVSVNNEKLYIIGGASQTDATNTQKMYSVSDLDVFVSNEKEWKFVTELVVPRHAHSASVLSSQILIIGGVTTVYKRTLKSVECWCFDRQAWIKGVSGLPATILGHS*********
MSEIWDWELICKEGTEGIKLLVIWIMDIVTYDLSIERVSQRYDVKINSLAGGVDPSSDEKTTDIVSNSVWSFNPNNKQWTQEPNMTYPRKIFSFVSCLDKIYAIGGQDCKTLLSSVECYDPVAHTWEDVAPLKIARMGMAVAEINDKIWIAGGYTGDKMNPVTDKVECYDPRTNTWTTLATKLRYPRYLATLVSVNNEKLYIIGGASQTDATNTQKMYSVSDLDVFVSNEKEWKFVTELVVPRHAHSASVLSSQILIIGGVTTVYKRTLKSVECWCFDRQAWIKGVSGLPATILGHSSVALPLK**
MSEIWDWELICKEGTEGIKLLVIWIMDIVTYDLSIERVSQRYDVKINSLAGGVDPSSDEKTTDIVSNSVWSFNPNNKQWTQEPNMTYPRKIFSFVSCLDKIYAIGGQDCKTLLSSVECYDPVAHTWEDVAPLKIARMGMAVAEINDKIWIAGGYTGDKMNPVTDKVECYDPRTNTWTTLATKLRYPRYLATLVSVNNEKLYIIGGASQTDATNTQKMYSVSDLDVFVSNEKEWKFVTELVVPRHAHSASVLSSQILIIGGVTTVYKRTLKSVECWCFDRQAWIKGVSGLPATILGHSSVALPLKSN
MSEIWDWELICKEGTEGIKLLVIWIMDIVTYDLSIERVSQRYDVKINSLAGGVDPSSDEKTTDIVSNSVWSFNPNNKQWTQEPNMTYPRKIFSFVSCLDKIYAIGGQDCKTLLSSVECYDPVAHTWEDVAPLKIARMGMAVAEINDKIWIAGGYTGDKMNPVTDKVECYDPRTNTWTTLATKLRYPRYLATLVSVNNEKLYIIGGASQTDATNTQKMYSVSDLDVFVSNEKEWKFVTELVVPRHAHSASVLSSQILIIGGVTTVYKRTLKSVECWCFDRQAWIKGVSGLPATILGHSSVALPLKS*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSEIWDWELICKEGTEGIKLLVIWIMDIVTYDLSIERVSQRYDVKINSLAGGVDPSSDEKTTDIVSNSVWSFNPNNKQWTQEPNMTYPRKIFSFVSCLDKIYAIGGQDCKTLLSSVECYDPVAHTWEDVAPLKIARMGMAVAEINDKIWIAGGYTGDKMNPVTDKVECYDPRTNTWTTLATKLRYPRYLATLVSVNNEKLYIIGGASQTDATNTQKMYSVSDLDVFVSNEKEWKFVTELVVPRHAHSASVLSSQILIIGGVTTVYKRTLKSVECWCFDRQAWIKGVSGLPATILGHSSVALPLKSN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query306 2.2.26 [Sep-21-2011]
Q25386916 Beta-scruin OS=Limulus po N/A N/A 0.816 0.272 0.301 1e-23
Q25390918 Alpha-scruin OS=Limulus p N/A N/A 0.820 0.273 0.319 3e-22
Q08CY1641 Kelch-like protein 22 OS= no N/A 0.705 0.336 0.285 1e-19
Q5RG82643 Influenza virus NS1A-bind no N/A 0.689 0.328 0.311 9e-19
Q9C0H6718 Kelch-like protein 4 OS=H yes N/A 0.516 0.220 0.333 1e-18
E1B932568 Kelch-like protein 12 OS= yes N/A 0.650 0.350 0.285 1e-18
Q6NRH0564 Kelch-like protein 12 OS= N/A N/A 0.653 0.354 0.292 1e-18
Q3B7M1616 Kelch-like protein 36 OS= yes N/A 0.810 0.402 0.277 2e-18
Q53G59568 Kelch-like protein 12 OS= no N/A 0.650 0.350 0.285 2e-18
Q8BWA5634 Kelch-like protein 31 OS= no N/A 0.803 0.388 0.266 2e-18
>sp|Q25386|SCRB_LIMPO Beta-scruin OS=Limulus polyphemus PE=2 SV=1 Back     alignment and function desciption
 Score =  110 bits (275), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 78/259 (30%), Positives = 122/259 (47%), Gaps = 9/259 (3%)

Query: 49  LAGGVDPSSDEKTTDIVSNSVWSFNPNNKQWTQEPNMTYPRKIFSFVSCLDKIYAIGGQD 108
           + GG DP        + +   + +  ++ +WT+  +M   R   S V   D IY IGG+D
Sbjct: 641 VTGGCDPHIRCWGEMVATKMTFVYRLSSNKWTRVADMHSARSHHSMVVFNDSIYVIGGRD 700

Query: 109 CKTLLS-SVECYDPVAHTWEDVAPLKIARMGMAVAEINDKIWIAGGYT---GDKMN-PVT 163
               LS SVE Y P    W    P+ + RMGMAV      +W+ GG T   G  +N PV 
Sbjct: 701 DSGRLSASVESYVPALDEWNQEKPMPLPRMGMAVVSHGGYLWVMGGVTSTKGGNINPPVL 760

Query: 164 DKVECYDPRTNTWTTLATKLRYPRYLATLVSVNNEKLYIIGGASQTDATNTQKMYSVSDL 223
           D V CYDP    W +    LR  R   + V V ++K+++ GGA+ +   N   + S+  +
Sbjct: 761 DDVICYDPVFKHWVS-GKPLRIARAFGSAV-VCDDKIWLCGGAAPSQDENNY-LVSIPAI 817

Query: 224 DVFVSNEKEWKFVTELVVPRHAHSASVLSSQILIIGGVTTVYKRTLKSVECWCFDRQAWI 283
           DV+ +   EW     L  PRH+     L S + +IGG+ +     +   E +  D    +
Sbjct: 818 DVYDNEALEWIQKATLSCPRHSSVVVALESCLYLIGGINSHELSAINRNELYTTDSDT-V 876

Query: 284 KGVSGLPATILGHSSVALP 302
           + +  LP  + G ++V +P
Sbjct: 877 QSIRELPVQLTGMAAVTIP 895




May have an enzymatic role. Found the acrosomal vesicle at the anterior of sperm but not in the acrosomal process.
Limulus polyphemus (taxid: 6850)
>sp|Q25390|SCRA_LIMPO Alpha-scruin OS=Limulus polyphemus PE=2 SV=1 Back     alignment and function description
>sp|Q08CY1|KLH22_XENTR Kelch-like protein 22 OS=Xenopus tropicalis GN=klhl22 PE=2 SV=1 Back     alignment and function description
>sp|Q5RG82|NS1BA_DANRE Influenza virus NS1A-binding protein homolog A OS=Danio rerio GN=ivns1abpa PE=2 SV=1 Back     alignment and function description
>sp|Q9C0H6|KLHL4_HUMAN Kelch-like protein 4 OS=Homo sapiens GN=KLHL4 PE=1 SV=2 Back     alignment and function description
>sp|E1B932|KLH12_BOVIN Kelch-like protein 12 OS=Bos taurus GN=KLHL12 PE=2 SV=2 Back     alignment and function description
>sp|Q6NRH0|KLH12_XENLA Kelch-like protein 12 OS=Xenopus laevis GN=klhl12 PE=2 SV=2 Back     alignment and function description
>sp|Q3B7M1|KLH36_BOVIN Kelch-like protein 36 OS=Bos taurus GN=KLHL36 PE=2 SV=1 Back     alignment and function description
>sp|Q53G59|KLH12_HUMAN Kelch-like protein 12 OS=Homo sapiens GN=KLHL12 PE=1 SV=2 Back     alignment and function description
>sp|Q8BWA5|KLH31_MOUSE Kelch-like protein 31 OS=Mus musculus GN=Klhl31 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query306
242012975 705 conserved hypothetical protein [Pediculu 0.830 0.360 0.445 1e-57
357617630 1189 hypothetical protein KGM_22480 [Danaus p 0.820 0.211 0.461 3e-53
380030500 426 PREDICTED: beta-scruin-like [Apis florea 0.810 0.582 0.433 5e-50
328783989 1532 PREDICTED: hypothetical protein LOC72569 0.810 0.161 0.429 1e-49
340712200 1591 PREDICTED: hypothetical protein LOC10064 0.810 0.155 0.429 8e-48
350417027 1592 PREDICTED: hypothetical protein LOC10074 0.810 0.155 0.429 9e-48
383857028 1531 PREDICTED: uncharacterized protein LOC10 0.807 0.161 0.416 3e-47
91090143 1007 PREDICTED: similar to GA15783-PA [Tribol 0.820 0.249 0.390 9e-46
260798879 656 hypothetical protein BRAFLDRAFT_119957 [ 0.794 0.370 0.315 8e-25
241713267 810 hypothetical protein IscW_ISCW011124 [Ix 0.797 0.301 0.287 6e-24
>gi|242012975|ref|XP_002427199.1| conserved hypothetical protein [Pediculus humanus corporis] gi|212511486|gb|EEB14461.1| conserved hypothetical protein [Pediculus humanus corporis] Back     alignment and taxonomy information
 Score =  229 bits (584), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 115/258 (44%), Positives = 160/258 (62%), Gaps = 4/258 (1%)

Query: 49  LAGGVDPSSDEKTTDIVSNSVWSFNPNNKQWTQEPNMTYPRKIFSFVSCLDKIYAIGGQD 108
           LAGG DP  DE+   +V  +VWSF+P ++ W +E +M  PRK F   S   K+ AIGGQD
Sbjct: 449 LAGGTDPRDDEQGRTVVVGTVWSFDPISRAWFKETDMLTPRKNFGLSSVKGKLLAIGGQD 508

Query: 109 CK-TLLSSVECYDPVAHTWEDVAPLKIARMGMAVAEINDKIWIAGGYTGDKMNPVTDKVE 167
               +LSSVE YDP+   WE +  L + R G+AVA+  D +WIAGG T  +  P+T  VE
Sbjct: 509 KHGRILSSVEKYDPLTGNWEYITSLNVERTGVAVAKYKDTVWIAGGMTSSRKTPLTSSVE 568

Query: 168 CYDPRTNTWTTLATKLRYPRYLATLVSVNNEKLYIIGGASQTDATNTQKMYSVSDLDVFV 227
            YDP+ NTW   ++ LR+PR    L ++N+  LY IGGA +  +   +   S + +D++ 
Sbjct: 569 SYDPKYNTWVEQSS-LRFPRCFGCLFAMND-TLYYIGGAGRV-SEKERTTSSCNAIDIWN 625

Query: 228 SNEKEWKFVTELVVPRHAHSASVLSSQILIIGGVTTVYKRTLKSVECWCFDRQAWIKGVS 287
             EKEWK    + +PRH H+ + L +QILIIGGVTT Y R L  VEC+C +R+ W+KG++
Sbjct: 626 LKEKEWKLHFAMSIPRHGHAVAYLGTQILIIGGVTTAYLRALNDVECFCCERKTWVKGLT 685

Query: 288 GLPATILGHSSVALPLKS 305
            LP  + GH +V LP  S
Sbjct: 686 VLPVPLSGHGAVTLPPAS 703




Source: Pediculus humanus corporis

Species: Pediculus humanus

Genus: Pediculus

Family: Pediculidae

Order: Phthiraptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota

>gi|357617630|gb|EHJ70900.1| hypothetical protein KGM_22480 [Danaus plexippus] Back     alignment and taxonomy information
>gi|380030500|ref|XP_003698885.1| PREDICTED: beta-scruin-like [Apis florea] Back     alignment and taxonomy information
>gi|328783989|ref|XP_001121516.2| PREDICTED: hypothetical protein LOC725699 [Apis mellifera] Back     alignment and taxonomy information
>gi|340712200|ref|XP_003394651.1| PREDICTED: hypothetical protein LOC100648970 [Bombus terrestris] Back     alignment and taxonomy information
>gi|350417027|ref|XP_003491220.1| PREDICTED: hypothetical protein LOC100740056 [Bombus impatiens] Back     alignment and taxonomy information
>gi|383857028|ref|XP_003704008.1| PREDICTED: uncharacterized protein LOC100877623 [Megachile rotundata] Back     alignment and taxonomy information
>gi|91090143|ref|XP_971931.1| PREDICTED: similar to GA15783-PA [Tribolium castaneum] gi|270013747|gb|EFA10195.1| hypothetical protein TcasGA2_TC012387 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|260798879|ref|XP_002594427.1| hypothetical protein BRAFLDRAFT_119957 [Branchiostoma floridae] gi|229279661|gb|EEN50438.1| hypothetical protein BRAFLDRAFT_119957 [Branchiostoma floridae] Back     alignment and taxonomy information
>gi|241713267|ref|XP_002412086.1| hypothetical protein IscW_ISCW011124 [Ixodes scapularis] gi|215505163|gb|EEC14657.1| hypothetical protein IscW_ISCW011124 [Ixodes scapularis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query306
ZFIN|ZDB-GENE-030131-556601 keap1a "kelch-like ECH-associa 0.679 0.346 0.331 7.7e-23
FB|FBgn0032485627 CG9426 [Drosophila melanogaste 0.758 0.370 0.284 5.9e-21
UNIPROTKB|Q3B7M1616 KLHL36 "Kelch-like protein 36" 0.810 0.402 0.277 1.5e-20
UNIPROTKB|Q8N4N3616 KLHL36 "Kelch-like protein 36" 0.803 0.399 0.286 3.2e-20
UNIPROTKB|Q6NRH0564 klhl12 "Kelch-like protein 12" 0.669 0.363 0.303 7.2e-20
UNIPROTKB|Q9NR64748 KLHL1 "Kelch-like protein 1" [ 0.653 0.267 0.288 7.5e-20
MGI|MGI:3045305634 Klhl31 "kelch-like 31" [Mus mu 0.800 0.386 0.269 1.5e-19
ZFIN|ZDB-GENE-031222-2643 ivns1abpa "influenza virus NS1 0.643 0.306 0.317 1.6e-19
FB|FBgn0030114654 CG17754 [Drosophila melanogast 0.738 0.345 0.292 1.6e-19
ZFIN|ZDB-GENE-040426-1185601 zgc:63606 "zgc:63606" [Danio r 0.464 0.236 0.356 1.8e-19
ZFIN|ZDB-GENE-030131-556 keap1a "kelch-like ECH-associated protein 1a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
 Score = 272 (100.8 bits), Expect = 7.7e-23, P = 7.7e-23
 Identities = 75/226 (33%), Positives = 109/226 (48%)

Query:    66 SNSVWSFNPNNKQWTQEPNMTYPRKIFSFVSCLD-KIYAIGGQDCKTLLSSVECYDPVAH 124
             S S+  +NP   QWTQ   +  PR     V  +D  IYA+GG    T  +SVE YDP  +
Sbjct:   363 SGSLSCYNPMTNQWTQLAPLNTPRNRVG-VGVIDGSIYAVGGSHASTHHNSVERYDPETN 421

Query:   125 TWEDVAPLKIARMGMAVAEINDKIWIAGGYTGDKMNPVTDKVECYDPRTNTWTTLATKLR 184
              W  VAP+ +AR+G  VA     +++ GG+ GD      + VE Y P TNTW  +A  + 
Sbjct:   422 RWTFVAPMSVARLGAGVAACGGCLYVVGGFDGDNR---WNTVERYQPDTNTWQHVAP-MN 477

Query:   185 YPRYLATLVSVNNEKLYIIGGASQTDATNTQKMYSVSDLDVFVSNEKEWKFVTELVVPRH 244
               R    +V ++N  LY +GG        T + Y+++  DV       W+ +  +   R 
Sbjct:   478 TVRSGLGVVCMDNY-LYAVGGYDGQTQLKTMERYNITR-DV-------WEPMASMNHCRS 528

Query:   245 AHSASVLSSQILIIGGVTTVYKRTLKSVECWCFDRQAWIKGVSGLP 290
             AH  SV   +I ++GG        L SVEC+C     W   V+ +P
Sbjct:   529 AHGVSVYQCKIFVLGGFNQ--GGFLSSVECYCPASNVWTL-VTDMP 571


GO:0042221 "response to chemical stimulus" evidence=IGI
FB|FBgn0032485 CG9426 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
UNIPROTKB|Q3B7M1 KLHL36 "Kelch-like protein 36" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q8N4N3 KLHL36 "Kelch-like protein 36" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|Q6NRH0 klhl12 "Kelch-like protein 12" [Xenopus laevis (taxid:8355)] Back     alignment and assigned GO terms
UNIPROTKB|Q9NR64 KLHL1 "Kelch-like protein 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:3045305 Klhl31 "kelch-like 31" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-031222-2 ivns1abpa "influenza virus NS1A binding protein a" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0030114 CG17754 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1185 zgc:63606 "zgc:63606" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query306
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 2e-26
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 2e-24
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 9e-17
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 3e-14
smart0061247 smart00612, Kelch, Kelch domain 4e-13
pfam0134446 pfam01344, Kelch_1, Kelch motif 7e-10
pfam0134446 pfam01344, Kelch_1, Kelch motif 4e-09
smart0061247 smart00612, Kelch, Kelch domain 4e-08
PHA02713557 PHA02713, PHA02713, hypothetical protein; Provisio 5e-08
pfam1396450 pfam13964, Kelch_6, Kelch motif 1e-06
PRK14131 376 PRK14131, PRK14131, N-acetylneuraminic acid mutaro 1e-06
PLN02193470 PLN02193, PLN02193, nitrile-specifier protein 2e-06
PHA02790480 PHA02790, PHA02790, Kelch-like protein; Provisiona 5e-06
PHA03098534 PHA03098, PHA03098, kelch-like protein; Provisiona 2e-05
pfam1396450 pfam13964, Kelch_6, Kelch motif 2e-05
TIGR03548323 TIGR03548, mutarot_permut, cyclically-permuted mut 3e-05
TIGR03548323 TIGR03548, mutarot_permut, cyclically-permuted mut 3e-05
pfam1341849 pfam13418, Kelch_4, Galactose oxidase, central dom 3e-05
TIGR03548323 TIGR03548, mutarot_permut, cyclically-permuted mut 6e-05
PHA03098 534 PHA03098, PHA03098, kelch-like protein; Provisiona 1e-04
smart0061247 smart00612, Kelch, Kelch domain 2e-04
COG3055 381 COG3055, COG3055, Uncharacterized protein conserve 2e-04
pfam0764648 pfam07646, Kelch_2, Kelch motif 3e-04
TIGR03547 346 TIGR03547, muta_rot_YjhT, mutatrotase, YjhT family 5e-04
pfam1341548 pfam13415, Kelch_3, Galactose oxidase, central dom 6e-04
PLN02153 341 PLN02153, PLN02153, epithiospecifier protein 0.001
pfam1341548 pfam13415, Kelch_3, Galactose oxidase, central dom 0.002
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information
 Score =  108 bits (271), Expect = 2e-26
 Identities = 55/212 (25%), Positives = 96/212 (45%), Gaps = 15/212 (7%)

Query: 49  LAGGVDPSSDEKTTDIVSNSVWSFNPNNKQWTQEPNMTYPRKIFSFVSCLDKIYAIGGQD 108
             GG++ ++         NSV S++   K W + P + YPRK        ++IY IGG  
Sbjct: 299 FIGGMNKNNL------SVNSVVSYDTKTKSWNKVPELIYPRKNPGVTVFNNRIYVIGGIY 352

Query: 109 CKTLLSSVECYDPVAHTWEDVAPLKIARMGMAVAEINDKIWIAGGYTGDKMNPVTDKVEC 168
               L++VE + P    W +  PL   R    V  +N+ I++ GG    K + +   VEC
Sbjct: 353 NSISLNTVESWKPGESKWREEPPLIFPRYNPCVVNVNNLIYVIGGI--SKNDELLKTVEC 410

Query: 169 YDPRTNTWTTLATKLRYPRYLATLVSVNNEKLYIIGGASQTDATNTQKMYSVSDLDVFVS 228
           +   TN W+  +  L    Y    +  ++ K+Y+IGG S  D      +     ++ +  
Sbjct: 411 FSLNTNKWSKGS-PLPISHYGGCAIY-HDGKIYVIGGISYIDNIKVYNI-----VESYNP 463

Query: 229 NEKEWKFVTELVVPRHAHSASVLSSQILIIGG 260
              +W  ++ L  PR   S  + +++I ++GG
Sbjct: 464 VTNKWTELSSLNFPRINASLCIFNNKIYVVGG 495


Length = 534

>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|128874 smart00612, Kelch, Kelch domain Back     alignment and domain information
>gnl|CDD|201739 pfam01344, Kelch_1, Kelch motif Back     alignment and domain information
>gnl|CDD|201739 pfam01344, Kelch_1, Kelch motif Back     alignment and domain information
>gnl|CDD|128874 smart00612, Kelch, Kelch domain Back     alignment and domain information
>gnl|CDD|165086 PHA02713, PHA02713, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206134 pfam13964, Kelch_6, Kelch motif Back     alignment and domain information
>gnl|CDD|237617 PRK14131, PRK14131, N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>gnl|CDD|177844 PLN02193, PLN02193, nitrile-specifier protein Back     alignment and domain information
>gnl|CDD|165153 PHA02790, PHA02790, Kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|206134 pfam13964, Kelch_6, Kelch motif Back     alignment and domain information
>gnl|CDD|211835 TIGR03548, mutarot_permut, cyclically-permuted mutarotase family protein Back     alignment and domain information
>gnl|CDD|211835 TIGR03548, mutarot_permut, cyclically-permuted mutarotase family protein Back     alignment and domain information
>gnl|CDD|205596 pfam13418, Kelch_4, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|211835 TIGR03548, mutarot_permut, cyclically-permuted mutarotase family protein Back     alignment and domain information
>gnl|CDD|222983 PHA03098, PHA03098, kelch-like protein; Provisional Back     alignment and domain information
>gnl|CDD|128874 smart00612, Kelch, Kelch domain Back     alignment and domain information
>gnl|CDD|225597 COG3055, COG3055, Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>gnl|CDD|116261 pfam07646, Kelch_2, Kelch motif Back     alignment and domain information
>gnl|CDD|234253 TIGR03547, muta_rot_YjhT, mutatrotase, YjhT family Back     alignment and domain information
>gnl|CDD|222113 pfam13415, Kelch_3, Galactose oxidase, central domain Back     alignment and domain information
>gnl|CDD|177814 PLN02153, PLN02153, epithiospecifier protein Back     alignment and domain information
>gnl|CDD|222113 pfam13415, Kelch_3, Galactose oxidase, central domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 306
KOG4441|consensus571 100.0
PHA02713557 hypothetical protein; Provisional 100.0
KOG4441|consensus571 100.0
PLN02153341 epithiospecifier protein 100.0
PLN02193470 nitrile-specifier protein 100.0
PHA03098534 kelch-like protein; Provisional 100.0
PLN02153341 epithiospecifier protein 100.0
PHA02713557 hypothetical protein; Provisional 100.0
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 100.0
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 100.0
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 100.0
PLN02193470 nitrile-specifier protein 100.0
TIGR03547346 muta_rot_YjhT mutatrotase, YjhT family. Members of 100.0
PHA02790480 Kelch-like protein; Provisional 100.0
TIGR03548323 mutarot_permut cyclically-permuted mutatrotase fam 100.0
PRK14131376 N-acetylneuraminic acid mutarotase; Provisional 100.0
PHA03098534 kelch-like protein; Provisional 100.0
PHA02790480 Kelch-like protein; Provisional 100.0
KOG4693|consensus392 100.0
KOG4693|consensus392 100.0
KOG0379|consensus 482 99.98
KOG1230|consensus 521 99.97
KOG4152|consensus 830 99.96
KOG4152|consensus 830 99.96
KOG0379|consensus 482 99.96
KOG1230|consensus 521 99.95
COG3055381 Uncharacterized protein conserved in bacteria [Fun 99.88
COG3055381 Uncharacterized protein conserved in bacteria [Fun 99.82
KOG2437|consensus723 99.62
KOG2437|consensus 723 99.54
PF1396450 Kelch_6: Kelch motif 99.41
PF1396450 Kelch_6: Kelch motif 99.31
PF1341549 Kelch_3: Galactose oxidase, central domain 99.25
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 99.21
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 99.08
PF0764649 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is 99.05
PF1341549 Kelch_3: Galactose oxidase, central domain 99.05
PF0134447 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is 99.01
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 99.0
PF0764649 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is 98.96
PF1341849 Kelch_4: Galactose oxidase, central domain; PDB: 2 98.94
smart0061247 Kelch Kelch domain. 98.92
smart0061247 Kelch Kelch domain. 98.9
TIGR01640230 F_box_assoc_1 F-box protein interaction domain. Th 98.79
PLN02772 398 guanylate kinase 98.69
PF1385442 Kelch_5: Kelch motif 98.63
PF07250243 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterP 98.59
PF1385442 Kelch_5: Kelch motif 98.58
PLN02772 398 guanylate kinase 98.55
TIGR01640230 F_box_assoc_1 F-box protein interaction domain. Th 98.34
PF03089337 RAG2: Recombination activating protein 2; InterPro 98.32
PF03089337 RAG2: Recombination activating protein 2; InterPro 98.24
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 97.9
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 97.74
PF07893342 DUF1668: Protein of unknown function (DUF1668); In 97.71
PRK11138394 outer membrane biogenesis protein BamB; Provisiona 97.59
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 97.58
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 97.53
PF13360238 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 97.5
PF07893 342 DUF1668: Protein of unknown function (DUF1668); In 97.45
KOG2055|consensus514 97.45
TIGR03300377 assembly_YfgL outer membrane assembly lipoprotein 97.38
PF12768281 Rax2: Cortical protein marker for cell polarity 97.38
KOG2055|consensus514 97.24
PF12768 281 Rax2: Cortical protein marker for cell polarity 97.22
PF02191250 OLF: Olfactomedin-like domain; InterPro: IPR003112 97.21
smart00284255 OLF Olfactomedin-like domains. 96.9
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 96.88
smart00284255 OLF Olfactomedin-like domains. 96.86
PF08450246 SGL: SMP-30/Gluconolaconase/LRE-like region; Inter 96.82
PF02191250 OLF: Olfactomedin-like domain; InterPro: IPR003112 96.62
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 96.6
KOG0310|consensus 487 96.6
PF05096264 Glu_cyclase_2: Glutamine cyclotransferase; InterPr 96.43
PF03178321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 96.41
PF03178 321 CPSF_A: CPSF A subunit region; InterPro: IPR004871 96.4
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 96.07
PRK00178430 tolB translocation protein TolB; Provisional 96.03
KOG0310|consensus 487 96.03
PRK04922433 tolB translocation protein TolB; Provisional 95.95
cd00094194 HX Hemopexin-like repeats.; Hemopexin is a heme-bi 95.85
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 95.74
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 95.36
PRK04792448 tolB translocation protein TolB; Provisional 95.33
TIGR03075 527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 95.28
PRK05137435 tolB translocation protein TolB; Provisional 95.15
PRK11028330 6-phosphogluconolactonase; Provisional 95.12
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 94.9
PF12217367 End_beta_propel: Catalytic beta propeller domain o 94.88
PRK04792448 tolB translocation protein TolB; Provisional 94.88
PTZ00421 493 coronin; Provisional 94.85
cd00216 488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 94.85
KOG0316|consensus 307 94.62
cd00200289 WD40 WD40 domain, found in a number of eukaryotic 94.54
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 94.53
PRK13684334 Ycf48-like protein; Provisional 94.5
TIGR03866300 PQQ_ABC_repeats PQQ-dependent catabolism-associate 94.25
PRK05137435 tolB translocation protein TolB; Provisional 94.22
PF14870302 PSII_BNR: Photosynthesis system II assembly factor 93.96
PRK04922433 tolB translocation protein TolB; Provisional 93.92
PRK04043419 tolB translocation protein TolB; Provisional 93.91
KOG0646|consensus 476 93.8
KOG0316|consensus307 93.8
TIGR03075 527 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methan 93.63
KOG3545|consensus249 93.37
PLN00181793 protein SPA1-RELATED; Provisional 93.25
PRK00178430 tolB translocation protein TolB; Provisional 93.14
KOG0291|consensus 893 93.05
TIGR02800417 propeller_TolB tol-pal system beta propeller repea 93.01
PRK03629429 tolB translocation protein TolB; Provisional 92.69
PRK13684 334 Ycf48-like protein; Provisional 92.49
PF08268129 FBA_3: F-box associated domain; InterPro: IPR01318 92.07
cd00216 488 PQQ_DH Dehydrogenases with pyrrolo-quinoline quino 91.96
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 91.87
PRK11028330 6-phosphogluconolactonase; Provisional 91.78
KOG2321|consensus 703 91.74
PF02897414 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal 91.64
PLN00033398 photosystem II stability/assembly factor; Provisio 91.63
PRK03629429 tolB translocation protein TolB; Provisional 91.52
PRK04043419 tolB translocation protein TolB; Provisional 91.17
PRK02889427 tolB translocation protein TolB; Provisional 90.87
COG4946 668 Uncharacterized protein related to the periplasmic 90.58
KOG0266|consensus456 90.34
PF08268129 FBA_3: F-box associated domain; InterPro: IPR01318 89.99
KOG1036|consensus 323 89.82
COG1520370 FOG: WD40-like repeat [Function unknown] 89.58
KOG3545|consensus249 89.49
PF10282345 Lactonase: Lactonase, 7-bladed beta-propeller; Int 89.13
PTZ00421 493 coronin; Provisional 89.04
KOG0315|consensus311 88.38
cd00094194 HX Hemopexin-like repeats.; Hemopexin is a heme-bi 88.15
COG4257353 Vgb Streptogramin lyase [Defense mechanisms] 87.69
PLN00033398 photosystem II stability/assembly factor; Provisio 87.24
KOG2321|consensus 703 86.98
TIGR02658352 TTQ_MADH_Hv methylamine dehydrogenase heavy chain. 86.81
KOG0289|consensus506 86.42
PF02239369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 85.43
KOG0296|consensus 399 84.5
PF02239 369 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO 84.35
KOG1036|consensus323 83.73
PRK02889427 tolB translocation protein TolB; Provisional 83.37
PF09910339 DUF2139: Uncharacterized protein conserved in arch 83.03
PRK10115 686 protease 2; Provisional 82.77
KOG0315|consensus311 82.44
PTZ00420 568 coronin; Provisional 82.39
KOG0649|consensus325 81.23
PF09910339 DUF2139: Uncharacterized protein conserved in arch 80.92
KOG1332|consensus299 80.52
PF06433342 Me-amine-dh_H: Methylamine dehydrogenase heavy cha 80.24
>KOG4441|consensus Back     alignment and domain information
Probab=100.00  E-value=1.2e-48  Score=346.16  Aligned_cols=276  Identities=30%  Similarity=0.541  Sum_probs=248.0

Q ss_pred             ceeEEecccccc--eeEEEEEEeec--CceeeecccccccccceE------EEEeCccCc-CCCCcccceeeceEEEEeC
Q psy9754           6 DWELICKEGTEG--IKLLVIWIMDI--VTYDLSIERVSQRYDVKI------NSLAGGVDP-SSDEKTTDIVSNSVWSFNP   74 (306)
Q Consensus         6 ~~~l~~~gG~~~--~~~~~~~~~~~--~~W~~~~~~p~~r~~~~~------i~v~GG~~~-~~~~~~~~~~~~~~~~~d~   74 (306)
                      .+.|+++||...  .....+..||+  +.|..+++||.+|..+++      ||++||++. ..       .++++++||+
T Consensus       284 ~~~l~~vGG~~~~~~~~~~ve~yd~~~~~w~~~a~m~~~r~~~~~~~~~~~lYv~GG~~~~~~-------~l~~ve~YD~  356 (571)
T KOG4441|consen  284 SGKLVAVGGYNRQGQSLRSVECYDPKTNEWSSLAPMPSPRCRVGVAVLNGKLYVVGGYDSGSD-------RLSSVERYDP  356 (571)
T ss_pred             CCeEEEECCCCCCCcccceeEEecCCcCcEeecCCCCcccccccEEEECCEEEEEccccCCCc-------ccceEEEecC
Confidence            468999999864  55668999999  679999999999998888      999999984 32       6899999999


Q ss_pred             CCCCeeeCCCCCCCccceeeEEECCEEEEEccCCCCCCCceeEEEeCCCCcEEeccCCcccccceeeEEECCEEEEEccc
Q psy9754          75 NNKQWTQEPNMTYPRKIFSFVSCLDKIYAIGGQDCKTLLSSVECYDPVAHTWEDVAPLKIARMGMAVAEINDKIWIAGGY  154 (306)
Q Consensus        75 ~t~~W~~~~~~~~~~~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~d~~~~~w~~~~~~~~~~~~~~~~~~~~~iyv~GG~  154 (306)
                      .+++|..+++|+.+|..+++++++++||++||.++...++++++|||.+++|+..++|+..|.++++++++++||++||.
T Consensus       357 ~~~~W~~~a~M~~~R~~~~v~~l~g~iYavGG~dg~~~l~svE~YDp~~~~W~~va~m~~~r~~~gv~~~~g~iYi~GG~  436 (571)
T KOG4441|consen  357 RTNQWTPVAPMNTKRSDFGVAVLDGKLYAVGGFDGEKSLNSVECYDPVTNKWTPVAPMLTRRSGHGVAVLGGKLYIIGGG  436 (571)
T ss_pred             CCCceeccCCccCccccceeEEECCEEEEEeccccccccccEEEecCCCCcccccCCCCcceeeeEEEEECCEEEEEcCc
Confidence            99999999999999999999999999999999999899999999999999999999999999999999999999999998


Q ss_pred             CCCCCCCCCccEEEEeCCCCeeEEcccccCCcceeEEEEEEeCCEEEEEcCCCCCCCCCcccccccceeeEEECCCCceE
Q psy9754         155 TGDKMNPVTDKVECYDPRTNTWTTLATKLRYPRYLATLVSVNNEKLYIIGGASQTDATNTQKMYSVSDLDVFVSNEKEWK  234 (306)
Q Consensus       155 ~~~~~~~~~~~~~~~d~~~~~W~~~~~~~~~~~~~~~~~~~~~~~iyi~GG~~~~~~~~~~~~~~~~~~~~y~~~~~~W~  234 (306)
                      +....  ..+++++|||.+++|+.+ ++|+.+|.++++++.+ ++||++||.+...        ....+++||+.+++|.
T Consensus       437 ~~~~~--~l~sve~YDP~t~~W~~~-~~M~~~R~~~g~a~~~-~~iYvvGG~~~~~--------~~~~VE~ydp~~~~W~  504 (571)
T KOG4441|consen  437 DGSSN--CLNSVECYDPETNTWTLI-APMNTRRSGFGVAVLN-GKIYVVGGFDGTS--------ALSSVERYDPETNQWT  504 (571)
T ss_pred             CCCcc--ccceEEEEcCCCCceeec-CCcccccccceEEEEC-CEEEEECCccCCC--------ccceEEEEcCCCCcee
Confidence            87763  278999999999999999 9999999999999999 9999999987632        2367999999999999


Q ss_pred             ecccCCcccccceeeeeCCEEEEEeCccCccccccceEEEeeccccceeccCCCCcccccceeeEEecC
Q psy9754         235 FVTELVVPRHAHSASVLSSQILIIGGVTTVYKRTLKSVECWCFDRQAWIKGVSGLPATILGHSSVALPL  303 (306)
Q Consensus       235 ~~~~~p~~~~~~~~~~~~~~i~v~GG~~~~~~~~~~~~~~yd~~~~~W~~~~~~~p~~r~~~~~~~~~~  303 (306)
                      .+++|+.+|..++++.+++++|++||.+.  ...++.+.+|||++++|+. ...+...|...+++++..
T Consensus       505 ~v~~m~~~rs~~g~~~~~~~ly~vGG~~~--~~~l~~ve~ydp~~d~W~~-~~~~~~~~~~~~~~~~~~  570 (571)
T KOG4441|consen  505 MVAPMTSPRSAVGVVVLGGKLYAVGGFDG--NNNLNTVECYDPETDTWTE-VTEPESGRGGAGVAVIPM  570 (571)
T ss_pred             EcccCccccccccEEEECCEEEEEecccC--ccccceeEEcCCCCCceee-CCCccccccCcceEEecC
Confidence            99999999999999999999999999665  4677999999999999999 566666666666666543



>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>KOG4441|consensus Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PLN02153 epithiospecifier protein Back     alignment and domain information
>PHA02713 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>PLN02193 nitrile-specifier protein Back     alignment and domain information
>TIGR03547 muta_rot_YjhT mutatrotase, YjhT family Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>TIGR03548 mutarot_permut cyclically-permuted mutatrotase family protein Back     alignment and domain information
>PRK14131 N-acetylneuraminic acid mutarotase; Provisional Back     alignment and domain information
>PHA03098 kelch-like protein; Provisional Back     alignment and domain information
>PHA02790 Kelch-like protein; Provisional Back     alignment and domain information
>KOG4693|consensus Back     alignment and domain information
>KOG4693|consensus Back     alignment and domain information
>KOG0379|consensus Back     alignment and domain information
>KOG1230|consensus Back     alignment and domain information
>KOG4152|consensus Back     alignment and domain information
>KOG4152|consensus Back     alignment and domain information
>KOG0379|consensus Back     alignment and domain information
>KOG1230|consensus Back     alignment and domain information
>COG3055 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>COG3055 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>KOG2437|consensus Back     alignment and domain information
>KOG2437|consensus Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>PF13964 Kelch_6: Kelch motif Back     alignment and domain information
>PF13415 Kelch_3: Galactose oxidase, central domain Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF13415 Kelch_3: Galactose oxidase, central domain Back     alignment and domain information
>PF01344 Kelch_1: Kelch motif; InterPro: IPR006652 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>PF07646 Kelch_2: Kelch motif; InterPro: IPR011498 Kelch is a 50-residue motif, named after the Drosophila mutant in which it was first identified [] Back     alignment and domain information
>PF13418 Kelch_4: Galactose oxidase, central domain; PDB: 2UVK_B Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>smart00612 Kelch Kelch domain Back     alignment and domain information
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>PF13854 Kelch_5: Kelch motif Back     alignment and domain information
>PF07250 Glyoxal_oxid_N: Glyoxal oxidase N-terminus; InterPro: IPR009880 This entry represents the N terminus (approximately 300 residues) of a number of plant and fungal glyoxal oxidase enzymes Back     alignment and domain information
>PF13854 Kelch_5: Kelch motif Back     alignment and domain information
>PLN02772 guanylate kinase Back     alignment and domain information
>TIGR01640 F_box_assoc_1 F-box protein interaction domain Back     alignment and domain information
>PF03089 RAG2: Recombination activating protein 2; InterPro: IPR004321 The variable portion of the genes encoding immunoglobulins and T cell receptors are assembled from component V, D, and J DNA segments by a site-specific recombination reaction termed V(D)J recombination Back     alignment and domain information
>PF03089 RAG2: Recombination activating protein 2; InterPro: IPR004321 The variable portion of the genes encoding immunoglobulins and T cell receptors are assembled from component V, D, and J DNA segments by a site-specific recombination reaction termed V(D)J recombination Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function Back     alignment and domain information
>PRK11138 outer membrane biogenesis protein BamB; Provisional Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PF13360 PQQ_2: PQQ-like domain; PDB: 3HXJ_B 1YIQ_A 1KV9_A 3Q54_A 2YH3_A 3PRW_A 3P1L_A 3Q7M_A 3Q7O_A 3Q7N_A Back     alignment and domain information
>PF07893 DUF1668: Protein of unknown function (DUF1668); InterPro: IPR012871 The hypothetical proteins found in this family are expressed by Oryza sativa (Rice) and are of unknown function Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>TIGR03300 assembly_YfgL outer membrane assembly lipoprotein YfgL Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>KOG2055|consensus Back     alignment and domain information
>PF12768 Rax2: Cortical protein marker for cell polarity Back     alignment and domain information
>PF02191 OLF: Olfactomedin-like domain; InterPro: IPR003112 The olfactomedin-domain was first identified in olfactomedin, an extracellular matrix protein of the olfactory neuroepithelium [] Back     alignment and domain information
>smart00284 OLF Olfactomedin-like domains Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>smart00284 OLF Olfactomedin-like domains Back     alignment and domain information
>PF08450 SGL: SMP-30/Gluconolaconase/LRE-like region; InterPro: IPR013658 This family describes a region that is found in proteins expressed by a variety of eukaryotic and prokaryotic species Back     alignment and domain information
>PF02191 OLF: Olfactomedin-like domain; InterPro: IPR003112 The olfactomedin-domain was first identified in olfactomedin, an extracellular matrix protein of the olfactory neuroepithelium [] Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>PF05096 Glu_cyclase_2: Glutamine cyclotransferase; InterPro: IPR007788 This family of enzymes 2 Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PF03178 CPSF_A: CPSF A subunit region; InterPro: IPR004871 This family includes a region that lies towards the C terminus of the cleavage and polyadenylation specificity factor (CPSF) A (160 kDa) subunit Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0310|consensus Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>cd00094 HX Hemopexin-like repeats Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PF12217 End_beta_propel: Catalytic beta propeller domain of bacteriophage endosialidase; InterPro: IPR024428 This entry represents the beta propeller domain of endosialidases, which consists of catalytically active part of the enzymes Back     alignment and domain information
>PRK04792 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>KOG0316|consensus Back     alignment and domain information
>cd00200 WD40 WD40 domain, found in a number of eukaryotic proteins that cover a wide variety of functions including adaptor/regulatory modules in signal transduction, pre-mRNA processing and cytoskeleton assembly; typically contains a GH dipeptide 11-24 residues from its N-terminus and the WD dipeptide at its C-terminus and is 40 residues long, hence the name WD40; between GH and WD lies a conserved core; serves as a stable propeller-like platform to which proteins can bind either stably or reversibly; forms a propeller-like structure with several blades where each blade is composed of a four-stranded anti-parallel b-sheet; instances with few detectable copies are hypothesized to form larger structures by dimerization; each WD40 sequence repeat forms the first three strands of one blade and the last strand in the next blade; the last C-terminal WD40 repeat completes the blade structure of the first WD40 repeat to create the closed ring propeller-structure; residues on the top and botto Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>TIGR03866 PQQ_ABC_repeats PQQ-dependent catabolism-associated beta-propeller protein Back     alignment and domain information
>PRK05137 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF14870 PSII_BNR: Photosynthesis system II assembly factor YCF48; PDB: 2XBG_A Back     alignment and domain information
>PRK04922 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0646|consensus Back     alignment and domain information
>KOG0316|consensus Back     alignment and domain information
>TIGR03075 PQQ_enz_alc_DH PQQ-dependent dehydrogenase, methanol/ethanol family Back     alignment and domain information
>KOG3545|consensus Back     alignment and domain information
>PLN00181 protein SPA1-RELATED; Provisional Back     alignment and domain information
>PRK00178 tolB translocation protein TolB; Provisional Back     alignment and domain information
>KOG0291|consensus Back     alignment and domain information
>TIGR02800 propeller_TolB tol-pal system beta propeller repeat protein TolB Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK13684 Ycf48-like protein; Provisional Back     alignment and domain information
>PF08268 FBA_3: F-box associated domain; InterPro: IPR013187 This domain occurs in a diverse superfamily of genes in plants Back     alignment and domain information
>cd00216 PQQ_DH Dehydrogenases with pyrrolo-quinoline quinone (PQQ) as cofactor, like ethanol, methanol, and membrane bound glucose dehydrogenases Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PRK11028 6-phosphogluconolactonase; Provisional Back     alignment and domain information
>KOG2321|consensus Back     alignment and domain information
>PF02897 Peptidase_S9_N: Prolyl oligopeptidase, N-terminal beta-propeller domain; InterPro: IPR004106 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>PLN00033 photosystem II stability/assembly factor; Provisional Back     alignment and domain information
>PRK03629 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK04043 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>COG4946 Uncharacterized protein related to the periplasmic component of the Tol biopolymer transport system [Function unknown] Back     alignment and domain information
>KOG0266|consensus Back     alignment and domain information
>PF08268 FBA_3: F-box associated domain; InterPro: IPR013187 This domain occurs in a diverse superfamily of genes in plants Back     alignment and domain information
>KOG1036|consensus Back     alignment and domain information
>COG1520 FOG: WD40-like repeat [Function unknown] Back     alignment and domain information
>KOG3545|consensus Back     alignment and domain information
>PF10282 Lactonase: Lactonase, 7-bladed beta-propeller; InterPro: IPR019405 6-phosphogluconolactonases (6PGL) 3 Back     alignment and domain information
>PTZ00421 coronin; Provisional Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>cd00094 HX Hemopexin-like repeats Back     alignment and domain information
>COG4257 Vgb Streptogramin lyase [Defense mechanisms] Back     alignment and domain information
>PLN00033 photosystem II stability/assembly factor; Provisional Back     alignment and domain information
>KOG2321|consensus Back     alignment and domain information
>TIGR02658 TTQ_MADH_Hv methylamine dehydrogenase heavy chain Back     alignment and domain information
>KOG0289|consensus Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG0296|consensus Back     alignment and domain information
>PF02239 Cytochrom_D1: Cytochrome D1 heme domain; PDB: 1NNO_B 1HZU_A 1N15_B 1N50_A 1GJQ_A 1BL9_B 1NIR_B 1N90_B 1HZV_A 1AOQ_A Back     alignment and domain information
>KOG1036|consensus Back     alignment and domain information
>PRK02889 tolB translocation protein TolB; Provisional Back     alignment and domain information
>PF09910 DUF2139: Uncharacterized protein conserved in archaea (DUF2139); InterPro: IPR016675 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>PRK10115 protease 2; Provisional Back     alignment and domain information
>KOG0315|consensus Back     alignment and domain information
>PTZ00420 coronin; Provisional Back     alignment and domain information
>KOG0649|consensus Back     alignment and domain information
>PF09910 DUF2139: Uncharacterized protein conserved in archaea (DUF2139); InterPro: IPR016675 There is currently no experimental data for members of this group or their homologues, nor do they exhibit features indicative of any function Back     alignment and domain information
>KOG1332|consensus Back     alignment and domain information
>PF06433 Me-amine-dh_H: Methylamine dehydrogenase heavy chain (MADH); InterPro: IPR009451 Methylamine dehydrogenase (1 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query306
2vpj_A301 Crystal Structure Of The Kelch Domain Of Human Klhl 3e-20
2dyh_A318 Crystal Structure Of The Keap1 Protein In Complexed 9e-19
1x2j_A316 Structural Basis For The Defects Of Human Lung Canc 9e-19
1u6d_X308 Crystal Structure Of The Kelch Domain Of Human Keap 3e-18
3vng_A309 Crystal Structure Of Keap1 In Complex With Syntheti 3e-18
2woz_A318 The Novel Beta-Propeller Of The Btb-Kelch Protein K 2e-16
1zgk_A308 1.35 Angstrom Structure Of The Kelch Domain Of Keap 2e-16
4asc_A315 Crystal Structure Of The Kelch Domain Of Human Kbtb 5e-15
2xn4_A302 Crystal Structure Of The Kelch Domain Of Human Klhl 1e-13
2xn4_A302 Crystal Structure Of The Kelch Domain Of Human Klhl 4e-09
3ii7_A306 Crystal Structure Of The Kelch Domain Of Human Klhl 5e-09
>pdb|2VPJ|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl12 Length = 301 Back     alignment and structure

Iteration: 1

Score = 95.9 bits (237), Expect = 3e-20, Method: Compositional matrix adjust. Identities = 62/217 (28%), Positives = 103/217 (47%), Gaps = 18/217 (8%) Query: 69 VWSFNPNNKQWTQEPNMTYPRKIFSFVSCLDKIYAIGGQDCKTLLSSVECYDPVAH---T 125 V ++P ++W+ P++T R+ + VS D+IY IGG D ++ LSSVEC D A Sbjct: 33 VEKYDPKTQEWSFLPSITRKRRYVASVSLHDRIYVIGGYDGRSRLSSVECLDYTADEDGV 92 Query: 126 WEDVAPLKIARMGMAVAEINDKIWIAGGYTGDKMNPVTDKVECYDPRTNTWTTLATKLRY 185 W VAP+ + R + D I+++GG+ G + + +E YDP + W+ L ++ Sbjct: 93 WYSVAPMNVRRGLAGATTLGDMIYVSGGFDGSRRHT---SMERYDPNIDQWSMLG-DMQT 148 Query: 186 PRYLATLVSVNNEKLYIIGGASQTDATNTQKMYSVSDLDVFVSNEKEWKFVTELVVPRHA 245 R A LV V + +Y +GG + N+ + Y + W VT + R Sbjct: 149 AREGAGLV-VASGVIYCLGGYDGLNILNSVEKYD--------PHTGHWTNVTPMATKRSG 199 Query: 246 HSASVLSSQILIIGGVTTVYKRTLKSVECWCFDRQAW 282 ++L+ I ++GG L SVE + +W Sbjct: 200 AGVALLNDHIYVVGGFDGTAH--LSSVEAYNIRTDSW 234
>pdb|2DYH|A Chain A, Crystal Structure Of The Keap1 Protein In Complexed With The N-Terminal Region Of The Nrf2 Transcription Factor Length = 318 Back     alignment and structure
>pdb|1X2J|A Chain A, Structural Basis For The Defects Of Human Lung Cancer Somatic Mutations In The Repression Activity Of Keap1 On Nrf2 Length = 316 Back     alignment and structure
>pdb|1U6D|X Chain X, Crystal Structure Of The Kelch Domain Of Human Keap1 Length = 308 Back     alignment and structure
>pdb|3VNG|A Chain A, Crystal Structure Of Keap1 In Complex With Synthetic Small Molecular Based On A Co-crystallization Length = 309 Back     alignment and structure
>pdb|2WOZ|A Chain A, The Novel Beta-Propeller Of The Btb-Kelch Protein Krp1 Provides The Binding Site For Lasp-1 That Is Necessary For Pseudopodia Extension Length = 318 Back     alignment and structure
>pdb|1ZGK|A Chain A, 1.35 Angstrom Structure Of The Kelch Domain Of Keap1 Length = 308 Back     alignment and structure
>pdb|4ASC|A Chain A, Crystal Structure Of The Kelch Domain Of Human Kbtbd5 Length = 315 Back     alignment and structure
>pdb|2XN4|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl2 (mayven) Length = 302 Back     alignment and structure
>pdb|2XN4|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl2 (mayven) Length = 302 Back     alignment and structure
>pdb|3II7|A Chain A, Crystal Structure Of The Kelch Domain Of Human Klhl7 Length = 306 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query306
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 2e-61
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 1e-52
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 7e-42
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 4e-41
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 2e-60
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 2e-51
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 2e-40
3ii7_A 306 Kelch-like protein 7; protein-binding, kelch-repea 8e-38
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 7e-60
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 4e-51
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 1e-48
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 2e-41
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 1e-58
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 4e-50
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 2e-46
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 2e-40
4asc_A 315 Kelch repeat and BTB domain-containing protein 5; 2e-36
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 2e-20
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 4e-58
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 3e-49
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 4e-47
2woz_A 318 Kelch repeat and BTB domain-containing protein 10; 8e-36
2woz_A 318 Kelch repeat and BTB domain-containing protein 10; 9e-24
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 3e-57
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 1e-49
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 8e-39
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 8e-35
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 2e-21
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 1e-35
2uvk_A 357 YJHT; unknown function, hypothetical protein, sial 1e-28
2uvk_A 357 YJHT; unknown function, hypothetical protein, sial 2e-20
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 6e-14
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 1e-23
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 4e-21
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 1e-18
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 3e-12
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 2e-11
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 1e-10
1qzv_F154 Plant photosystem I: subunit PSAF; photosynthesis, 1e-04
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
 Score =  196 bits (500), Expect = 2e-61
 Identities = 62/252 (24%), Positives = 98/252 (38%), Gaps = 20/252 (7%)

Query: 50  AGGVDPSSDEKTTDIVSNSVWSFNPNNKQWTQEPNMTYPRKIFSFVSCLDKIYAIGGQDC 109
            GG + S           +V S++P   QWT   NM   R           +YA+GG D 
Sbjct: 67  VGGFNGSLR-------VRTVDSYDPVKDQWTSVANMRDRRSTLGAAVLNGLLYAVGGFDG 119

Query: 110 KTLLSSVECYDPVAHTWEDVAPLKIARMGMAVAEINDKIWIAGGYTGDKMNPVTDKVECY 169
            T LSSVE Y+  ++ W  VAP+   R  + V  +   ++  GGY           VECY
Sbjct: 120 STGLSSVEAYNIKSNEWFHVAPMNTRRSSVGVGVVGGLLYAVGGYDVASRQC-LSTVECY 178

Query: 170 DPRTNTWTTLATKLRYPRYLATLVSVNNEKLYIIGGASQTDATNTQKMYSVSDLDVFVSN 229
           +  TN WT +A  +   R  A +  +NN  LY +GG        + ++Y  +        
Sbjct: 179 NATTNEWTYIAE-MSTRRSGAGVGVLNN-LLYAVGGHDGPLVRKSVEVYDPTT------- 229

Query: 230 EKEWKFVTELVVPRHAHSASVLSSQILIIGGVTTVYKRTLKSVECWCFDRQAWIKGVSGL 289
              W+ V ++ + R       ++  + ++GG        L SVE +      W    S +
Sbjct: 230 -NAWRQVADMNMCRRNAGVCAVNGLLYVVGGDDG--SCNLASVEYYNPTTDKWTVVSSCM 286

Query: 290 PATILGHSSVAL 301
                      +
Sbjct: 287 STGRSYAGVTVI 298


>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Length = 302 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Length = 306 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Length = 308 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Length = 315 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Length = 318 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Length = 301 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Length = 357 Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Length = 695 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656 Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Length = 656 Back     alignment and structure
>1qzv_F Plant photosystem I: subunit PSAF; photosynthesis,plant photosynthetic reaction center, peripheral antenna; HET: CL1 PQN; 4.44A {Pisum sativum} SCOP: i.5.1.1 Length = 154 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query306
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 100.0
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 100.0
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 100.0
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 100.0
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 100.0
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 100.0
1zgk_A308 Kelch-like ECH-associated protein 1; beta-propelle 100.0
2xn4_A302 Kelch-like protein 2; structural protein, cytoskel 100.0
3ii7_A306 Kelch-like protein 7; protein-binding, kelch-repea 100.0
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 100.0
2vpj_A301 Kelch-like protein 12; adaptor protein, WNT signal 100.0
4asc_A315 Kelch repeat and BTB domain-containing protein 5; 100.0
2woz_A318 Kelch repeat and BTB domain-containing protein 10; 100.0
2uvk_A357 YJHT; unknown function, hypothetical protein, sial 100.0
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 100.0
2zwa_A695 Leucine carboxyl methyltransferase 2; HET: SAH CIT 100.0
1k3i_A 656 Galactose oxidase precursor; blade beta propeller, 100.0
1k3i_A656 Galactose oxidase precursor; blade beta propeller, 100.0
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 98.56
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.35
3mbr_X243 Glutamine cyclotransferase; beta-propeller; 1.44A 98.34
3dsm_A328 Uncharacterized protein bacuni_02894; seven_blated 98.33
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 98.24
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 98.24
1l0q_A 391 Surface layer protein; SLP, S-layer, 7-bladed beta 98.23
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 98.21
3nol_A262 Glutamine cyclotransferase; beta-propeller, glutam 98.09
1l0q_A391 Surface layer protein; SLP, S-layer, 7-bladed beta 98.06
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 97.99
3ow8_A321 WD repeat-containing protein 61; structural genomi 97.9
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 97.87
3bws_A433 Protein LP49; two-domain, immunoglobulin-like, 7-b 97.85
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 97.84
3nok_A268 Glutaminyl cyclase; beta-propeller, cyclotransfera 97.8
1k8k_C372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 97.8
3q7m_A376 Lipoprotein YFGL, BAMB; beta-propeller, BAM comple 97.78
2iwa_A266 Glutamine cyclotransferase; pyroglutamate, acyltra 97.77
3jrp_A379 Fusion protein of protein transport protein SEC13 97.73
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 97.69
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 97.67
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 97.65
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 97.62
1rwi_B270 Serine/threonine-protein kinase PKND; beta propell 97.55
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 97.53
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 97.52
1ri6_A343 Putative isomerase YBHE; 7-bladed propeller, enzym 97.52
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 97.51
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 97.51
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 97.49
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 97.47
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 97.46
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 97.46
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 97.44
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 97.44
3bws_A 433 Protein LP49; two-domain, immunoglobulin-like, 7-b 97.43
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 97.42
1q7f_A286 NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL 97.42
1gxr_A337 ESG1, transducin-like enhancer protein 1; transcri 97.41
2z2n_A299 Virginiamycin B lyase; seven-bladed beta-propeller 97.41
3jrp_A 379 Fusion protein of protein transport protein SEC13 97.39
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 97.39
3hfq_A347 Uncharacterized protein LP_2219; Q88V64_lacpl, NES 97.37
3vgz_A353 Uncharacterized protein YNCE; beta-propeller, prot 97.34
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 97.32
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 97.3
2qc5_A300 Streptogramin B lactonase; beta propeller, lyase; 97.3
3ow8_A321 WD repeat-containing protein 61; structural genomi 97.29
3vl1_A420 26S proteasome regulatory subunit RPN14; beta-prop 97.28
3scy_A361 Hypothetical bacterial 6-phosphogluconolactonase; 97.27
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 97.27
2ovr_B445 FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 97.26
4ery_A312 WD repeat-containing protein 5; WD40, WIN motif, b 97.23
3dwl_C377 Actin-related protein 2/3 complex subunit 1; prope 97.23
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 97.2
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 97.2
3u4y_A331 Uncharacterized protein; structural genomics, PSI- 97.18
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 97.16
1k8k_C 372 P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta- 97.15
3jro_A 753 Fusion protein of protein transport protein SEC13 97.15
1p22_A435 F-BOX/WD-repeat protein 1A; ubiquitination, degrad 97.14
3v9f_A 781 Two-component system sensor histidine kinase/RESP 97.13
4aez_A401 CDC20, WD repeat-containing protein SLP1; cell cyc 97.09
4g56_B357 MGC81050 protein; protein arginine methyltransfera 97.02
1got_B340 GT-beta; complex (GTP-binding/transducer), G prote 97.02
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 97.02
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 97.02
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 97.01
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 97.0
1r5m_A425 SIR4-interacting protein SIF2; transcription corep 96.99
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 96.97
2aq5_A402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 96.97
3dwl_C 377 Actin-related protein 2/3 complex subunit 1; prope 96.95
4a2l_A 795 BT_4663, two-component system sensor histidine kin 96.9
3zwl_B369 Eukaryotic translation initiation factor 3 subuni; 96.9
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 96.87
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 96.85
3fvz_A329 Peptidyl-glycine alpha-amidating monooxygenase; be 96.85
3bg1_A316 Protein SEC13 homolog; NPC, transport, WD repeat, 96.84
3ei3_B383 DNA damage-binding protein 2; UV-damage, DDB, nucl 96.83
4a2l_A 795 BT_4663, two-component system sensor histidine kin 96.82
2vdu_B450 TRNA (guanine-N(7)-)-methyltransferase- associated 96.82
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 96.82
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 96.74
2dg1_A333 DRP35, lactonase; beta propeller, hydrolase; 1.72A 96.74
2pm7_B297 Protein transport protein SEC13, protein transport 96.74
1nir_A 543 Nitrite reductase; hemoprotein, denitrification, d 96.73
3fm0_A 345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 96.72
1vyh_C410 Platelet-activating factor acetylhydrolase IB alph 96.69
3fm0_A345 Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD r 96.68
1pgu_A 615 Actin interacting protein 1; WD repeat, seven-blad 96.68
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 96.57
2pm9_A416 Protein WEB1, protein transport protein SEC31; bet 96.56
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 96.51
1jmx_B349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 96.45
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 96.44
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 96.42
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 96.41
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 96.4
3g4e_A297 Regucalcin; six bladed beta-propeller, gluconolcat 96.38
2pbi_B354 Guanine nucleotide-binding protein subunit beta 5; 96.37
3v7d_B464 Cell division control protein 4; WD 40 domain, pho 96.37
4g56_B357 MGC81050 protein; protein arginine methyltransfera 96.35
4e54_B435 DNA damage-binding protein 2; beta barrel, double 96.35
3mkq_A 814 Coatomer beta'-subunit; beta-propeller, alpha-sole 96.31
3jro_A 753 Fusion protein of protein transport protein SEC13 96.31
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 96.28
2ynn_A304 Coatomer subunit beta'; protein transport, peptide 96.28
1pjx_A314 Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotries 96.27
2hes_X330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 96.24
3v9f_A 781 Two-component system sensor histidine kinase/RESP 96.23
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 96.22
4a11_B408 DNA excision repair protein ERCC-8; DNA binding pr 96.22
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 96.19
4aow_A340 Guanine nucleotide-binding protein subunit beta-2; 96.18
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 96.17
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 96.16
1sq9_A 397 Antiviral protein SKI8; WD repeat, beta-transducin 96.15
3k26_A366 Polycomb protein EED; WD40, structural genomics, N 96.15
2hqs_A415 Protein TOLB; TOLB, PAL, TOL, transport protein-li 96.14
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 96.11
3odt_A313 Protein DOA1; ubiquitin, nuclear protein; HET: MSE 96.11
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 96.1
1sq9_A397 Antiviral protein SKI8; WD repeat, beta-transducin 96.09
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 96.05
4gga_A420 P55CDC, cell division cycle protein 20 homolog; ce 96.04
2p4o_A306 Hypothetical protein; putative lactonase, structur 96.03
4gqb_B344 Methylosome protein 50; TIM barrel, beta-propeller 96.02
2ojh_A297 Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 96.0
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 95.98
4e54_B 435 DNA damage-binding protein 2; beta barrel, double 95.87
1pgu_A615 Actin interacting protein 1; WD repeat, seven-blad 95.87
3lrv_A343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 95.87
2fp8_A322 Strictosidine synthase; six bladed beta propeller 95.84
3i2n_A357 WD repeat-containing protein 92; WD40 repeats, str 95.79
2pm7_B297 Protein transport protein SEC13, protein transport 95.77
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 95.76
2ad6_A 571 Methanol dehydrogenase subunit 1; PQQ configuratio 95.71
3ei3_B 383 DNA damage-binding protein 2; UV-damage, DDB, nucl 95.71
3mmy_A368 MRNA export factor; mRNA export, nuclear protein; 95.71
3no2_A276 Uncharacterized protein; six-bladed beta-propeller 95.68
3sfz_A 1249 APAF-1, apoptotic peptidase activating factor 1; a 95.67
3ott_A 758 Two-component system sensor histidine kinase; beta 95.67
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 95.57
2aq5_A 402 Coronin-1A; WD40 repeat, 7-bladed beta-propeller, 95.55
2ad6_A 571 Methanol dehydrogenase subunit 1; PQQ configuratio 95.48
2pm9_A 416 Protein WEB1, protein transport protein SEC31; bet 95.45
3lrv_A 343 PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiqu 95.44
2vdu_B 450 TRNA (guanine-N(7)-)-methyltransferase- associated 95.39
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 95.38
3e5z_A296 Putative gluconolactonase; X-RAY NESG Q9RXN3 gluco 95.38
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 95.37
3dm0_A694 Maltose-binding periplasmic protein fused with RAC 95.36
1erj_A393 Transcriptional repressor TUP1; beta-propeller, tr 95.32
3ott_A758 Two-component system sensor histidine kinase; beta 95.31
2z3z_A 706 Dipeptidyl aminopeptidase IV; peptidase family S9, 95.29
2xyi_A430 Probable histone-binding protein CAF1; transcripti 95.27
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 95.24
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 95.23
3c7x_A196 Matrix metalloproteinase-14; membrane protein inte 95.21
1jmx_B 349 Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 95.21
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 95.08
3sfz_A1249 APAF-1, apoptotic peptidase activating factor 1; a 95.05
3ju4_A 670 Endo-N-acetylneuraminidase; endonf, polysia, high- 95.03
1qhu_A460 Protein (hemopexin); beta propeller, HAEM binding 95.02
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 94.99
4a11_B 408 DNA excision repair protein ERCC-8; DNA binding pr 94.99
1qks_A 567 Cytochrome CD1 nitrite reductase; enzyme, oxidored 94.98
1kb0_A 677 Quinohemoprotein alcohol dehydrogenase; beta-prope 94.98
1pby_B337 Quinohemoprotein amine dehydrogenase 40 kDa subuni 94.86
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 94.84
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 94.8
3bg1_A 316 Protein SEC13 homolog; NPC, transport, WD repeat, 94.79
3azo_A 662 Aminopeptidase; POP family, hydrolase; 2.00A {Stre 94.78
3gre_A437 Serine/threonine-protein kinase VPS15; seven-blade 94.73
1pex_A207 Collagenase-3, MMP-13; C-terminal hemopexin-like d 94.56
2xbg_A327 YCF48-like protein; photosynthesis, photosystem II 94.52
1yiq_A 689 Quinohemoprotein alcohol dehydrogenase; electron t 94.43
3b7f_A 394 Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop 94.41
1n7d_A699 LDL receptor, low-density lipoprotein receptor; fa 94.4
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 94.32
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 94.31
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 94.31
3c5m_A396 Oligogalacturonate lyase; blade-shaped beta-propel 94.29
1w6s_A 599 Methanol dehydrogenase subunit 1; anisotropic, ele 94.28
2p4o_A306 Hypothetical protein; putative lactonase, structur 94.27
2bkl_A 695 Prolyl endopeptidase; mechanistic study, celiac sp 94.22
3f3f_A351 Nucleoporin SEH1; structural protein, protein comp 94.2
3iz6_a380 40S ribosomal protein RACK1 (RACK1); eukaryotic ri 94.15
3gre_A 437 Serine/threonine-protein kinase VPS15; seven-blade 94.13
3pe7_A388 Oligogalacturonate lyase; seven-bladed beta-propel 94.05
2hes_X 330 YDR267CP; beta-propeller, WD40 repeat, biosyntheti 94.04
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 93.95
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 93.9
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 93.84
2hz6_A 369 Endoplasmic reticulum to nucleus signalling 1 isof 93.78
1kv9_A 668 Type II quinohemoprotein alcohol dehydrogenase; el 93.62
1yfq_A342 Cell cycle arrest protein BUB3; WD repeat WD40 rep 93.53
1w6s_A 599 Methanol dehydrogenase subunit 1; anisotropic, ele 92.72
3v65_B386 Low-density lipoprotein receptor-related protein; 92.7
1itv_A195 MMP9; adaptive molecular recognition, beta propell 92.54
1npe_A267 Nidogen, entactin; glycoprotein, basement membrane 92.49
4ggc_A318 P55CDC, cell division cycle protein 20 homolog; ce 92.46
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 92.35
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 92.34
2fp8_A322 Strictosidine synthase; six bladed beta propeller 92.27
3oyo_A225 Hemopexin fold protein CP4; seeds, plant protein; 92.18
3v65_B386 Low-density lipoprotein receptor-related protein; 92.08
3tc9_A 430 Hypothetical hydrolase; 6-bladed beta-propeller, i 92.05
3mmy_A 368 MRNA export factor; mRNA export, nuclear protein; 92.0
3frx_A319 Guanine nucleotide-binding protein subunit beta- l 91.93
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 91.71
1qhu_A 460 Protein (hemopexin); beta propeller, HAEM binding 91.67
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 91.49
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 91.41
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 91.18
2xdw_A 710 Prolyl endopeptidase; alpha/beta-hydrolase, amnesi 91.04
2cn3_A737 Xyloglucanase, beta-1,4-xyloglucan hydrolase; glyc 90.86
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 90.78
4h5i_A365 Guanine nucleotide-exchange factor SEC12; copii ve 90.03
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 89.98
1su3_A450 Interstitial collagenase; prodomain, hemopexin dom 89.95
3dr2_A305 Exported gluconolactonase; gluconolactonase SMP-30 89.9
2xyi_A430 Probable histone-binding protein CAF1; transcripti 89.72
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 89.67
1k32_A 1045 Tricorn protease; protein degradation, substrate g 89.37
1flg_A 582 Protein (quinoprotein ethanol dehydrogenase); supe 89.31
3lp9_A227 LS-24; SEED albumin, plant protein; HET: SPM; 2.20 89.2
3ba0_A365 Macrophage metalloelastase; FULL-length MMP-12, he 89.06
3v64_C349 Agrin; beta propeller, laminin-G, signaling, prote 88.75
3hrp_A409 Uncharacterized protein; NP_812590.1, structural g 88.42
3b7f_A394 Glycosyl hydrolase, BNR repeat; 7-bladed beta-prop 88.42
3o4h_A 582 Acylamino-acid-releasing enzyme; alpha/beta hydrol 88.28
3sjl_D386 Methylamine dehydrogenase heavy chain; MAUG, C-hem 88.2
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 88.0
2ymu_A577 WD-40 repeat protein; unknown function, two domain 87.67
3oyo_A225 Hemopexin fold protein CP4; seeds, plant protein; 87.46
3hxj_A330 Pyrrolo-quinoline quinone; all beta protein. incom 87.38
3iuj_A 693 Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas 87.17
2ecf_A 741 Dipeptidyl peptidase IV; prolyl oligopeptidase fam 87.01
2hz6_A 369 Endoplasmic reticulum to nucleus signalling 1 isof 86.88
2ymu_A577 WD-40 repeat protein; unknown function, two domain 86.7
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 86.45
2ghs_A326 AGR_C_1268P; regucalcin, structural genomics, join 86.39
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 85.78
2xzm_R343 RACK1; ribosome, translation; 3.93A {Tetrahymena t 85.72
3a0f_A763 Xyloglucanase; beta-propeller, hydrolase; 2.50A {G 85.42
4hw6_A 433 Hypothetical protein, IPT/TIG domain protein; puta 85.17
1hxn_A219 Hemopexin, HPX; heme, binding protein; 1.80A {Oryc 85.17
1flg_A 582 Protein (quinoprotein ethanol dehydrogenase); supe 85.14
1ijq_A316 LDL receptor, low-density lipoprotein receptor; be 85.06
3c7x_A196 Matrix metalloproteinase-14; membrane protein inte 84.55
3dw8_B447 Serine/threonine-protein phosphatase 2A 55 kDa RE 84.05
1yr2_A 741 Prolyl oligopeptidase; prolyl endopeptidase, mecha 83.55
1pex_A207 Collagenase-3, MMP-13; C-terminal hemopexin-like d 83.22
3vu4_A355 KMHSV2; beta-propeller fold, protein transport; 2. 82.99
1jof_A 365 Carboxy-CIS,CIS-muconate cyclase; beta-propeller, 82.97
3p5b_L400 Low density lipoprotein receptor variant; B-propel 82.79
2qe8_A343 Uncharacterized protein; structural genomics, join 82.27
3tc9_A430 Hypothetical hydrolase; 6-bladed beta-propeller, i 82.15
2mad_H373 Methylamine dehydrogenase (heavy subunit); oxidore 81.95
3p5b_L400 Low density lipoprotein receptor variant; B-propel 81.69
3c75_H426 MADH, methylamine dehydrogenase heavy chain; coppe 81.19
3lp9_A227 LS-24; SEED albumin, plant protein; HET: SPM; 2.20 81.15
2gop_A347 Trilobed protease; beta propeller, open velcro, hy 80.73
1nr0_A 611 Actin interacting protein 1; beta propeller, WD40 80.4
1mda_H368 Methylamine dehydrogenase (heavy subunit); electro 80.29
1gen_A218 Gelatinase A; hydrolase, hemopexin domain, metallo 80.06
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
Probab=100.00  E-value=1.1e-52  Score=351.50  Aligned_cols=280  Identities=25%  Similarity=0.401  Sum_probs=249.7

Q ss_pred             cccceeEEecccccceeEEEEEEeec--CceeeecccccccccceE------EEEeCccCcCCCCcccceeeceEEEEeC
Q psy9754           3 EIWDWELICKEGTEGIKLLVIWIMDI--VTYDLSIERVSQRYDVKI------NSLAGGVDPSSDEKTTDIVSNSVWSFNP   74 (306)
Q Consensus         3 ~~~~~~l~~~gG~~~~~~~~~~~~~~--~~W~~~~~~p~~r~~~~~------i~v~GG~~~~~~~~~~~~~~~~~~~~d~   74 (306)
                      +.++++||++||.++....+++.||+  ++|+.++++|.+|..|++      |||+||......   ....++++++||+
T Consensus        21 ~~~~~~i~v~GG~~~~~~~~~~~~d~~~~~W~~~~~~p~~r~~~~~~~~~~~lyv~GG~~~~~~---~~~~~~~~~~~d~   97 (308)
T 1zgk_A           21 PKVGRLIYTAGGYFRQSLSYLEAYNPSNGTWLRLADLQVPRSGLAGCVVGGLLYAVGGRNNSPD---GNTDSSALDCYNP   97 (308)
T ss_dssp             CCCCCCEEEECCBSSSBCCCEEEEETTTTEEEECCCCSSCCBSCEEEEETTEEEEECCEEEETT---EEEECCCEEEEET
T ss_pred             cCCCCEEEEEeCcCCCCcceEEEEcCCCCeEeECCCCCcccccceEEEECCEEEEECCCcCCCC---CCeecceEEEECC
Confidence            45788999999986566668999999  789999999999999988      999999842110   0126789999999


Q ss_pred             CCCCeeeCCCCCCCccceeeEEECCEEEEEccCCCCCCCceeEEEeCCCCcEEeccCCcccccceeeEEECCEEEEEccc
Q psy9754          75 NNKQWTQEPNMTYPRKIFSFVSCLDKIYAIGGQDCKTLLSSVECYDPVAHTWEDVAPLKIARMGMAVAEINDKIWIAGGY  154 (306)
Q Consensus        75 ~t~~W~~~~~~~~~~~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~d~~~~~w~~~~~~~~~~~~~~~~~~~~~iyv~GG~  154 (306)
                      .+++|+.++++|.+|..|+++.++++||++||.......+++++||+.+++|++++++|.+|..+++++++++||++||.
T Consensus        98 ~~~~W~~~~~~p~~r~~~~~~~~~~~iyv~GG~~~~~~~~~~~~yd~~~~~W~~~~~~p~~r~~~~~~~~~~~iyv~GG~  177 (308)
T 1zgk_A           98 MTNQWSPCAPMSVPRNRIGVGVIDGHIYAVGGSHGCIHHNSVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGF  177 (308)
T ss_dssp             TTTEEEECCCCSSCCBTCEEEEETTEEEEECCEETTEECCCEEEEETTTTEEEECCCCSSCCBSCEEEEETTEEEEECCB
T ss_pred             CCCeEeECCCCCcCccccEEEEECCEEEEEcCCCCCcccccEEEECCCCCeEeECCCCCccccceEEEEECCEEEEEeCC
Confidence            99999999999999999999999999999999887777889999999999999999999999999999999999999998


Q ss_pred             CCCCCCCCCccEEEEeCCCCeeEEcccccCCcceeEEEEEEeCCEEEEEcCCCCCCCCCcccccccceeeEEECCCCceE
Q psy9754         155 TGDKMNPVTDKVECYDPRTNTWTTLATKLRYPRYLATLVSVNNEKLYIIGGASQTDATNTQKMYSVSDLDVFVSNEKEWK  234 (306)
Q Consensus       155 ~~~~~~~~~~~~~~~d~~~~~W~~~~~~~~~~~~~~~~~~~~~~~iyi~GG~~~~~~~~~~~~~~~~~~~~y~~~~~~W~  234 (306)
                      .....   .+++++||+.+++|+.+ +++|.+|..++++.++ ++||++||.....        ...++++||+.+++|+
T Consensus       178 ~~~~~---~~~~~~yd~~~~~W~~~-~~~p~~r~~~~~~~~~-~~iyv~GG~~~~~--------~~~~v~~yd~~~~~W~  244 (308)
T 1zgk_A          178 DGTNR---LNSAECYYPERNEWRMI-TAMNTIRSGAGVCVLH-NCIYAAGGYDGQD--------QLNSVERYDVETETWT  244 (308)
T ss_dssp             CSSCB---CCCEEEEETTTTEEEEC-CCCSSCCBSCEEEEET-TEEEEECCBCSSS--------BCCCEEEEETTTTEEE
T ss_pred             CCCCc---CceEEEEeCCCCeEeeC-CCCCCccccceEEEEC-CEEEEEeCCCCCC--------ccceEEEEeCCCCcEE
Confidence            76654   68999999999999999 7889999999988887 9999999986442        2478999999999999


Q ss_pred             ecccCCcccccceeeeeCCEEEEEeCccCccccccceEEEeeccccceeccCCCCcccccceeeEEe
Q psy9754         235 FVTELVVPRHAHSASVLSSQILIIGGVTTVYKRTLKSVECWCFDRQAWIKGVSGLPATILGHSSVAL  301 (306)
Q Consensus       235 ~~~~~p~~~~~~~~~~~~~~i~v~GG~~~~~~~~~~~~~~yd~~~~~W~~~~~~~p~~r~~~~~~~~  301 (306)
                      .+.++|.+|..++++.++++||++||.+.  ...++++++||+++++|+. ++.||.+|..|+++++
T Consensus       245 ~~~~~p~~r~~~~~~~~~~~i~v~GG~~~--~~~~~~v~~yd~~~~~W~~-~~~~p~~r~~~~~~~l  308 (308)
T 1zgk_A          245 FVAPMKHRRSALGITVHQGRIYVLGGYDG--HTFLDSVECYDPDTDTWSE-VTRMTSGRSGVGVAVT  308 (308)
T ss_dssp             ECCCCSSCCBSCEEEEETTEEEEECCBCS--SCBCCEEEEEETTTTEEEE-EEECSSCCBSCEEEEC
T ss_pred             ECCCCCCCccceEEEEECCEEEEEcCcCC--CcccceEEEEcCCCCEEee-cCCCCCCcccceeEeC
Confidence            99999999999999999999999999775  2456899999999999999 7999999999999985



>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>1zgk_A Kelch-like ECH-associated protein 1; beta-propeller, kelch repeat motif, protein binding; HET: MSE; 1.35A {Homo sapiens} SCOP: b.68.11.1 PDB: 2flu_X 1u6d_X 1x2j_A 1x2r_A 2dyh_A 2z32_A 3ade_A Back     alignment and structure
>2xn4_A Kelch-like protein 2; structural protein, cytoskeleton; 1.99A {Homo sapiens} Back     alignment and structure
>3ii7_A Kelch-like protein 7; protein-binding, kelch-repeat, structural genomics, structur genomics consortium, SGC, kelch repeat, nucleus, protein BI; 1.63A {Homo sapiens} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2vpj_A Kelch-like protein 12; adaptor protein, WNT signaling pathway, protein-binding, UBI degradation, UBL conjugation pathway, CUL3, kelch repeat; 1.85A {Homo sapiens} Back     alignment and structure
>4asc_A Kelch repeat and BTB domain-containing protein 5; protein binding, cytoskeleton; 1.78A {Homo sapiens} Back     alignment and structure
>2woz_A Kelch repeat and BTB domain-containing protein 10; protein binding, invasion and metastasis, UBL conjugation pathway, UBL protein folding; 2.00A {Rattus norvegicus} Back     alignment and structure
>2uvk_A YJHT; unknown function, hypothetical protein, sialic acid metabolism, kelch repeat, beta-propeller; HET: MSE; 1.50A {Escherichia coli} Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>2zwa_A Leucine carboxyl methyltransferase 2; HET: SAH CIT; 1.70A {Saccharomyces cerevisiae} PDB: 2zw9_A* 2zzk_A* Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>1k3i_A Galactose oxidase precursor; blade beta propeller, prosequence form, precursor of copper enzyme., oxidoreductase; 1.40A {Fusarium SP} SCOP: b.1.18.2 b.18.1.1 b.69.1.1 PDB: 1gof_A 1gog_A 1goh_A 2eie_A 2jkx_A 2vz1_A 2vz3_A 2eic_A 2eib_A 1t2x_A 2eid_A 2wq8_A Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3mbr_X Glutamine cyclotransferase; beta-propeller; 1.44A {Xanthomonas campestris} Back     alignment and structure
>3dsm_A Uncharacterized protein bacuni_02894; seven_blated beta propeller, structural genomics, PSI-2, Pro structure initiative; 1.90A {Bacteroides uniformis} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3nol_A Glutamine cyclotransferase; beta-propeller, glutaminyl cyclase, pyrogl transferase; 1.70A {Zymomonas mobilis} PDB: 3nom_A Back     alignment and structure
>1l0q_A Surface layer protein; SLP, S-layer, 7-bladed beta-propeller superfamily, protein binding; HET: YCM; 2.40A {Methanosarcina mazei} SCOP: b.1.3.1 b.69.2.3 Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3nok_A Glutaminyl cyclase; beta-propeller, cyclotransferase, pyrogl transferase; HET: MES DDQ; 1.65A {Myxococcus xanthus} Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3q7m_A Lipoprotein YFGL, BAMB; beta-propeller, BAM complex, outer membrane protein folding, negative, BAMA, protein binding; 1.65A {Escherichia coli} PDB: 3q7n_A 3q7o_A 3p1l_A 3prw_A 2yh3_A 3q54_A Back     alignment and structure
>2iwa_A Glutamine cyclotransferase; pyroglutamate, acyltransferase, glutaminyl CYCL N-terminal cyclisation; HET: NAG; 1.6A {Carica papaya} PDB: 2faw_A* Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>1rwi_B Serine/threonine-protein kinase PKND; beta propeller, structural genomics, PSI, protein structure initiative; 1.80A {Mycobacterium tuberculosis} SCOP: b.68.9.1 PDB: 1rwl_A Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>1ri6_A Putative isomerase YBHE; 7-bladed propeller, enzyme, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.00A {Escherichia coli} SCOP: b.69.11.1 Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>3bws_A Protein LP49; two-domain, immunoglobulin-like, 7-bladed beta propeller, unknown function; 1.99A {Leptospira interrogans} Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>1q7f_A NHL, brain tumor CG10719-PA; BRAT, NHL domain, NHL repeat, beta-propeller, translation; 1.95A {Drosophila melanogaster} SCOP: b.68.9.1 Back     alignment and structure
>1gxr_A ESG1, transducin-like enhancer protein 1; transcriptional CO-repressor, WD40, transcription repressor, WD repeat; 1.65A {Homo sapiens} SCOP: b.69.4.1 PDB: 2ce8_A 2ce9_A Back     alignment and structure
>2z2n_A Virginiamycin B lyase; seven-bladed beta-propeller, antibiotic resistance, E mechanism, virginiamycin B hydrolase streptogramin; HET: MSE; 1.65A {Staphylococcus aureus} PDB: 2z2o_A 2z2p_A* Back     alignment and structure
>3jrp_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>3hfq_A Uncharacterized protein LP_2219; Q88V64_lacpl, NESG, LPR118, structural genomics, PSI-2, protein structure initiative; 1.96A {Lactobacillus plantarum} Back     alignment and structure
>3vgz_A Uncharacterized protein YNCE; beta-propeller, protein binding; 1.70A {Escherichia coli} PDB: 3vh0_A* Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>2qc5_A Streptogramin B lactonase; beta propeller, lyase; 1.80A {Staphylococcus cohnii} Back     alignment and structure
>3ow8_A WD repeat-containing protein 61; structural genomics consortium, SGC, transcriptio; 2.30A {Homo sapiens} Back     alignment and structure
>3vl1_A 26S proteasome regulatory subunit RPN14; beta-propeller, chaperone, RPT6; 1.60A {Saccharomyces cerevisiae} PDB: 3acp_A Back     alignment and structure
>3scy_A Hypothetical bacterial 6-phosphogluconolactonase; 7-bladed beta-propeller, structural genomics, joint center F structural genomics, JCSG; HET: MSE; 1.50A {Bacteroides fragilis} PDB: 3fgb_A Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>2ovr_B FBW7, F-BOX/WD repeat protein 7, F-box PROT; WD40 domains, double phosphorylation, transcription-C complex; HET: TPO; 2.50A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 PDB: 2ovp_B* 2ovq_B* Back     alignment and structure
>4ery_A WD repeat-containing protein 5; WD40, WIN motif, beta propeller, 3-10 helix, lysine methyltransferase, RBBP5, ASH2L, core complex; 1.30A {Homo sapiens} PDB: 2h6k_A* 2h68_A* 2h6q_A* 3eg6_A 4erq_A 2h6n_A 4erz_A 4es0_A 4esg_A 4ewr_A 2gnq_A 2xl2_A 2xl3_A 3uvk_A* 3psl_A* 3uvl_A 3uvm_A 3uvn_A 3uvo_A 2h14_A ... Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>3u4y_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomi CS, MCSG; 2.99A {Desulfotomaculum acetoxidans} Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>1k8k_C P40, ARP2/3 complex 41 kDa subunit, P41-ARC; beta-propeller, structural protein; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1tyq_C* 1u2v_C* 2p9i_C* 2p9k_C* 2p9l_C 2p9n_C* 2p9p_C* 2p9s_C* 2p9u_C* 3rse_C 3dxm_C* 3dxk_C Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1p22_A F-BOX/WD-repeat protein 1A; ubiquitination, degradation, signaling protein; HET: SEP; 2.95A {Homo sapiens} SCOP: a.158.1.1 b.69.4.1 Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4aez_A CDC20, WD repeat-containing protein SLP1; cell cycle, KEN-BOX, D-BOX, APC/C; 2.30A {Schizosaccharomyces pombe} Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>1got_B GT-beta; complex (GTP-binding/transducer), G protein, heterotrimer signal transduction; HET: GDP; 2.00A {Bos taurus} SCOP: b.69.4.1 PDB: 1b9y_A 1b9x_A* 2trc_B 1tbg_A 1gg2_B* 1omw_B 1gp2_B 1xhm_A 2qns_A 3ah8_B* 3cik_B 3kj5_A 3krw_B* 3krx_B* 3psc_B 3pvu_B* 3pvw_B* 1a0r_B* 2bcj_B* 3sn6_B* Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>1r5m_A SIR4-interacting protein SIF2; transcription corepressor, WD40 repeat, beta propeller; 1.55A {Saccharomyces cerevisiae} Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>3dwl_C Actin-related protein 2/3 complex subunit 1; propellor, actin-binding, ATP-binding, cytoskeleton, nucleot binding, WD repeat; HET: ATP; 3.78A {Schizosaccharomyces pombe} Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>3zwl_B Eukaryotic translation initiation factor 3 subuni; 2.20A {Saccharomyces cerevisiae} Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3fvz_A Peptidyl-glycine alpha-amidating monooxygenase; beta propeller, lyase, peptide amidation, HG-MAD, Zn-MAD, CL PAIR of basic residues; 2.35A {Rattus norvegicus} PDB: 3fw0_A* Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>4a2l_A BT_4663, two-component system sensor histidine kinase/RESP; transcription, beta-propeller; HET: PGE PG4 MES 2PE; 2.60A {Bacteroides thetaiotaomicron} PDB: 4a2m_A* Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>2dg1_A DRP35, lactonase; beta propeller, hydrolase; 1.72A {Staphylococcus aureus} SCOP: b.68.6.1 PDB: 2dg0_A 2dso_A Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>1nir_A Nitrite reductase; hemoprotein, denitrification, domain swapping; HET: HEC DHE; 2.15A {Pseudomonas aeruginosa} SCOP: a.3.1.2 b.70.2.1 PDB: 1bl9_A* 1n15_A* 1n50_A* 1n90_A* 1gjq_A* 1nno_A* 1hzv_A* 1hzu_A* Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>1vyh_C Platelet-activating factor acetylhydrolase IB alpha subunit; lissencephaly, platelet activacting factor, regulator of cytoplasmic dynein; 3.4A {Mus musculus} SCOP: b.69.4.1 Back     alignment and structure
>3fm0_A Protein CIAO1; WDR39,SGC,WD40,CIAO1, nucleus, WD repeat, biosynthetic prote structural genomics, structural genomics consortium; 1.70A {Homo sapiens} Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>3g4e_A Regucalcin; six bladed beta-propeller, gluconolcatonase, organophosphate hydrolase, calcium bound, alternative splicing, cytoplasm, phosphoprotein; 1.42A {Homo sapiens} PDB: 3g4h_B Back     alignment and structure
>2pbi_B Guanine nucleotide-binding protein subunit beta 5; helix WRAP, RGS domain, DEP domain, DHEX domain, GGL domain, propeller, signaling protein; 1.95A {Mus musculus} Back     alignment and structure
>3v7d_B Cell division control protein 4; WD 40 domain, phospho-peptide complex, E3 ubiquitin ligase, cell cycle, phospho binding protein, phosphorylation; HET: SEP; 2.31A {Saccharomyces cerevisiae} PDB: 1nex_B* 3mks_B* Back     alignment and structure
>4g56_B MGC81050 protein; protein arginine methyltransferase, protein complexes, histo methylation, transferase; HET: SAH; 2.95A {Xenopus laevis} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>3mkq_A Coatomer beta'-subunit; beta-propeller, alpha-solenoid, transport protein; 2.50A {Saccharomyces cerevisiae} PDB: 2ynp_A Back     alignment and structure
>3jro_A Fusion protein of protein transport protein SEC13 nucleoporin NUP145; protein complex, cytoplasmic vesicle, endoplasmic reticulum, transport, membrane, mRNA transport; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>2ynn_A Coatomer subunit beta'; protein transport, peptide binding protein, membrane traffic COPI-mediated trafficking, dilysine motifs; 1.78A {Saccharomyces cerevisiae} PDB: 2yno_A Back     alignment and structure
>1pjx_A Dfpase, DIISOPROPYLFLUOROPHOSPHATASE; phosphotriesterase (PTE), nitrogen-calcium coordination, BET propeller; HET: ME2 MES PGE; 0.85A {Loligo vulgaris} SCOP: b.68.6.1 PDB: 1e1a_A* 2gvv_A* 2gvw_A 3byc_A 3kgg_A 3o4p_A* 3li3_A 2gvx_A 2gvu_A 3li4_A 2iaq_A 3li5_A* 2iao_A 2iap_A 2iau_A 2iax_A 2iaw_A 2ias_A 2iat_A 2iar_A ... Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3v9f_A Two-component system sensor histidine kinase/RESP regulator, hybrid (ONE-component...; beta-propeller, beta-sandwich; 3.30A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>4aow_A Guanine nucleotide-binding protein subunit beta-2; receptor, WD-repeat, beta-propeller; 2.45A {Homo sapiens} PDB: 2zkq_a Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>3k26_A Polycomb protein EED; WD40, structural genomics, NPPSFA, national project on prote structural and functional analysis, structural genomics CON SGC; HET: M3L; 1.58A {Homo sapiens} PDB: 3jzn_A* 3k27_A* 3jpx_A* 3jzg_A* 3jzh_A* 3iiw_A* 3ijc_A* 3iiy_A* 3ij0_A* 3ij1_A* 2qxv_A Back     alignment and structure
>2hqs_A Protein TOLB; TOLB, PAL, TOL, transport protein-lipoprotein complex; 1.50A {Escherichia coli} SCOP: b.68.4.1 c.51.2.1 PDB: 3iax_A 1c5k_A 2ivz_A 2w8b_B 2w8b_A 1crz_A Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>3odt_A Protein DOA1; ubiquitin, nuclear protein; HET: MSE MES; 1.35A {Saccharomyces cerevisiae} Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>1sq9_A Antiviral protein SKI8; WD repeat, beta-transducin repeat, WD40 repeat, beta propeller, recombination; 1.90A {Saccharomyces cerevisiae} SCOP: b.69.4.1 PDB: 1s4u_X Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>4gga_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; 2.04A {Homo sapiens} PDB: 4ggd_A Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>4gqb_B Methylosome protein 50; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} Back     alignment and structure
>2ojh_A Uncharacterized protein ATU1656/AGR_C_3050; TOLB, 6-stranded beta-propeller, structural genomics, PSI-2; 1.85A {Agrobacterium tumefaciens str} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>4e54_B DNA damage-binding protein 2; beta barrel, double helix, DDB1:WD40 beta-barrel fold, DNA D DNA repair, HOST-virus interactions; HET: DNA 3DR; 2.85A {Homo sapiens} PDB: 3ei4_B* Back     alignment and structure
>1pgu_A Actin interacting protein 1; WD repeat, seven-bladed beta-propeller, protein binding; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 b.69.4.1 PDB: 1pi6_A Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3i2n_A WD repeat-containing protein 92; WD40 repeats, structural genomics, structural genomic consortium, SGC, apoptosis, transcription; 1.95A {Homo sapiens} Back     alignment and structure
>2pm7_B Protein transport protein SEC13, protein transport protein SEC31; beta propeller, alpha solenoid; 2.35A {Saccharomyces cerevisiae} PDB: 2pm9_B 2pm6_B 3iko_A 3mzk_A 3mzl_A Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>3ei3_B DNA damage-binding protein 2; UV-damage, DDB, nucleotide excision repair, xeroderma pigmentosum, cytoplasm, DNA repair; HET: DNA PG4; 2.30A {Danio rerio} PDB: 3ei1_B* 3ei2_B* 4a08_B* 4a09_B* 4a0a_B* 4a0b_B* 4a0k_D* 4a0l_B* Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3no2_A Uncharacterized protein; six-bladed beta-propeller, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE CIT PEG; 1.35A {Bacteroides caccae} Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>2aq5_A Coronin-1A; WD40 repeat, 7-bladed beta-propeller, structural protein; HET: CME; 1.75A {Mus musculus} PDB: 2b4e_A Back     alignment and structure
>2ad6_A Methanol dehydrogenase subunit 1; PQQ configuration, native, oxidoredu; HET: PQQ; 1.50A {Methylophilus methylotrophus} SCOP: b.70.1.1 PDB: 2ad7_A* 2ad8_A* 4aah_A* 1g72_A* Back     alignment and structure
>2pm9_A Protein WEB1, protein transport protein SEC31; beta propeller; 3.30A {Saccharomyces cerevisiae} Back     alignment and structure
>3lrv_A PRE-mRNA-splicing factor 19; PRP19, WD40, E3 ubiquitin ligase, spliceosome, DNA damage, D repair, mRNA processing, nucleus; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2vdu_B TRNA (guanine-N(7)-)-methyltransferase- associated WD repeat protein TRM82; S-adenosyl-L-methionine, tRNA processing, phosphorylation, M7G, spout MT, WD repeat; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>3e5z_A Putative gluconolactonase; X-RAY NESG Q9RXN3 gluconolactonase, structural genomics, PSI protein structure initiative; 2.01A {Deinococcus radiodurans} Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>1erj_A Transcriptional repressor TUP1; beta-propeller, transcription inhibitor; 2.30A {Saccharomyces cerevisiae} SCOP: b.69.4.1 Back     alignment and structure
>3ott_A Two-component system sensor histidine kinase; beta-propeller, beta-sandwich, transcription; HET: TBR; 2.30A {Bacteroides thetaiotaomicron} PDB: 3va6_A Back     alignment and structure
>2z3z_A Dipeptidyl aminopeptidase IV; peptidase family S9, prolyl oligopeptidase family, serine PR proline-specific peptidase, hydrolase; HET: AIO; 1.95A {Porphyromonas gingivalis} PDB: 2z3w_A* 2d5l_A 2eep_A* 2dcm_A* Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>3c7x_A Matrix metalloproteinase-14; membrane protein interaction, Pro-MMP-2, TIMP-2, metastasis, calcium, cleavage on PAIR of basic residues, hydrolase; 1.70A {Homo sapiens} Back     alignment and structure
>1jmx_B Amine dehydrogenase; oxidoreductase; HET: TRQ HEC; 1.90A {Pseudomonas putida} SCOP: b.69.2.2 PDB: 1jmz_B* Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>3sfz_A APAF-1, apoptotic peptidase activating factor 1; apoptosis, caspase activation, cytochrome C, procaspase-9, A nucleotide, cytosol; HET: ADP; 3.00A {Mus musculus} PDB: 3shf_A* 3iyt_A* 3iza_A* Back     alignment and structure
>3ju4_A Endo-N-acetylneuraminidase; endonf, polysia, high-resolution, glycosidase, hydrolase; HET: SLB; 0.98A {Enterobacteria phage K1F} PDB: 3gvl_A* 3gvj_A* 3gvk_A* 1v0e_A 1v0f_A* Back     alignment and structure
>1qhu_A Protein (hemopexin); beta propeller, HAEM binding and transport, iron metabolism, binding protein; HET: HEM; 2.30A {Oryctolagus cuniculus} SCOP: b.66.1.1 b.66.1.1 PDB: 1qjs_A* Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>4a11_B DNA excision repair protein ERCC-8; DNA binding protein, DNA damage repair; HET: DNA; 3.31A {Homo sapiens} Back     alignment and structure
>1qks_A Cytochrome CD1 nitrite reductase; enzyme, oxidoreductase, denitrification, electron transport, periplasmic; HET: HEC DHE; 1.28A {Paracoccus pantotrophus} SCOP: a.3.1.2 b.70.2.1 PDB: 1aof_A* 1aoq_A* 1aom_A* 1e2r_A* 1hj5_A* 1h9x_A* 1h9y_A* 1hcm_A* 1hj3_A* 1hj4_A* 1dy7_A* 1gq1_A* Back     alignment and structure
>1kb0_A Quinohemoprotein alcohol dehydrogenase; beta-propeller fold, cytochrome C, oxidoreductase; HET: TRO HEC PQQ; 1.44A {Comamonas testosteroni} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1pby_B Quinohemoprotein amine dehydrogenase 40 kDa subunit; oxidoreductase; HET: TRW HEM; 1.70A {Paracoccus denitrificans} SCOP: b.69.2.2 PDB: 1jju_B* Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3bg1_A Protein SEC13 homolog; NPC, transport, WD repeat, autocatalytic cleavage, mRNA transport, nuclear pore complex, nucleus, phosphoprotein; 3.00A {Homo sapiens} PDB: 3bg0_A Back     alignment and structure
>3azo_A Aminopeptidase; POP family, hydrolase; 2.00A {Streptomyces morookaensis} PDB: 3azp_A 3azq_A Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>1pex_A Collagenase-3, MMP-13; C-terminal hemopexin-like domain of matrix- metalloproteinase, metalloprotease; 2.70A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>2xbg_A YCF48-like protein; photosynthesis, photosystem II, beta-propeller, assembly FAC; 1.50A {Thermosynechococcus elongatus} Back     alignment and structure
>1yiq_A Quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM; 2.20A {Pseudomonas putida} Back     alignment and structure
>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha} Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>3c5m_A Oligogalacturonate lyase; blade-shaped beta-propeller, structural genomics, PSI-2, protein structure initiative; 2.60A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>2p4o_A Hypothetical protein; putative lactonase, structural genomics, joint center for ST genomics, JCSG, protein structure initiative, PSI-2; HET: MSE; 1.90A {Nostoc punctiforme} SCOP: b.68.6.3 Back     alignment and structure
>2bkl_A Prolyl endopeptidase; mechanistic study, celiac sprue, hydrolase, protease; HET: ZAH MES; 1.5A {Myxococcus xanthus} Back     alignment and structure
>3f3f_A Nucleoporin SEH1; structural protein, protein complex, nucleopori complex, nuclear pore complex, macromolecular assembly, MEM coat; 2.90A {Saccharomyces cerevisiae} PDB: 3f3g_A 3f3p_A 3ewe_A Back     alignment and structure
>3iz6_a 40S ribosomal protein RACK1 (RACK1); eukaryotic ribosome,homology modeling,de novo modeling,ribos proteins,novel ribosomal proteins, ribosome; 5.50A {Triticum aestivum} Back     alignment and structure
>3gre_A Serine/threonine-protein kinase VPS15; seven-bladed propeller, WD repeat, scaffold protein, ATP- binding, endosome, golgi apparatus; 1.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3pe7_A Oligogalacturonate lyase; seven-bladed beta-propeller; 1.65A {Yersinia enterocolitica subsp} Back     alignment and structure
>2hes_X YDR267CP; beta-propeller, WD40 repeat, biosynthetic protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>1kv9_A Type II quinohemoprotein alcohol dehydrogenase; electron transfer, oxidoreductase; HET: PQQ HEM EPE; 1.90A {Pseudomonas putida} SCOP: a.3.1.6 b.70.1.1 Back     alignment and structure
>1yfq_A Cell cycle arrest protein BUB3; WD repeat WD40 repeat beta transducin repeat all beta, signaling protein; 1.10A {Saccharomyces cerevisiae} SCOP: b.69.4.2 PDB: 1u4c_A 2i3s_A 2i3t_A Back     alignment and structure
>1w6s_A Methanol dehydrogenase subunit 1; anisotropic, electron transfer, oxidoreductase, calcium- binding, methanol utilization, PQQ; HET: PQQ; 1.2A {Methylobacterium extorquens} SCOP: b.70.1.1 PDB: 1h4i_A* 1h4j_A* 2d0v_A* 1lrw_A* Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>1itv_A MMP9; adaptive molecular recognition, beta propeller, dimer, hydrolase; 1.95A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>1npe_A Nidogen, entactin; glycoprotein, basement membrane, beta-propeller, EGF-like, structural protein; 2.30A {Mus musculus} SCOP: b.68.5.1 Back     alignment and structure
>4ggc_A P55CDC, cell division cycle protein 20 homolog; cell cycle, mitosis, securin, ubiquitination, WD40; HET: MRD; 1.35A {Homo sapiens} Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>2fp8_A Strictosidine synthase; six bladed beta propeller fold, lyase; 2.30A {Rauvolfia serpentina} PDB: 2fp9_A* 2fpc_A* 2vaq_A* 3v1s_A* 2fpb_A* 2v91_A* Back     alignment and structure
>3oyo_A Hemopexin fold protein CP4; seeds, plant protein; 2.10A {Vigna unguiculata} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3mmy_A MRNA export factor; mRNA export, nuclear protein; HET: MES; 1.65A {Homo sapiens} Back     alignment and structure
>3frx_A Guanine nucleotide-binding protein subunit beta- like protein; RACK1, WD40, beta propeller, ribosome, translation, acetylation; 2.13A {Saccharomyces cerevisiae} PDB: 3izb_a 3o2z_T 3o30_T 3u5c_g 3u5g_g 3rfg_A 3rfh_A 1trj_A 3jyv_R* Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>1qhu_A Protein (hemopexin); beta propeller, HAEM binding and transport, iron metabolism, binding protein; HET: HEM; 2.30A {Oryctolagus cuniculus} SCOP: b.66.1.1 b.66.1.1 PDB: 1qjs_A* Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>2xdw_A Prolyl endopeptidase; alpha/beta-hydrolase, amnesia, beta-propeller, hydrolase, in; HET: PHQ TAM; 1.35A {Sus scrofa} PDB: 1qfm_A 1qfs_A* 1h2w_A* 3eq7_A* 3eq8_A* 3eq9_A* 1e8m_A* 1e8n_A 1h2z_A 1uoo_A 1uop_A 1uoq_A 1o6f_A 1h2x_A 1h2y_A* 1o6g_A 1vz3_A 1e5t_A 1vz2_A 3ddu_A* Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>4h5i_A Guanine nucleotide-exchange factor SEC12; copii vesicle budding, potassium binding site, beta propelle protein transport; 1.36A {Saccharomyces cerevisiae} PDB: 4h5j_A Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>1su3_A Interstitial collagenase; prodomain, hemopexin domain, exocite, structural proteomics in europe, spine, structural genomics, hydrolase; HET: EPE; 2.20A {Homo sapiens} SCOP: a.20.1.2 b.66.1.1 d.92.1.11 PDB: 2clt_A 1fbl_A* Back     alignment and structure
>3dr2_A Exported gluconolactonase; gluconolactonase SMP-30, six-bladed-propeller dimer, vitamin C, hydrolase; 1.67A {Xanthomonas campestris PV} Back     alignment and structure
>2xyi_A Probable histone-binding protein CAF1; transcription, repressor, phosphoprotein, WD-repeat; HET: PG4; 1.75A {Drosophila melanogaster} PDB: 3c99_A 3c9c_A 2yb8_B 2yba_A 2xu7_A* 3gfc_A 3cfs_B 3cfv_B Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>1k32_A Tricorn protease; protein degradation, substrate gating, serine protease, beta propeller, proteasome, hydrolase; 2.00A {Thermoplasma acidophilum} SCOP: b.36.1.3 b.68.7.1 b.69.9.1 c.14.1.2 PDB: 1n6e_A 1n6d_A 1n6f_A* Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>3lp9_A LS-24; SEED albumin, plant protein; HET: SPM; 2.20A {Lathyrus sativus} PDB: 3s0l_A 3v6n_A 4hsd_A 3s18_A Back     alignment and structure
>3ba0_A Macrophage metalloelastase; FULL-length MMP-12, hemopexin domain, catalytic domain, domain interaction., calcium, extracellular matrix; 3.00A {Homo sapiens} PDB: 2jxy_A Back     alignment and structure
>3v64_C Agrin; beta propeller, laminin-G, signaling, protein binding; HET: NAG; 2.85A {Rattus norvegicus} Back     alignment and structure
>3hrp_A Uncharacterized protein; NP_812590.1, structural genomics protein of unknown function structural genomics; HET: MSE; 1.70A {Bacteroides thetaiotaomicron vpi-5482} Back     alignment and structure
>3b7f_A Glycosyl hydrolase, BNR repeat; 7-bladed beta-propeller fold, structural genomics, joint CEN structural genomics, JCSG; 2.20A {Ralstonia eutropha} Back     alignment and structure
>3o4h_A Acylamino-acid-releasing enzyme; alpha/beta hydrolase fold, beta propeller, hydrolase, oligop SIZE selectivity; HET: GOL; 1.82A {Aeropyrum pernix} PDB: 3o4i_A 3o4j_A 2hu5_A* 1ve7_A* 1ve6_A* 2hu7_A* 3o4g_A 2hu8_A* 2qr5_A 2qzp_A Back     alignment and structure
>3sjl_D Methylamine dehydrogenase heavy chain; MAUG, C-heme, quinone cofactor, oxidoreductase-electron transport complex; HET: 0AF HEC MES; 1.63A {Paracoccus denitrificans} PDB: 2gc7_A* 2j55_H* 2j56_H* 2j57_G* 3l4m_D* 3l4o_D* 3orv_D* 3pxs_D* 3pxt_D* 3rlm_D* 2gc4_A* 3rn0_D* 3rn1_D* 3rmz_D* 3svw_D* 3sws_D* 3sxt_D* 3pxw_D* 3sle_D* 1mg2_A* ... Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>3oyo_A Hemopexin fold protein CP4; seeds, plant protein; 2.10A {Vigna unguiculata} Back     alignment and structure
>3hxj_A Pyrrolo-quinoline quinone; all beta protein. incomplete 8-blade beta-propeller., struct genomics, PSI-2, protein structure initiative; 2.00A {Methanococcus maripaludis} Back     alignment and structure
>3iuj_A Prolyl endopeptidase; hydrolase; 1.80A {Aeromonas punctata} PDB: 3iul_A 3ium_A 3ivm_A* 3iur_A* 3iun_A* 3iuq_A* 3muo_A* 3mun_A* Back     alignment and structure
>2ecf_A Dipeptidyl peptidase IV; prolyl oligopeptidase family, peptidase family S9, hydrolase; 2.80A {Stenotrophomonas maltophilia} Back     alignment and structure
>2hz6_A Endoplasmic reticulum to nucleus signalling 1 isoform 1 variant; triangular beta-sheet cluster, signaling protein; 3.10A {Homo sapiens} Back     alignment and structure
>2ymu_A WD-40 repeat protein; unknown function, two domains; 1.79A {Nostoc punctiforme} Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>2ghs_A AGR_C_1268P; regucalcin, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; 1.55A {Agrobacterium tumefaciens str} SCOP: b.68.6.1 Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>2xzm_R RACK1; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_R Back     alignment and structure
>3a0f_A Xyloglucanase; beta-propeller, hydrolase; 2.50A {Geotrichum SP} Back     alignment and structure
>4hw6_A Hypothetical protein, IPT/TIG domain protein; putative carbohydrate bindning two domains protein, IPT/TIG (PF01833), 6-beta-propeller; HET: MSE; 1.70A {Bacteroides ovatus} Back     alignment and structure
>1hxn_A Hemopexin, HPX; heme, binding protein; 1.80A {Oryctolagus cuniculus} SCOP: b.66.1.1 Back     alignment and structure
>1flg_A Protein (quinoprotein ethanol dehydrogenase); superbarrel, oxidoreductase; HET: PQQ; 2.60A {Pseudomonas aeruginosa} SCOP: b.70.1.1 Back     alignment and structure
>1ijq_A LDL receptor, low-density lipoprotein receptor; beta-propeller, lipid transport; 1.50A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 Back     alignment and structure
>3c7x_A Matrix metalloproteinase-14; membrane protein interaction, Pro-MMP-2, TIMP-2, metastasis, calcium, cleavage on PAIR of basic residues, hydrolase; 1.70A {Homo sapiens} Back     alignment and structure
>3dw8_B Serine/threonine-protein phosphatase 2A 55 kDa RE subunit B alpha isoform; holoenzyme, PR55, WD repeat, hydrolase, iron, manganese binding, methylation, phosphoprotein, protein phosphatase; HET: 1ZN; 2.85A {Homo sapiens} Back     alignment and structure
>1yr2_A Prolyl oligopeptidase; prolyl endopeptidase, mechanistic study, celiac sprue, hydro; 1.80A {Novosphingobium capsulatum} Back     alignment and structure
>1pex_A Collagenase-3, MMP-13; C-terminal hemopexin-like domain of matrix- metalloproteinase, metalloprotease; 2.70A {Homo sapiens} SCOP: b.66.1.1 Back     alignment and structure
>3vu4_A KMHSV2; beta-propeller fold, protein transport; 2.60A {Kluyveromyces marxianus} PDB: 4av9_A 4av8_A 4exv_A Back     alignment and structure
>1jof_A Carboxy-CIS,CIS-muconate cyclase; beta-propeller, homotetramer, seMet-protein, isomerase; HET: PIN; 2.50A {Neurospora crassa} SCOP: b.69.10.1 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>2qe8_A Uncharacterized protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE UNL PG4; 1.35A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3tc9_A Hypothetical hydrolase; 6-bladed beta-propeller, immunoglobulin-like, structural GEN joint center for structural genomics, JCSG; 2.23A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2mad_H Methylamine dehydrogenase (heavy subunit); oxidoreductase(CHNH2(D)-deaminating); HET: TRQ; 2.25A {Paracoccus versutus} SCOP: b.69.2.1 PDB: 1mae_H* 1maf_H* Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>3c75_H MADH, methylamine dehydrogenase heavy chain; copper proteins, electron transfer complex, TTQ, electron transport, oxidoreductase, periplasm, transport, metal- binding; HET: TRQ; 2.50A {Paracoccus versutus} Back     alignment and structure
>3lp9_A LS-24; SEED albumin, plant protein; HET: SPM; 2.20A {Lathyrus sativus} PDB: 3s0l_A 3v6n_A 4hsd_A 3s18_A Back     alignment and structure
>2gop_A Trilobed protease; beta propeller, open velcro, hydrolase; 2.00A {Pyrococcus furiosus} Back     alignment and structure
>1nr0_A Actin interacting protein 1; beta propeller, WD40 repeat, ADF, cofilin, structural genomics, PSI, protein structure initiative; 1.70A {Caenorhabditis elegans} SCOP: b.69.4.1 b.69.4.1 PDB: 1pev_A Back     alignment and structure
>1mda_H Methylamine dehydrogenase (heavy subunit); electron transport; HET: TRQ; 2.50A {Paracoccus denitrificans} SCOP: b.69.2.1 Back     alignment and structure
>1gen_A Gelatinase A; hydrolase, hemopexin domain, metalloprotease, hydrolase (metalloprotease); 2.15A {Homo sapiens} SCOP: b.66.1.1 PDB: 1rtg_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 306
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 7e-16
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 4e-13
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 8e-12
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 2e-11
d1zgka1288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 1e-10
d1zgka1 288 b.68.11.1 (A:322-609) Kelch-like ECH-associated pr 1e-08
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 2e-13
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 9e-12
d1k3ia3 387 b.69.1.1 (A:151-537) Galactose oxidase, central do 3e-10
d1k3ia3387 b.69.1.1 (A:151-537) Galactose oxidase, central do 4e-09
d1k3ia3 387 b.69.1.1 (A:151-537) Galactose oxidase, central do 9e-08
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure

class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: Kelch motif
family: Kelch motif
domain: Kelch-like ECH-associated protein 1, KEAP1
species: Human (Homo sapiens) [TaxId: 9606]
 Score = 74.2 bits (180), Expect = 7e-16
 Identities = 41/123 (33%), Positives = 57/123 (46%), Gaps = 4/123 (3%)

Query: 66  SNSVWSFNPNNKQWTQEPNMTYPRKIFSFVSCLDKIYAIGGQDCKTLLSSVECYDPVAHT 125
            NS   + P   +W     M   R         + IYA GG D +  L+SVE YD    T
Sbjct: 163 LNSAECYYPERNEWRMITAMNTIRSGAGVCVLHNCIYAAGGYDGQDQLNSVERYDVETET 222

Query: 126 WEDVAPLKIARMGMAVAEINDKIWIAGGYTGDKMNPVTDKVECYDPRTNTWTTLATKLRY 185
           W  VAP+K  R  + +     +I++ GGY G   +   D VECYDP T+TW+ +   +  
Sbjct: 223 WTFVAPMKHRRSALGITVHQGRIYVLGGYDG---HTFLDSVECYDPDTDTWSEVTR-MTS 278

Query: 186 PRY 188
            R 
Sbjct: 279 GRS 281


>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 288 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Length = 387 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query306
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 100.0
d1zgka1288 Kelch-like ECH-associated protein 1, KEAP1 {Human 100.0
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 100.0
d1k3ia3387 Galactose oxidase, central domain {Fungi (Fusarium 99.97
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 97.6
d1l0qa2301 Surface layer protein {Archaeon Methanosarcina maz 97.56
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 97.44
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 97.17
d1k8kc_ 371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 97.15
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 96.99
d1k8kc_371 Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taur 96.98
d1gxra_337 Groucho/tle1, C-terminal domain {Human (Homo sapie 96.92
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 96.86
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 96.74
d1tbga_340 beta1-subunit of the signal-transducing G protein 96.67
d1nr0a1311 Actin interacting protein 1 {Nematode (Caenorhabdi 96.57
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 96.47
d1tbga_340 beta1-subunit of the signal-transducing G protein 96.46
d1q7fa_279 Brain tumor cg10719-pa {Fruit fly (Drosophila mela 96.39
d1su3a2195 Collagenase (MMP1), C-terminal domain {Human (Homo 96.35
d2dg1a1319 Lactonase Drp35 {Staphylococcus aureus [TaxId: 128 96.3
d1itva_195 Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 96.28
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 96.26
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 96.22
d1erja_388 Tup1, C-terminal domain {Baker's yeast (Saccharomy 96.17
d1pexa_192 Collagenase-3 (MMP-13), C-terminal domain {Human ( 96.11
d1nr0a2299 Actin interacting protein 1 {Nematode (Caenorhabdi 95.93
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 95.88
d1jmxb_346 Quinohemoprotein amine dehydrogenase B chain {Pseu 95.66
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 95.46
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 95.46
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 95.41
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 95.32
d1nexb2355 Cdc4 propeller domain {Baker's yeast (Saccharomyce 95.26
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 94.79
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 94.79
d2ghsa1295 Regucalcin {Agrobacterium tumefaciens [TaxId: 358] 94.68
d2p4oa1302 Hypothetical protein All0351 homologue {Nostoc pun 94.57
d1pjxa_314 Diisopropylfluorophosphatase (phosphotriesterase, 94.38
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 93.92
d2ovrb2342 F-box/WD repeat-containing protein 7, FBXW7 {Human 93.81
d1k32a3 360 Tricorn protease domain 2 {Archaeon Thermoplasma a 93.41
d1qhua1192 Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 92.74
d1kv9a2 560 Quinoprotein alcohol dehydrogenase, N-terminal dom 92.61
d1qksa2 432 C-terminal (heme d1) domain of cytochrome cd1-nitr 91.99
d1gena_200 Gelatinase A (MMP-2), C-terminal domain {Human (Ho 91.97
d1vyhc1317 Platelet-activating factor acetylhydrolase IB subu 91.97
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 91.25
d1pbyb_337 Quinohemoprotein amine dehydrogenase B chain {Para 91.07
d1qhua1192 Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 90.96
d1kv9a2 560 Quinoprotein alcohol dehydrogenase, N-terminal dom 90.87
d1pgua1325 Actin interacting protein 1 {Baker's yeast (Saccha 90.69
d2ad6a1 571 Methanol dehydrogenase, heavy chain {Methylophilus 90.63
d1kb0a2 573 Quinoprotein alcohol dehydrogenase, N-terminal dom 90.28
d1hxna_210 Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 90.16
d1rwia_260 Serine/threonine-protein kinase PknD {Mycobacteriu 89.43
d1kb0a2 573 Quinoprotein alcohol dehydrogenase, N-terminal dom 89.03
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 88.49
d1jmxb_ 346 Quinohemoprotein amine dehydrogenase B chain {Pseu 86.55
d1hzua2 426 C-terminal (heme d1) domain of cytochrome cd1-nitr 86.26
d1flga_ 582 Ethanol dehydrogenase {Pseudomonas aeruginosa [Tax 86.2
d1ri6a_ 333 Putative isomerase YbhE {Escherichia coli [TaxId: 85.84
d1itva_195 Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 85.22
d2ad6a1 571 Methanol dehydrogenase, heavy chain {Methylophilus 82.69
d1pexa_192 Collagenase-3 (MMP-13), C-terminal domain {Human ( 82.27
d1p22a2293 F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Hom 80.03
>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All beta proteins
fold: 6-bladed beta-propeller
superfamily: Kelch motif
family: Kelch motif
domain: Kelch-like ECH-associated protein 1, KEAP1
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=1.9e-47  Score=314.61  Aligned_cols=279  Identities=25%  Similarity=0.403  Sum_probs=248.2

Q ss_pred             ccceeEEecccccceeEEEEEEeec--CceeeecccccccccceE------EEEeCccCcCCCCcccceeeceEEEEeCC
Q psy9754           4 IWDWELICKEGTEGIKLLVIWIMDI--VTYDLSIERVSQRYDVKI------NSLAGGVDPSSDEKTTDIVSNSVWSFNPN   75 (306)
Q Consensus         4 ~~~~~l~~~gG~~~~~~~~~~~~~~--~~W~~~~~~p~~r~~~~~------i~v~GG~~~~~~~~~~~~~~~~~~~~d~~   75 (306)
                      .++..||||||.....+.+++.||+  ++|++++++|.+|.+|++      |||+||......   ....++++++||+.
T Consensus         2 ~~g~~iyv~GG~~~~~~~~~~~yd~~t~~W~~~~~~p~~R~~~~~~~~~~~iyv~GG~~~~~~---~~~~~~~~~~yd~~   78 (288)
T d1zgka1           2 KVGRLIYTAGGYFRQSLSYLEAYNPSNGTWLRLADLQVPRSGLAGCVVGGLLYAVGGRNNSPD---GNTDSSALDCYNPM   78 (288)
T ss_dssp             CCCCCEEEECCBSSSBCCCEEEEETTTTEEEECCCCSSCCBSCEEEEETTEEEEECCEEEETT---EEEECCCEEEEETT
T ss_pred             CcCCEEEEECCcCCCCCceEEEEECCCCeEEECCCCCCccceeEEEEECCEEEEEeCcccCCC---Cccccchhhhcccc
Confidence            3577899999997777778999999  689999999999999998      999999854321   11357899999999


Q ss_pred             CCCeeeCCCCCCCccceeeEEECCEEEEEccCCCCCCCceeEEEeCCCCcEEeccCCcccccceeeEEECCEEEEEcccC
Q psy9754          76 NKQWTQEPNMTYPRKIFSFVSCLDKIYAIGGQDCKTLLSSVECYDPVAHTWEDVAPLKIARMGMAVAEINDKIWIAGGYT  155 (306)
Q Consensus        76 t~~W~~~~~~~~~~~~~~~~~~~~~iyv~GG~~~~~~~~~~~~~d~~~~~w~~~~~~~~~~~~~~~~~~~~~iyv~GG~~  155 (306)
                      +++|+.++++|.+|..|+++.++++||++||.......+..+.+|+.+++|...+.++..|..++++..+++++++||..
T Consensus        79 ~~~w~~~~~~p~~r~~~~~~~~~~~i~~~gg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~r~~~~~~~~~~~~~~~GG~~  158 (288)
T d1zgka1          79 TNQWSPCAPMSVPRNRIGVGVIDGHIYAVGGSHGCIHHNSVERYEPERDEWHLVAPMLTRRIGVGVAVLNRLLYAVGGFD  158 (288)
T ss_dssp             TTEEEECCCCSSCCBTCEEEEETTEEEEECCEETTEECCCEEEEETTTTEEEECCCCSSCCBSCEEEEETTEEEEECCBC
T ss_pred             cccccccccccceecceeccccceeeEEecceecccccceeeeeccccCccccccccccccccceeeeeeecceEecCcc
Confidence            99999999999999999999999999999998888788899999999999999999999999999999999999999987


Q ss_pred             CCCCCCCCccEEEEeCCCCeeEEcccccCCcceeEEEEEEeCCEEEEEcCCCCCCCCCcccccccceeeEEECCCCceEe
Q psy9754         156 GDKMNPVTDKVECYDPRTNTWTTLATKLRYPRYLATLVSVNNEKLYIIGGASQTDATNTQKMYSVSDLDVFVSNEKEWKF  235 (306)
Q Consensus       156 ~~~~~~~~~~~~~~d~~~~~W~~~~~~~~~~~~~~~~~~~~~~~iyi~GG~~~~~~~~~~~~~~~~~~~~y~~~~~~W~~  235 (306)
                      ....   ...++.||+.+++|... ...+.++..++++... ++|+++||.....        .+.+.++||..+++|+.
T Consensus       159 ~~~~---~~~~~~~d~~~~~~~~~-~~~~~~~~~~~~~~~~-~~i~i~GG~~~~~--------~~~~~~~~~~~~~~~~~  225 (288)
T d1zgka1         159 GTNR---LNSAECYYPERNEWRMI-TAMNTIRSGAGVCVLH-NCIYAAGGYDGQD--------QLNSVERYDVETETWTF  225 (288)
T ss_dssp             SSCB---CCCEEEEETTTTEEEEC-CCCSSCCBSCEEEEET-TEEEEECCBCSSS--------BCCCEEEEETTTTEEEE
T ss_pred             cccc---cceEEEeeccccccccc-ccccccccccccccee-eeEEEecCccccc--------cccceeeeeecceeeec
Confidence            6554   57899999999999999 7777788888888888 9999999986543        34788999999999999


Q ss_pred             cccCCcccccceeeeeCCEEEEEeCccCccccccceEEEeeccccceeccCCCCcccccceeeEEe
Q psy9754         236 VTELVVPRHAHSASVLSSQILIIGGVTTVYKRTLKSVECWCFDRQAWIKGVSGLPATILGHSSVAL  301 (306)
Q Consensus       236 ~~~~p~~~~~~~~~~~~~~i~v~GG~~~~~~~~~~~~~~yd~~~~~W~~~~~~~p~~r~~~~~~~~  301 (306)
                      ++++|.+|..|+++.++++|||+||.+.  ...++++++||+++++|++ ++.||.+|.+|++|+.
T Consensus       226 ~~~~p~~r~~~~~~~~~~~l~v~GG~~~--~~~~~~v~~yd~~~~~W~~-~~~~p~~R~~~~~~~~  288 (288)
T d1zgka1         226 VAPMKHRRSALGITVHQGRIYVLGGYDG--HTFLDSVECYDPDTDTWSE-VTRMTSGRSGVGVAVT  288 (288)
T ss_dssp             CCCCSSCCBSCEEEEETTEEEEECCBCS--SCBCCEEEEEETTTTEEEE-EEECSSCCBSCEEEEC
T ss_pred             ccCccCcccceEEEEECCEEEEEecCCC--CeecceEEEEECCCCEEEE-CCCCCCCcEeEEEEEC
Confidence            9999999999999999999999999865  3566889999999999999 7999999999998874



>d1zgka1 b.68.11.1 (A:322-609) Kelch-like ECH-associated protein 1, KEAP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1k3ia3 b.69.1.1 (A:151-537) Galactose oxidase, central domain {Fungi (Fusarium sp.) [TaxId: 29916]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1l0qa2 b.69.2.3 (A:1-301) Surface layer protein {Archaeon Methanosarcina mazei [TaxId: 2209]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1k8kc_ b.69.4.1 (C:) Arp2/3 complex 41 kDa subunit ARPC1 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1gxra_ b.69.4.1 (A:) Groucho/tle1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1nr0a1 b.69.4.1 (A:2-312) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1tbga_ b.69.4.1 (A:) beta1-subunit of the signal-transducing G protein heterotrimer {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1q7fa_ b.68.9.1 (A:) Brain tumor cg10719-pa {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1su3a2 b.66.1.1 (A:271-465) Collagenase (MMP1), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2dg1a1 b.68.6.1 (A:6-324) Lactonase Drp35 {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1itva_ b.66.1.1 (A:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1erja_ b.69.4.1 (A:) Tup1, C-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pexa_ b.66.1.1 (A:) Collagenase-3 (MMP-13), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nr0a2 b.69.4.1 (A:313-611) Actin interacting protein 1 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1nexb2 b.69.4.1 (B:370-744) Cdc4 propeller domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d2ghsa1 b.68.6.1 (A:20-314) Regucalcin {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2p4oa1 b.68.6.3 (A:4-305) Hypothetical protein All0351 homologue {Nostoc punctiforme [TaxId: 272131]} Back     information, alignment and structure
>d1pjxa_ b.68.6.1 (A:) Diisopropylfluorophosphatase (phosphotriesterase, DFP) {Squid (Loligo vulgaris) [TaxId: 6622]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ovrb2 b.69.4.1 (B:2365-2706) F-box/WD repeat-containing protein 7, FBXW7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k32a3 b.69.9.1 (A:320-679) Tricorn protease domain 2 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1qhua1 b.66.1.1 (A:24-215) Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1qksa2 b.70.2.1 (A:136-567) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1gena_ b.66.1.1 (A:) Gelatinase A (MMP-2), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyhc1 b.69.4.1 (C:92-408) Platelet-activating factor acetylhydrolase IB subunit alpha {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pbyb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Paracoccus denitrificans [TaxId: 266]} Back     information, alignment and structure
>d1qhua1 b.66.1.1 (A:24-215) Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1kv9a2 b.70.1.1 (A:1-560) Quinoprotein alcohol dehydrogenase, N-terminal domain {Pseudomonas putida, hk5 [TaxId: 303]} Back     information, alignment and structure
>d1pgua1 b.69.4.1 (A:2-326) Actin interacting protein 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1hxna_ b.66.1.1 (A:) Hemopexin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1rwia_ b.68.9.1 (A:) Serine/threonine-protein kinase PknD {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1kb0a2 b.70.1.1 (A:1-573) Quinoprotein alcohol dehydrogenase, N-terminal domain {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jmxb_ b.69.2.2 (B:) Quinohemoprotein amine dehydrogenase B chain {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1hzua2 b.70.2.1 (A:118-543) C-terminal (heme d1) domain of cytochrome cd1-nitrite reductase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1flga_ b.70.1.1 (A:) Ethanol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1ri6a_ b.69.11.1 (A:) Putative isomerase YbhE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1itva_ b.66.1.1 (A:) Gelatinase B (MMP-9) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ad6a1 b.70.1.1 (A:1-571) Methanol dehydrogenase, heavy chain {Methylophilus methylotrophus, w3a1 [TaxId: 17]} Back     information, alignment and structure
>d1pexa_ b.66.1.1 (A:) Collagenase-3 (MMP-13), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p22a2 b.69.4.1 (A:253-545) F-box/WD-repeat protein 1 (beta-TRCP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure