Psyllid ID: psy9757
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 659 | ||||||
| 195477245 | 631 | GE16877 [Drosophila yakuba] gi|194187666 | 0.884 | 0.923 | 0.525 | 1e-173 | |
| 195163954 | 653 | GL14545 [Drosophila persimilis] gi|19410 | 0.892 | 0.900 | 0.524 | 1e-173 | |
| 195046997 | 677 | GH24648 [Drosophila grimshawi] gi|193893 | 0.886 | 0.862 | 0.524 | 1e-172 | |
| 198469946 | 653 | GA19585 [Drosophila pseudoobscura pseudo | 0.892 | 0.900 | 0.522 | 1e-172 | |
| 24639609 | 631 | CG6428 [Drosophila melanogaster] gi|7290 | 0.884 | 0.923 | 0.522 | 1e-172 | |
| 194767806 | 655 | lyso [Drosophila ananassae] gi|190622890 | 0.886 | 0.891 | 0.519 | 1e-172 | |
| 195340911 | 631 | GM12708 [Drosophila sechellia] gi|194131 | 0.887 | 0.927 | 0.520 | 1e-171 | |
| 194887951 | 636 | GG18566 [Drosophila erecta] gi|190648485 | 0.884 | 0.916 | 0.520 | 1e-171 | |
| 307178114 | 627 | L-asparaginase [Camponotus floridanus] | 0.893 | 0.939 | 0.514 | 1e-169 | |
| 195456970 | 656 | GK15547 [Drosophila willistoni] gi|19417 | 0.884 | 0.888 | 0.517 | 1e-169 |
| >gi|195477245|ref|XP_002100142.1| GE16877 [Drosophila yakuba] gi|194187666|gb|EDX01250.1| GE16877 [Drosophila yakuba] | Back alignment and taxonomy information |
|---|
Score = 613 bits (1581), Expect = e-173, Method: Compositional matrix adjust.
Identities = 309/588 (52%), Positives = 415/588 (70%), Gaps = 5/588 (0%)
Query: 69 SEDRLESKVLVLYTGGTIGMEDNEQGALAPSSKPLTDKIRENPLLYDRHYDVCK---TQD 125
++D E+ V V+YTGGTIGM NE+ ALAP L IR+ P ++D Y + + +
Sbjct: 44 AQDVKEAMVKVIYTGGTIGMVRNERNALAPIPNALVRSIRKYPNIHDEEYALRRFGTSAS 103
Query: 126 GNVLVLPRVKDT-RRVLYKVVEYTPLLDSSNMCQVHWIKIANDIKEYYESYDGFVILHGT 184
LVLP V+ RRV+Y++ EYTPLLDSSNM W +IA+DI++ YE +DGFV+LHGT
Sbjct: 104 MAPLVLPIVQGVDRRVIYQITEYTPLLDSSNMTMNDWARIASDIQQSYEFFDGFVVLHGT 163
Query: 185 DTLSYTASALSFMLENLGKPVIVTGSQISIFQIRSDGVHNFIGALILAGNYDIPEVTVYF 244
DTLSYTASALSFMLENLGK VI+TGSQI IF+ R+DG NF ALI+AGNY IPEV V+F
Sbjct: 164 DTLSYTASALSFMLENLGKTVIITGSQIPIFETRTDGKDNFTSALIIAGNYIIPEVCVFF 223
Query: 245 NHKLIRGNRTVKMSVKEFDAFDSPNFPNLAKVGLTIDVNMKSIFRSSTIKKFDVQSQLNL 304
HKL+RGNRTVK+S DAFDSPN P LA++G+ ++V+ + IFR +I++F V L+
Sbjct: 224 GHKLMRGNRTVKVSSNALDAFDSPNVPPLARIGIDVNVDYRLIFRPCSIERFRVHLNLDE 283
Query: 305 NVGILRIYPHISNHTVRSFMQSPMEGVILLTYGSGNFPSNRSDLIDELRLASDRNVIIVN 364
NVG+LRI+P IS+ T R+F+ P+ GV+L ++GSGN PSNR+DLIDELR A +R VII+N
Sbjct: 284 NVGLLRIFPSISHSTFRAFLAPPIRGVVLQSFGSGNIPSNRTDLIDELRAAGERGVIIIN 343
Query: 365 CSQCSRGGTSDTYEAGKILSGIGVINGYDMTPEAALTKLSYVLSKSELTLQQKKDIMMTN 424
C+QC G ++ Y+ GK+L +GVI G+DMTPEAAL+KL+YV+ K E +L+ KK +M N
Sbjct: 344 CTQCPNGTVAEIYDTGKVLCDVGVIPGFDMTPEAALSKLAYVIGKEEWSLEVKKQMMQAN 403
Query: 425 IRGELST-DAIHNNELDLAAAVAKTLHLSGRQELNKLKKILYPALFQSAVREGDIDKIKE 483
+RGEL++ A + DL AVA++LHLS QEL++L + L+PA+ +AV EGD KI
Sbjct: 404 LRGELTSLKAAKMEDYDLVDAVARSLHLSSPQELDQLGETLFPAMINAAVAEGDPKKINN 463
Query: 484 MQNYGADISMTDFDRRNILHTACSVGKLDIVKYCLENGVSVHIRDNYDISPLHEAVIADQ 543
++ YGAD+S T+ D+R LH AC +G ++IVKY L+NGVSVH+RD YD +PL EAV D
Sbjct: 464 LKAYGADLSGTNHDQRTALHLACQLGNVEIVKYLLQNGVSVHVRDRYDRTPLLEAVSTDS 523
Query: 544 HDIIRLLRHCGAHLTNEPMFLGDVLTNAAARGMIKRLQSYLLAGINLNQVDSIGLTPLHA 603
H+II+LL +CGAHLT +G+ L AAARG + RL+SY AG +L Q D G T LH
Sbjct: 524 HEIIQLLINCGAHLTGSSRAIGEQLCAAAARGSMVRLKSYQFAGADLAQPDPSGRTALHV 583
Query: 604 AVLNNNIESVRYLLSQHVDLTIENKNGQSAIEVANQMQLNDIIELLKS 651
A L+ E V+Y+L + ++ G +A++ A + IE LK+
Sbjct: 584 AALHGFPEVVQYVLPYFENPHEKDMLGLTALDYAERGGHAAAIEALKT 631
|
Source: Drosophila yakuba Species: Drosophila yakuba Genus: Drosophila Family: Drosophilidae Order: Diptera Class: Insecta Phylum: Arthropoda Superkingdom: Eukaryota |
| >gi|195163954|ref|XP_002022814.1| GL14545 [Drosophila persimilis] gi|194104837|gb|EDW26880.1| GL14545 [Drosophila persimilis] | Back alignment and taxonomy information |
|---|
| >gi|195046997|ref|XP_001992251.1| GH24648 [Drosophila grimshawi] gi|193893092|gb|EDV91958.1| GH24648 [Drosophila grimshawi] | Back alignment and taxonomy information |
|---|
| >gi|198469946|ref|XP_001355161.2| GA19585 [Drosophila pseudoobscura pseudoobscura] gi|198147110|gb|EAL32218.2| GA19585 [Drosophila pseudoobscura pseudoobscura] | Back alignment and taxonomy information |
|---|
| >gi|24639609|ref|NP_570088.1| CG6428 [Drosophila melanogaster] gi|7290456|gb|AAF45911.1| CG6428 [Drosophila melanogaster] gi|21430848|gb|AAM51102.1| SD20009p [Drosophila melanogaster] | Back alignment and taxonomy information |
|---|
| >gi|194767806|ref|XP_001966005.1| lyso [Drosophila ananassae] gi|190622890|gb|EDV38414.1| lyso [Drosophila ananassae] | Back alignment and taxonomy information |
|---|
| >gi|195340911|ref|XP_002037056.1| GM12708 [Drosophila sechellia] gi|194131172|gb|EDW53215.1| GM12708 [Drosophila sechellia] | Back alignment and taxonomy information |
|---|
| >gi|194887951|ref|XP_001976836.1| GG18566 [Drosophila erecta] gi|190648485|gb|EDV45763.1| GG18566 [Drosophila erecta] | Back alignment and taxonomy information |
|---|
| >gi|307178114|gb|EFN66941.1| L-asparaginase [Camponotus floridanus] | Back alignment and taxonomy information |
|---|
| >gi|195456970|ref|XP_002075368.1| GK15547 [Drosophila willistoni] gi|194171453|gb|EDW86354.1| GK15547 [Drosophila willistoni] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 659 | ||||||
| FB|FBgn0029689 | 631 | CG6428 [Drosophila melanogaste | 0.884 | 0.923 | 0.523 | 1e-155 | |
| FB|FBgn0037759 | 605 | CG8526 [Drosophila melanogaste | 0.878 | 0.957 | 0.469 | 1.7e-137 | |
| ZFIN|ZDB-GENE-070820-14 | 665 | aspg "asparaginase homolog (S. | 0.843 | 0.836 | 0.452 | 3.5e-130 | |
| UNIPROTKB|Q9U518 | 590 | Q9U518 "L-asparaginase" [Dirof | 0.872 | 0.974 | 0.470 | 1.1e-126 | |
| UNIPROTKB|F1NW85 | 570 | ASPG "Uncharacterized protein" | 0.822 | 0.950 | 0.444 | 1.7e-123 | |
| WB|WBGene00007756 | 715 | C27A7.5 [Caenorhabditis elegan | 0.869 | 0.801 | 0.445 | 6.7e-120 | |
| RGD|708388 | 564 | Aspg "asparaginase homolog (S. | 0.820 | 0.959 | 0.400 | 9.5e-105 | |
| UNIPROTKB|Q86U10 | 573 | ASPG "60 kDa lysophospholipase | 0.822 | 0.945 | 0.402 | 1.3e-102 | |
| MGI|MGI:2144822 | 564 | Aspg "asparaginase homolog (S. | 0.820 | 0.959 | 0.387 | 1.8e-101 | |
| UNIPROTKB|F1MGH2 | 572 | ASPG "Uncharacterized protein" | 0.819 | 0.944 | 0.400 | 4.9e-101 |
| FB|FBgn0029689 CG6428 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
Score = 1518 (539.4 bits), Expect = 1.0e-155, P = 1.0e-155
Identities = 308/588 (52%), Positives = 414/588 (70%)
Query: 69 SEDRLESKVLVLYTGGTIGMEDNEQGALAPSSKPLTDKIRENPLLYDRHYDVCK---TQD 125
++D E++V V+YTGGTIGM NE+ LAP L IR+ P ++D Y + + +
Sbjct: 44 AQDVKEARVKVIYTGGTIGMVRNERNVLAPIPNALVRSIRKYPNIHDEEYALRRFGASAS 103
Query: 126 GNVLVLPRVKDT-RRVLYKVVEYTPLLDSSNMCQVHWIKIANDIKEYYESYDGFVILHGT 184
LVLP V+ RRV+Y++ EYTPLLDSSNM W +IA+DI++ YE +DGFV+LHGT
Sbjct: 104 MAPLVLPIVQGVDRRVIYQISEYTPLLDSSNMTMNDWARIASDIQQSYEFFDGFVVLHGT 163
Query: 185 DTLSYTASALSFMLENLGKPVIVTGSQISIFQIRSDGVHNFIGALILAGNYDIPEVTVYF 244
DTLSYTASALSFMLENLGK VI+TGSQI IF+ R+DG NF ALI+AGNY IPEV ++F
Sbjct: 164 DTLSYTASALSFMLENLGKTVIITGSQIPIFETRTDGKDNFTSALIIAGNYIIPEVCIFF 223
Query: 245 NHKLIRGNRTVKMSVKEFDAFDSPNFPNLAKVGLTIDVNMKSIFRSSTIKKFDVQSQLNL 304
HKL+RGNRTVK+S DAFDSPN P LA++G+ ++V+ + IFR TI++F V L+
Sbjct: 224 GHKLMRGNRTVKVSSNALDAFDSPNVPPLARIGIDVNVDYRLIFRPCTIERFCVHLNLDE 283
Query: 305 NVGILRIYPHISNHTVRSFMQSPMEGVILLTYGSGNFPSNRSDLIDELRLASDRNVIIVN 364
NVG+LRI+P IS+ T R+F+ P+ GV+L ++GSGN PSNR DLIDELR A +R VII+N
Sbjct: 284 NVGLLRIFPSISHSTFRAFLAPPIRGVVLQSFGSGNIPSNRKDLIDELRAAGERGVIIIN 343
Query: 365 CSQCSRGGTSDTYEAGKILSGIGVINGYDMTPEAALTKLSYVLSKSELTLQQKKDIMMTN 424
C+QC G ++ Y+ GK+L +GVI G+DMTPEAAL KL+YV+ K E +L KK +M ++
Sbjct: 344 CTQCPNGTVAEIYDTGKVLCDVGVIPGFDMTPEAALAKLAYVIGKEEWSLDMKKQMMQSS 403
Query: 425 IRGEL-STDAIHNNELDLAAAVAKTLHLSGRQELNKLKKILYPALFQSAVREGDIDKIKE 483
+RGEL S A + DL AVA++LHLS QEL++L + L+PA+ +AV EGD KI
Sbjct: 404 LRGELTSLKAPKMEDYDLVDAVARSLHLSSPQELDQLGETLFPAMINAAVAEGDPKKINN 463
Query: 484 MQNYGADISMTDFDRRNILHTACSVGKLDIVKYCLENGVSVHIRDNYDISPLHEAVIADQ 543
++ YGAD+S T+ D+R LH AC +G ++IVKY L+NGVSVH+RD YD +PL EAV D
Sbjct: 464 LKAYGADLSGTNHDQRTALHLACQLGNVEIVKYLLQNGVSVHVRDRYDRTPLLEAVATDS 523
Query: 544 HDIIRLLRHCGAHLTNEPMFLGDVLTNAAARGMIKRLQSYLLAGINLNQVDSIGLTPLHA 603
H+II+LL +CGAHLT +G+ L AAARG + RL+SY AG +L Q D G T LH
Sbjct: 524 HEIIQLLINCGAHLTGSSRAVGEQLCAAAARGSMIRLKSYQYAGADLAQSDPSGRTALHV 583
Query: 604 AVLNNNIESVRYLLSQHVDLTIENKNGQSAIEVANQMQLNDIIELLKS 651
A L+ E V+Y+L + ++ G +A++ A + ++E+LKS
Sbjct: 584 AALHGFPEVVQYVLPYFENPNEKDMLGLTAMDYAERGGHAAVMEVLKS 631
|
|
| FB|FBgn0037759 CG8526 [Drosophila melanogaster (taxid:7227)] | Back alignment and assigned GO terms |
|---|
| ZFIN|ZDB-GENE-070820-14 aspg "asparaginase homolog (S. cerevisiae)" [Danio rerio (taxid:7955)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q9U518 Q9U518 "L-asparaginase" [Dirofilaria immitis (taxid:6287)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1NW85 ASPG "Uncharacterized protein" [Gallus gallus (taxid:9031)] | Back alignment and assigned GO terms |
|---|
| WB|WBGene00007756 C27A7.5 [Caenorhabditis elegans (taxid:6239)] | Back alignment and assigned GO terms |
|---|
| RGD|708388 Aspg "asparaginase homolog (S. cerevisiae)" [Rattus norvegicus (taxid:10116)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|Q86U10 ASPG "60 kDa lysophospholipase" [Homo sapiens (taxid:9606)] | Back alignment and assigned GO terms |
|---|
| MGI|MGI:2144822 Aspg "asparaginase homolog (S. cerevisiae)" [Mus musculus (taxid:10090)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|F1MGH2 ASPG "Uncharacterized protein" [Bos taurus (taxid:9913)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
Prediction of Functionally Associated Proteins
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 659 | |||
| PRK09461 | 335 | PRK09461, ansA, cytoplasmic asparaginase I; Provis | 1e-123 | |
| cd08963 | 316 | cd08963, L-asparaginase_I, Type I (cytosolic) bact | 1e-113 | |
| pfam00710 | 318 | pfam00710, Asparaginase, Asparaginase | 1e-112 | |
| smart00870 | 323 | smart00870, Asparaginase, Asparaginase, found in v | 1e-105 | |
| TIGR00519 | 336 | TIGR00519, asnASE_I, L-asparaginase, type I | 2e-83 | |
| COG0252 | 351 | COG0252, AnsB, L-asparaginase/archaeal Glu-tRNAGln | 8e-78 | |
| cd08962 | 402 | cd08962, GatD, GatD subunit of archaeal Glu-tRNA a | 9e-54 | |
| TIGR02153 | 404 | TIGR02153, gatD_arch, glutamyl-tRNA(Gln) amidotran | 1e-50 | |
| PRK04183 | 419 | PRK04183, PRK04183, glutamyl-tRNA(Gln) amidotransf | 2e-48 | |
| cd00411 | 320 | cd00411, L-asparaginase_like, Bacterial L-asparagi | 1e-42 | |
| cd08964 | 319 | cd08964, L-asparaginase_II, Type II (periplasmic) | 9e-32 | |
| cd00204 | 126 | cd00204, ANK, ankyrin repeats; ankyrin repeats med | 2e-24 | |
| cd00204 | 126 | cd00204, ANK, ankyrin repeats; ankyrin repeats med | 4e-22 | |
| PRK11096 | 347 | PRK11096, ansB, L-asparaginase II; Provisional | 2e-16 | |
| pfam12796 | 91 | pfam12796, Ank_2, Ankyrin repeats (3 copies) | 4e-16 | |
| TIGR00520 | 349 | TIGR00520, asnASE_II, L-asparaginase, type II | 3e-15 | |
| pfam12796 | 91 | pfam12796, Ank_2, Ankyrin repeats (3 copies) | 5e-15 | |
| PLN03192 | 823 | PLN03192, PLN03192, Voltage-dependent potassium ch | 6e-14 | |
| cd00204 | 126 | cd00204, ANK, ankyrin repeats; ankyrin repeats med | 5e-13 | |
| PHA02874 | 434 | PHA02874, PHA02874, ankyrin repeat protein; Provis | 2e-12 | |
| PHA03100 | 422 | PHA03100, PHA03100, ankyrin repeat protein; Provis | 1e-11 | |
| PHA02874 | 434 | PHA02874, PHA02874, ankyrin repeat protein; Provis | 3e-10 | |
| COG0666 | 235 | COG0666, Arp, FOG: Ankyrin repeat [General functio | 3e-10 | |
| PHA03095 | 471 | PHA03095, PHA03095, ankyrin-like protein; Provisio | 4e-10 | |
| PHA03100 | 422 | PHA03100, PHA03100, ankyrin repeat protein; Provis | 6e-09 | |
| pfam13637 | 54 | pfam13637, Ank_4, Ankyrin repeats (many copies) | 6e-09 | |
| cd00204 | 126 | cd00204, ANK, ankyrin repeats; ankyrin repeats med | 1e-08 | |
| pfam12796 | 91 | pfam12796, Ank_2, Ankyrin repeats (3 copies) | 1e-08 | |
| pfam13637 | 54 | pfam13637, Ank_4, Ankyrin repeats (many copies) | 3e-08 | |
| pfam12796 | 91 | pfam12796, Ank_2, Ankyrin repeats (3 copies) | 5e-08 | |
| pfam13857 | 56 | pfam13857, Ank_5, Ankyrin repeats (many copies) | 1e-07 | |
| PHA02874 | 434 | PHA02874, PHA02874, ankyrin repeat protein; Provis | 3e-07 | |
| PHA02876 | 682 | PHA02876, PHA02876, ankyrin repeat protein; Provis | 6e-07 | |
| PHA03095 | 471 | PHA03095, PHA03095, ankyrin-like protein; Provisio | 1e-06 | |
| PHA03100 | 422 | PHA03100, PHA03100, ankyrin repeat protein; Provis | 2e-06 | |
| PTZ00322 | 664 | PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct | 2e-06 | |
| PHA03095 | 471 | PHA03095, PHA03095, ankyrin-like protein; Provisio | 6e-06 | |
| PHA02875 | 413 | PHA02875, PHA02875, ankyrin repeat protein; Provis | 6e-06 | |
| PHA02875 | 413 | PHA02875, PHA02875, ankyrin repeat protein; Provis | 1e-05 | |
| pfam13857 | 56 | pfam13857, Ank_5, Ankyrin repeats (many copies) | 4e-05 | |
| PHA02878 | 477 | PHA02878, PHA02878, ankyrin repeat protein; Provis | 4e-05 | |
| PHA02798 | 489 | PHA02798, PHA02798, ankyrin-like protein; Provisio | 5e-05 | |
| pfam00023 | 33 | pfam00023, Ank, Ankyrin repeat | 5e-05 | |
| PHA02878 | 477 | PHA02878, PHA02878, ankyrin repeat protein; Provis | 6e-05 | |
| PTZ00322 | 664 | PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fruct | 1e-04 | |
| pfam00023 | 33 | pfam00023, Ank, Ankyrin repeat | 3e-04 | |
| COG0666 | 235 | COG0666, Arp, FOG: Ankyrin repeat [General functio | 4e-04 | |
| COG0666 | 235 | COG0666, Arp, FOG: Ankyrin repeat [General functio | 0.002 | |
| PHA02876 | 682 | PHA02876, PHA02876, ankyrin repeat protein; Provis | 0.002 | |
| PHA03100 | 422 | PHA03100, PHA03100, ankyrin repeat protein; Provis | 0.003 | |
| pfam13637 | 54 | pfam13637, Ank_4, Ankyrin repeats (many copies) | 0.003 | |
| PHA02875 | 413 | PHA02875, PHA02875, ankyrin repeat protein; Provis | 0.003 | |
| pfam13606 | 30 | pfam13606, Ank_3, Ankyrin repeat | 0.003 | |
| TIGR00870 | 743 | TIGR00870, trp, transient-receptor-potential calci | 0.003 |
| >gnl|CDD|181876 PRK09461, ansA, cytoplasmic asparaginase I; Provisional | Back alignment and domain information |
|---|
Score = 368 bits (946), Expect = e-123
Identities = 162/353 (45%), Positives = 216/353 (61%), Gaps = 26/353 (7%)
Query: 79 VLYTGGTIGMEDNEQGALAPSSKPLTDKIRENPLLYDRHYDVCKTQDGNVLVLPRVKDTR 138
V YTGGTIGM+ ++QG P S L ++ P + P + D
Sbjct: 8 VAYTGGTIGMQRSDQG-YIPVSGHLQRQLALMPEFHR----------------PEMPD-- 48
Query: 139 RVLYKVVEYTPLLDSSNMCQVHWIKIANDIKEYYESYDGFVILHGTDTLSYTASALSFML 198
+ + EYTPL+DSS+M W IA+DIK Y+ YDGFVILHGTDT++YTASALSFML
Sbjct: 49 ---FTIHEYTPLIDSSDMTPEDWQHIADDIKANYDDYDGFVILHGTDTMAYTASALSFML 105
Query: 199 ENLGKPVIVTGSQISIFQIRSDGVHNFIGALILAGNYDIPEVTVYFNHKLIRGNRTVKMS 258
ENLGKPVIVTGSQI + ++RSDG N + AL +A NY I EVT++FN+KL RGNRT K
Sbjct: 106 ENLGKPVIVTGSQIPLAELRSDGQTNLLNALYVAANYPINEVTLFFNNKLFRGNRTTKAH 165
Query: 259 VKEFDAFDSPNFPNLAKVGLTIDVNMKSIFRSSTIKKFDVQSQLNLNVGILRIYPHISNH 318
FDAF SPN P L + G+ I + V +G++ IYP IS
Sbjct: 166 ADGFDAFASPNLPPLLEAGIHIRRLNTPPAPHGE-GELIVHPITPQPIGVVTIYPGISAE 224
Query: 319 TVRSFMQSPMEGVILLTYGSGNFPSNRSDLIDELRLASDRNVIIVNCSQCSRGGTS-DTY 377
VR+F++ P++ +IL +YG GN P N L+ EL+ AS+R +++VN +QC G + Y
Sbjct: 225 VVRNFLRQPVKALILRSYGVGNAPQN-PALLQELKEASERGIVVVNLTQCMSGKVNMGGY 283
Query: 378 EAGKILSGIGVINGYDMTPEAALTKLSYVLSKSELTLQQKKDIMMTNIRGELS 430
G L+ GVI+G DMT EAALTKL Y+LS+ EL+ ++ + M N+RGEL+
Sbjct: 284 ATGNALAHAGVISGADMTVEAALTKLHYLLSQ-ELSTEEIRQAMQQNLRGELT 335
|
Length = 335 |
| >gnl|CDD|199207 cd08963, L-asparaginase_I, Type I (cytosolic) bacterial L-asparaginase | Back alignment and domain information |
|---|
| >gnl|CDD|216074 pfam00710, Asparaginase, Asparaginase | Back alignment and domain information |
|---|
| >gnl|CDD|214873 smart00870, Asparaginase, Asparaginase, found in various plant, animal and bacterial cells | Back alignment and domain information |
|---|
| >gnl|CDD|129610 TIGR00519, asnASE_I, L-asparaginase, type I | Back alignment and domain information |
|---|
| >gnl|CDD|223330 COG0252, AnsB, L-asparaginase/archaeal Glu-tRNAGln amidotransferase subunit D [Amino acid transport and metabolism / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >gnl|CDD|199206 cd08962, GatD, GatD subunit of archaeal Glu-tRNA amidotransferase | Back alignment and domain information |
|---|
| >gnl|CDD|233752 TIGR02153, gatD_arch, glutamyl-tRNA(Gln) amidotransferase, subunit D | Back alignment and domain information |
|---|
| >gnl|CDD|235245 PRK04183, PRK04183, glutamyl-tRNA(Gln) amidotransferase subunit D; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|199205 cd00411, L-asparaginase_like, Bacterial L-asparaginases and related enzymes | Back alignment and domain information |
|---|
| >gnl|CDD|199208 cd08964, L-asparaginase_II, Type II (periplasmic) bacterial L-asparaginase | Back alignment and domain information |
|---|
| >gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >gnl|CDD|182958 PRK11096, ansB, L-asparaginase II; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) | Back alignment and domain information |
|---|
| >gnl|CDD|129611 TIGR00520, asnASE_II, L-asparaginase, type II | Back alignment and domain information |
|---|
| >gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) | Back alignment and domain information |
|---|
| >gnl|CDD|215625 PLN03192, PLN03192, Voltage-dependent potassium channel; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) | Back alignment and domain information |
|---|
| >gnl|CDD|238125 cd00204, ANK, ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) | Back alignment and domain information |
|---|
| >gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) | Back alignment and domain information |
|---|
| >gnl|CDD|205076 pfam12796, Ank_2, Ankyrin repeats (3 copies) | Back alignment and domain information |
|---|
| >gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) | Back alignment and domain information |
|---|
| >gnl|CDD|165205 PHA02874, PHA02874, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222980 PHA03095, PHA03095, ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|206028 pfam13857, Ank_5, Ankyrin repeats (many copies) | Back alignment and domain information |
|---|
| >gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222931 PHA02798, PHA02798, ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat | Back alignment and domain information |
|---|
| >gnl|CDD|222939 PHA02878, PHA02878, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|140343 PTZ00322, PTZ00322, 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|200936 pfam00023, Ank, Ankyrin repeat | Back alignment and domain information |
|---|
| >gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|223738 COG0666, Arp, FOG: Ankyrin repeat [General function prediction only] | Back alignment and domain information |
|---|
| >gnl|CDD|165207 PHA02876, PHA02876, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222984 PHA03100, PHA03100, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|222277 pfam13637, Ank_4, Ankyrin repeats (many copies) | Back alignment and domain information |
|---|
| >gnl|CDD|165206 PHA02875, PHA02875, ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|205784 pfam13606, Ank_3, Ankyrin repeat | Back alignment and domain information |
|---|
| >gnl|CDD|233161 TIGR00870, trp, transient-receptor-potential calcium channel protein | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 659 | |||
| PRK09461 | 335 | ansA cytoplasmic asparaginase I; Provisional | 100.0 | |
| TIGR00519 | 336 | asnASE_I L-asparaginases, type I. Two related fami | 100.0 | |
| TIGR02153 | 404 | gatD_arch glutamyl-tRNA(Gln) amidotransferase, sub | 100.0 | |
| PRK04183 | 419 | glutamyl-tRNA(Gln) amidotransferase subunit D; Val | 100.0 | |
| cd00411 | 323 | Asparaginase Asparaginase (amidohydrolase): Aspara | 100.0 | |
| smart00870 | 323 | Asparaginase Asparaginase, which is found in vario | 100.0 | |
| TIGR00520 | 349 | asnASE_II L-asparaginases, type II. Two related fa | 100.0 | |
| COG0252 | 351 | AnsB L-asparaginase/archaeal Glu-tRNAGln amidotran | 100.0 | |
| PRK11096 | 347 | ansB L-asparaginase II; Provisional | 100.0 | |
| PF00710 | 313 | Asparaginase: Asparaginase; InterPro: IPR006034 As | 100.0 | |
| KOG0503|consensus | 368 | 100.0 | ||
| KOG4412|consensus | 226 | 100.0 | ||
| PHA02791 | 284 | ankyrin-like protein; Provisional | 100.0 | |
| KOG4412|consensus | 226 | 100.0 | ||
| PHA02875 | 413 | ankyrin repeat protein; Provisional | 99.97 | |
| PHA03100 | 480 | ankyrin repeat protein; Provisional | 99.97 | |
| PHA02791 | 284 | ankyrin-like protein; Provisional | 99.97 | |
| PHA02874 | 434 | ankyrin repeat protein; Provisional | 99.97 | |
| PHA02875 | 413 | ankyrin repeat protein; Provisional | 99.97 | |
| PHA02878 | 477 | ankyrin repeat protein; Provisional | 99.97 | |
| PHA03100 | 480 | ankyrin repeat protein; Provisional | 99.97 | |
| PHA02946 | 446 | ankyin-like protein; Provisional | 99.97 | |
| PHA02716 | 764 | CPXV016; CPX019; EVM010; Provisional | 99.97 | |
| PHA03095 | 471 | ankyrin-like protein; Provisional | 99.96 | |
| PHA02874 | 434 | ankyrin repeat protein; Provisional | 99.96 | |
| PHA02798 | 489 | ankyrin-like protein; Provisional | 99.96 | |
| KOG0509|consensus | 600 | 99.96 | ||
| PHA02946 | 446 | ankyin-like protein; Provisional | 99.96 | |
| PHA02989 | 494 | ankyrin repeat protein; Provisional | 99.96 | |
| PHA03095 | 471 | ankyrin-like protein; Provisional | 99.96 | |
| KOG0509|consensus | 600 | 99.96 | ||
| PHA02878 | 477 | ankyrin repeat protein; Provisional | 99.96 | |
| PHA02716 | 764 | CPXV016; CPX019; EVM010; Provisional | 99.96 | |
| PHA02859 | 209 | ankyrin repeat protein; Provisional | 99.96 | |
| PHA02989 | 494 | ankyrin repeat protein; Provisional | 99.95 | |
| PHA02876 | 682 | ankyrin repeat protein; Provisional | 99.95 | |
| KOG0508|consensus | 615 | 99.95 | ||
| PHA02795 | 437 | ankyrin-like protein; Provisional | 99.95 | |
| PHA02876 | 682 | ankyrin repeat protein; Provisional | 99.95 | |
| PHA02798 | 489 | ankyrin-like protein; Provisional | 99.95 | |
| KOG0510|consensus | 929 | 99.94 | ||
| PHA02917 | 661 | ankyrin-like protein; Provisional | 99.94 | |
| KOG0510|consensus | 929 | 99.94 | ||
| PHA02859 | 209 | ankyrin repeat protein; Provisional | 99.92 | |
| PLN03192 | 823 | Voltage-dependent potassium channel; Provisional | 99.92 | |
| PHA02730 | 672 | ankyrin-like protein; Provisional | 99.92 | |
| KOG0508|consensus | 615 | 99.92 | ||
| PHA02730 | 672 | ankyrin-like protein; Provisional | 99.92 | |
| PHA02795 | 437 | ankyrin-like protein; Provisional | 99.92 | |
| PHA02917 | 661 | ankyrin-like protein; Provisional | 99.92 | |
| KOG4177|consensus | 1143 | 99.91 | ||
| PHA02792 | 631 | ankyrin-like protein; Provisional | 99.9 | |
| KOG0502|consensus | 296 | 99.9 | ||
| PLN03192 | 823 | Voltage-dependent potassium channel; Provisional | 99.9 | |
| KOG4177|consensus | 1143 | 99.9 | ||
| PHA02792 | 631 | ankyrin-like protein; Provisional | 99.88 | |
| KOG0514|consensus | 452 | 99.88 | ||
| PHA02743 | 166 | Viral ankyrin protein; Provisional | 99.87 | |
| KOG0502|consensus | 296 | 99.86 | ||
| TIGR00870 | 743 | trp transient-receptor-potential calcium channel p | 99.86 | |
| KOG0505|consensus | 527 | 99.85 | ||
| KOG0507|consensus | 854 | 99.85 | ||
| KOG0514|consensus | 452 | 99.84 | ||
| PHA02743 | 166 | Viral ankyrin protein; Provisional | 99.84 | |
| TIGR00870 | 743 | trp transient-receptor-potential calcium channel p | 99.84 | |
| PHA02884 | 300 | ankyrin repeat protein; Provisional | 99.83 | |
| PHA02884 | 300 | ankyrin repeat protein; Provisional | 99.83 | |
| PHA02741 | 169 | hypothetical protein; Provisional | 99.83 | |
| PHA02741 | 169 | hypothetical protein; Provisional | 99.82 | |
| KOG0507|consensus | 854 | 99.81 | ||
| PHA02736 | 154 | Viral ankyrin protein; Provisional | 99.81 | |
| KOG0505|consensus | 527 | 99.81 | ||
| PHA02736 | 154 | Viral ankyrin protein; Provisional | 99.8 | |
| KOG0512|consensus | 228 | 99.77 | ||
| KOG0512|consensus | 228 | 99.75 | ||
| KOG0195|consensus | 448 | 99.72 | ||
| KOG3676|consensus | 782 | 99.71 | ||
| KOG4369|consensus | 2131 | 99.69 | ||
| PF12796 | 89 | Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 | 99.69 | |
| KOG0195|consensus | 448 | 99.69 | ||
| cd00204 | 126 | ANK ankyrin repeats; ankyrin repeats mediate prote | 99.67 | |
| KOG4369|consensus | 2131 | 99.67 | ||
| cd00204 | 126 | ANK ankyrin repeats; ankyrin repeats mediate prote | 99.66 | |
| PF12796 | 89 | Ank_2: Ankyrin repeats (3 copies); InterPro: IPR02 | 99.66 | |
| KOG3676|consensus | 782 | 99.6 | ||
| COG0666 | 235 | Arp FOG: Ankyrin repeat [General function predicti | 99.53 | |
| COG0666 | 235 | Arp FOG: Ankyrin repeat [General function predicti | 99.5 | |
| KOG4214|consensus | 117 | 99.5 | ||
| KOG4214|consensus | 117 | 99.42 | ||
| PTZ00322 | 664 | 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas | 99.36 | |
| PTZ00322 | 664 | 6-phosphofructo-2-kinase/fructose-2,6-biphosphatas | 99.33 | |
| KOG0515|consensus | 752 | 99.3 | ||
| PF13857 | 56 | Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A | 99.29 | |
| KOG0515|consensus | 752 | 99.28 | ||
| PF13857 | 56 | Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A | 99.28 | |
| PF13637 | 54 | Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A | 99.27 | |
| KOG1710|consensus | 396 | 99.26 | ||
| KOG1710|consensus | 396 | 99.25 | ||
| PF13637 | 54 | Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A | 99.23 | |
| KOG0506|consensus | 622 | 98.7 | ||
| KOG0506|consensus | 622 | 98.69 | ||
| KOG0783|consensus | 1267 | 98.58 | ||
| KOG0818|consensus | 669 | 98.57 | ||
| KOG0818|consensus | 669 | 98.53 | ||
| KOG0783|consensus | 1267 | 98.52 | ||
| KOG0782|consensus | 1004 | 98.52 | ||
| PF13606 | 30 | Ank_3: Ankyrin repeat | 98.48 | |
| KOG0782|consensus | 1004 | 98.46 | ||
| KOG0705|consensus | 749 | 98.43 | ||
| PF13606 | 30 | Ank_3: Ankyrin repeat | 98.43 | |
| PF00023 | 33 | Ank: Ankyrin repeat Hereditary spherocytosis; Inte | 98.41 | |
| KOG0705|consensus | 749 | 98.38 | ||
| PF00023 | 33 | Ank: Ankyrin repeat Hereditary spherocytosis; Inte | 98.38 | |
| KOG0522|consensus | 560 | 98.21 | ||
| KOG0522|consensus | 560 | 98.16 | ||
| KOG3609|consensus | 822 | 98.12 | ||
| KOG0521|consensus | 785 | 98.1 | ||
| KOG0511|consensus | 516 | 98.0 | ||
| KOG2384|consensus | 223 | 97.98 | ||
| KOG0511|consensus | 516 | 97.9 | ||
| KOG3609|consensus | 822 | 97.88 | ||
| KOG2384|consensus | 223 | 97.82 | ||
| KOG0520|consensus | 975 | 97.81 | ||
| KOG0521|consensus | 785 | 97.76 | ||
| KOG0520|consensus | 975 | 97.68 | ||
| KOG2505|consensus | 591 | 96.29 | ||
| smart00248 | 30 | ANK ankyrin repeats. Ankyrin repeats are about 33 | 96.06 | |
| KOG2505|consensus | 591 | 96.01 | ||
| smart00248 | 30 | ANK ankyrin repeats. Ankyrin repeats are about 33 | 95.92 | |
| PF03158 | 192 | DUF249: Multigene family 530 protein; InterPro: IP | 95.91 | |
| PF03158 | 192 | DUF249: Multigene family 530 protein; InterPro: IP | 95.0 | |
| PF06128 | 284 | Shigella_OspC: Shigella flexneri OspC protein; Int | 94.55 | |
| PF06128 | 284 | Shigella_OspC: Shigella flexneri OspC protein; Int | 89.8 | |
| PF11929 | 76 | DUF3447: Domain of unknown function (DUF3447); Int | 83.47 | |
| PF11929 | 76 | DUF3447: Domain of unknown function (DUF3447); Int | 80.51 |
| >PRK09461 ansA cytoplasmic asparaginase I; Provisional | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.1e-76 Score=622.57 Aligned_cols=332 Identities=47% Similarity=0.766 Sum_probs=291.7
Q ss_pred CCeEEEEecCCccccccCCCCccccCCCchhhHHhhCCCCcccccccccccCCcccccccccccceeEEEEEEecCCCCC
Q psy9757 74 ESKVLVLYTGGTIGMEDNEQGALAPSSKPLTDKIRENPLLYDRHYDVCKTQDGNVLVLPRVKDTRRVLYKVVEYTPLLDS 153 (659)
Q Consensus 74 ~~~i~ii~TGGTI~~~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~dS 153 (659)
+|||+||+|||||||+.++ +++.|....+++++..+|.+.+.. ...+++.++.+++||
T Consensus 3 ~~~i~vl~TGGTIa~~~~~-~g~~~~~~~~~~~l~~~p~l~~~~---------------------~~~~~~~~~~~~idS 60 (335)
T PRK09461 3 KKSIYVAYTGGTIGMQRSD-QGYIPVSGHLQRQLALMPEFHRPE---------------------MPDFTIHEYTPLIDS 60 (335)
T ss_pred CCEEEEEeCCccccCCcCC-CCccCCCccHHHHHHhCccccccC---------------------cccEEEEEccCCCCc
Confidence 5899999999999998655 456775555688888877654210 123566788877999
Q ss_pred CCCCHHHHHHHHHHHHHHhcCcCeEEEEcCcccHHHHHHHHHHHHhcCCCcEEEeccCCCCCCCCChHHHHHHHHHHHHc
Q psy9757 154 SNMCQVHWIKIANDIKEYYESYDGFVILHGTDTLSYTASALSFMLENLGKPVIVTGSQISIFQIRSDGVHNFIGALILAG 233 (659)
Q Consensus 154 ~~~~~~~~~~l~~~i~~~~~~~~g~vv~hGTdt~~~ta~~l~~~~~~~~~pvv~tga~~p~~~~~~Dg~~Nl~~a~~~a~ 233 (659)
++|||+||.+|++.|++.+++||||||||||||||||||||+|++.+++|||||||||||++++++||+.||.+|+++|+
T Consensus 61 s~mt~~~w~~la~~I~~~~~~~dG~VVtHGTDTmeeTA~~L~~~l~~~~kPVVlTGAmrP~~~~~sDg~~NL~~Av~~A~ 140 (335)
T PRK09461 61 SDMTPEDWQHIADDIKANYDDYDGFVILHGTDTMAYTASALSFMLENLGKPVIVTGSQIPLAELRSDGQTNLLNALYVAA 140 (335)
T ss_pred ccCCHHHHHHHHHHHHHHhccCCeEEEeeccchHHHHHHHHHHHHhCCCCCEEEeCCCCCCCCCCchHHHHHHHHHHHHc
Confidence 99999999999999999888899999999999999999999999988899999999999999999999999999999999
Q ss_pred CCCCCeEEEEeCCeeeecCceEeccCCCCCCCCCCCCcccEEEeeeeEEecccccccCCCCCccccCCCCCcEEEEEeCC
Q psy9757 234 NYDIPEVTVYFNHKLIRGNRTVKMSVKEFDAFDSPNFPNLAKVGLTIDVNMKSIFRSSTIKKFDVQSQLNLNVGILRIYP 313 (659)
Q Consensus 234 ~~~~~gv~v~~~~~i~~~~~~~k~~~~~~~aF~sp~~~~lg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~V~il~~~p 313 (659)
++..+||+|||||+||+|++++|+|+.++|||.|||+||||+++..+.+.+... ++.+...|.+.....++|+++++||
T Consensus 141 ~~~~~GV~V~f~~~i~~a~~v~K~~t~~~daF~s~~~g~lg~~~~~~~~~~~~~-~~~~~~~~~~~~~~~~~V~ii~~~p 219 (335)
T PRK09461 141 NYPINEVTLFFNNKLFRGNRTTKAHADGFDAFASPNLPPLLEAGIHIRRLNTPP-APHGEGELIVHPITPQPIGVVTIYP 219 (335)
T ss_pred CCCCCeEEEEECCEeeccCceEEcCCCCCccccCCCCCcceEccceEEEecccc-CCCCCCceeecCCCCCcEEEEEecC
Confidence 877789999999999999999999999999999999999998865444433322 2223345555444457899999999
Q ss_pred CCCHHHHHHhHhCCCcEEEEEecCCCCCCCCchHHHHHHHHHHhCCCeEEEeccCCCCCcC-CchhhhhhhhcccccccC
Q psy9757 314 HISNHTVRSFMQSPMEGVILLTYGSGNFPSNRSDLIDELRLASDRNVIIVNCSQCSRGGTS-DTYEAGKILSGIGVINGY 392 (659)
Q Consensus 314 g~~~~~l~~~~~~~~~giVl~~~G~G~~p~~~~~~~~~l~~a~~~gi~vV~~sq~~~G~v~-~~y~~g~~L~~~G~i~~~ 392 (659)
|+++++|+++++.|++||||++||+||+|. .+++.++|+++.++|+|||++|||.+|.|. ..|+++..|.+.|+++++
T Consensus 220 G~~~~~l~~~~~~~~~GiVl~~~G~Gn~p~-~~~~~~~l~~~~~~Gi~VV~~Sr~~~G~v~~~~Y~~g~~l~~~G~i~~g 298 (335)
T PRK09461 220 GISAEVVRNFLRQPVKALILRSYGVGNAPQ-NPALLQELKEASERGIVVVNLTQCMSGKVNMGGYATGNALAHAGVISGA 298 (335)
T ss_pred CCCHHHHHHHHhCCCCEEEEccCCCCCCCC-CHHHHHHHHHHHHCCCEEEEeCCCCCCcCCccchhhhHHHHhCCEEECC
Confidence 999999999999999999999999999995 458999999999999999999999999998 799999999999999999
Q ss_pred CCCHHHHHHHHHHhhhcccchhhhhhhhhhccccCCCc
Q psy9757 393 DMTPEAALTKLSYVLSKSELTLQQKKDIMMTNIRGELS 430 (659)
Q Consensus 393 dmt~e~a~~kL~~~l~k~~~~~~~vk~l~~~~l~gelt 430 (659)
||++++|++||+++|+++ .+.++++++|.+++++|++
T Consensus 299 ~lt~ekAr~kL~~~L~~~-~~~~~i~~~f~~~~~ge~~ 335 (335)
T PRK09461 299 DMTVEAALTKLHYLLSQE-LSTEEIRQAMQQNLRGELT 335 (335)
T ss_pred CCCHHHHHHHHHHHHhCC-CCHHHHHHHHhhccCCCCC
Confidence 999999999999999984 7999999999999999864
|
|
| >TIGR00519 asnASE_I L-asparaginases, type I | Back alignment and domain information |
|---|
| >TIGR02153 gatD_arch glutamyl-tRNA(Gln) amidotransferase, subunit D | Back alignment and domain information |
|---|
| >PRK04183 glutamyl-tRNA(Gln) amidotransferase subunit D; Validated | Back alignment and domain information |
|---|
| >cd00411 Asparaginase Asparaginase (amidohydrolase): Asparaginases are tetrameric enzymes that catalyze the hydrolysis of asparagine to aspartic acid and ammonia | Back alignment and domain information |
|---|
| >smart00870 Asparaginase Asparaginase, which is found in various plant, animal and bacterial cells, catalyses the deamination of asparagine to yield aspartic acid and an ammonium ion, resulting in a depletion of free circulatory asparagine in plasma PUBMED:3026924 | Back alignment and domain information |
|---|
| >TIGR00520 asnASE_II L-asparaginases, type II | Back alignment and domain information |
|---|
| >COG0252 AnsB L-asparaginase/archaeal Glu-tRNAGln amidotransferase subunit D [Amino acid transport and metabolism / Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >PRK11096 ansB L-asparaginase II; Provisional | Back alignment and domain information |
|---|
| >PF00710 Asparaginase: Asparaginase; InterPro: IPR006034 Asparaginase, which is found in various plant, animal and bacterial cells, catalyses the deamination of asparagine to yield aspartic acid and an ammonium ion, resulting in a depletion of free circulatory asparagine in plasma [] | Back alignment and domain information |
|---|
| >KOG0503|consensus | Back alignment and domain information |
|---|
| >KOG4412|consensus | Back alignment and domain information |
|---|
| >PHA02791 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG4412|consensus | Back alignment and domain information |
|---|
| >PHA02875 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA03100 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02791 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02874 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02875 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02878 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA03100 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02946 ankyin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02716 CPXV016; CPX019; EVM010; Provisional | Back alignment and domain information |
|---|
| >PHA03095 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02874 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02798 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0509|consensus | Back alignment and domain information |
|---|
| >PHA02946 ankyin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02989 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA03095 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0509|consensus | Back alignment and domain information |
|---|
| >PHA02878 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02716 CPXV016; CPX019; EVM010; Provisional | Back alignment and domain information |
|---|
| >PHA02859 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02989 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02876 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >KOG0508|consensus | Back alignment and domain information |
|---|
| >PHA02795 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02876 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02798 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0510|consensus | Back alignment and domain information |
|---|
| >PHA02917 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0510|consensus | Back alignment and domain information |
|---|
| >PHA02859 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PLN03192 Voltage-dependent potassium channel; Provisional | Back alignment and domain information |
|---|
| >PHA02730 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0508|consensus | Back alignment and domain information |
|---|
| >PHA02730 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02795 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >PHA02917 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG4177|consensus | Back alignment and domain information |
|---|
| >PHA02792 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0502|consensus | Back alignment and domain information |
|---|
| >PLN03192 Voltage-dependent potassium channel; Provisional | Back alignment and domain information |
|---|
| >KOG4177|consensus | Back alignment and domain information |
|---|
| >PHA02792 ankyrin-like protein; Provisional | Back alignment and domain information |
|---|
| >KOG0514|consensus | Back alignment and domain information |
|---|
| >PHA02743 Viral ankyrin protein; Provisional | Back alignment and domain information |
|---|
| >KOG0502|consensus | Back alignment and domain information |
|---|
| >TIGR00870 trp transient-receptor-potential calcium channel protein | Back alignment and domain information |
|---|
| >KOG0505|consensus | Back alignment and domain information |
|---|
| >KOG0507|consensus | Back alignment and domain information |
|---|
| >KOG0514|consensus | Back alignment and domain information |
|---|
| >PHA02743 Viral ankyrin protein; Provisional | Back alignment and domain information |
|---|
| >TIGR00870 trp transient-receptor-potential calcium channel protein | Back alignment and domain information |
|---|
| >PHA02884 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02884 ankyrin repeat protein; Provisional | Back alignment and domain information |
|---|
| >PHA02741 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >PHA02741 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG0507|consensus | Back alignment and domain information |
|---|
| >PHA02736 Viral ankyrin protein; Provisional | Back alignment and domain information |
|---|
| >KOG0505|consensus | Back alignment and domain information |
|---|
| >PHA02736 Viral ankyrin protein; Provisional | Back alignment and domain information |
|---|
| >KOG0512|consensus | Back alignment and domain information |
|---|
| >KOG0512|consensus | Back alignment and domain information |
|---|
| >KOG0195|consensus | Back alignment and domain information |
|---|
| >KOG3676|consensus | Back alignment and domain information |
|---|
| >KOG4369|consensus | Back alignment and domain information |
|---|
| >PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain | Back alignment and domain information |
|---|
| >KOG0195|consensus | Back alignment and domain information |
|---|
| >cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >KOG4369|consensus | Back alignment and domain information |
|---|
| >cd00204 ANK ankyrin repeats; ankyrin repeats mediate protein-protein interactions in very diverse families of proteins | Back alignment and domain information |
|---|
| >PF12796 Ank_2: Ankyrin repeats (3 copies); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain | Back alignment and domain information |
|---|
| >KOG3676|consensus | Back alignment and domain information |
|---|
| >COG0666 Arp FOG: Ankyrin repeat [General function prediction only] | Back alignment and domain information |
|---|
| >COG0666 Arp FOG: Ankyrin repeat [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4214|consensus | Back alignment and domain information |
|---|
| >KOG4214|consensus | Back alignment and domain information |
|---|
| >PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional | Back alignment and domain information |
|---|
| >PTZ00322 6-phosphofructo-2-kinase/fructose-2,6-biphosphatase; Provisional | Back alignment and domain information |
|---|
| >KOG0515|consensus | Back alignment and domain information |
|---|
| >PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A | Back alignment and domain information |
|---|
| >KOG0515|consensus | Back alignment and domain information |
|---|
| >PF13857 Ank_5: Ankyrin repeats (many copies); PDB: 1SW6_A 3EHR_B 3EHQ_A | Back alignment and domain information |
|---|
| >PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A | Back alignment and domain information |
|---|
| >KOG1710|consensus | Back alignment and domain information |
|---|
| >KOG1710|consensus | Back alignment and domain information |
|---|
| >PF13637 Ank_4: Ankyrin repeats (many copies); PDB: 3B95_A 3B7B_A 3F6Q_A 2KBX_A 3IXE_A 2DWZ_C 2DVW_A 3AJI_A 1S70_B 2HE0_A | Back alignment and domain information |
|---|
| >KOG0506|consensus | Back alignment and domain information |
|---|
| >KOG0506|consensus | Back alignment and domain information |
|---|
| >KOG0783|consensus | Back alignment and domain information |
|---|
| >KOG0818|consensus | Back alignment and domain information |
|---|
| >KOG0818|consensus | Back alignment and domain information |
|---|
| >KOG0783|consensus | Back alignment and domain information |
|---|
| >KOG0782|consensus | Back alignment and domain information |
|---|
| >PF13606 Ank_3: Ankyrin repeat | Back alignment and domain information |
|---|
| >KOG0782|consensus | Back alignment and domain information |
|---|
| >KOG0705|consensus | Back alignment and domain information |
|---|
| >PF13606 Ank_3: Ankyrin repeat | Back alignment and domain information |
|---|
| >PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature | Back alignment and domain information |
|---|
| >KOG0705|consensus | Back alignment and domain information |
|---|
| >PF00023 Ank: Ankyrin repeat Hereditary spherocytosis; InterPro: IPR002110 The ankyrin repeat is one of the most common protein-protein interaction motifs in nature | Back alignment and domain information |
|---|
| >KOG0522|consensus | Back alignment and domain information |
|---|
| >KOG0522|consensus | Back alignment and domain information |
|---|
| >KOG3609|consensus | Back alignment and domain information |
|---|
| >KOG0521|consensus | Back alignment and domain information |
|---|
| >KOG0511|consensus | Back alignment and domain information |
|---|
| >KOG2384|consensus | Back alignment and domain information |
|---|
| >KOG0511|consensus | Back alignment and domain information |
|---|
| >KOG3609|consensus | Back alignment and domain information |
|---|
| >KOG2384|consensus | Back alignment and domain information |
|---|
| >KOG0520|consensus | Back alignment and domain information |
|---|
| >KOG0521|consensus | Back alignment and domain information |
|---|
| >KOG0520|consensus | Back alignment and domain information |
|---|
| >KOG2505|consensus | Back alignment and domain information |
|---|
| >smart00248 ANK ankyrin repeats | Back alignment and domain information |
|---|
| >KOG2505|consensus | Back alignment and domain information |
|---|
| >smart00248 ANK ankyrin repeats | Back alignment and domain information |
|---|
| >PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses | Back alignment and domain information |
|---|
| >PF03158 DUF249: Multigene family 530 protein; InterPro: IPR004858 This entry represents multigene family 530 proteins from African swine fever virus (ASFV) viruses | Back alignment and domain information |
|---|
| >PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC | Back alignment and domain information |
|---|
| >PF06128 Shigella_OspC: Shigella flexneri OspC protein; InterPro: IPR010366 This family consists of the Shigella flexneri specific protein OspC | Back alignment and domain information |
|---|
| >PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain | Back alignment and domain information |
|---|
| >PF11929 DUF3447: Domain of unknown function (DUF3447); InterPro: IPR020683 This entry represents the ankyrin repeat-containing domain | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 659 | ||||
| 2him_A | 358 | Crystal Structure And Allosteric Regulation Of The | 2e-77 | ||
| 2p2d_A | 358 | Crystal Structure And Allosteric Regulation Of The | 2e-77 | ||
| 3ntx_A | 341 | Crystal Structure Of L-Asparaginase I From Yersinia | 2e-70 | ||
| 2ocd_A | 337 | Crystal Structure Of L-Asparaginase I From Vibrio C | 3e-69 | ||
| 1wnf_A | 328 | Crystal Structure Of Ph0066 From Pyrococcus Horikos | 2e-33 | ||
| 1wls_A | 328 | Crystal Structure Of L-Asparaginase I Homologue Pro | 1e-30 | ||
| 1zq1_A | 438 | Structure Of Gatde Trna-Dependent Amidotransferase | 7e-29 | ||
| 2d6f_A | 435 | Crystal Structure Of Glu-Trna(Gln) Amidotransferase | 3e-27 | ||
| 3nxk_A | 334 | Crystal Structure Of Probable Cytoplasmic L-Asparag | 8e-17 | ||
| 2dvw_A | 231 | Structure Of The Oncoprotein Gankyrin In Complex Wi | 5e-14 | ||
| 3aji_A | 231 | Structure Of Gankyrin-S6atpase Photo-Cross-Linked S | 8e-14 | ||
| 3eca_A | 326 | Crystal Structure Of Escherichia Coli L-Asparaginas | 3e-13 | ||
| 1ho3_A | 326 | Crystal Structure Analysis Of E. Coli L-asparaginas | 3e-13 | ||
| 4hqd_A | 169 | Crystal Structure Of Engineered Protein. Northeast | 4e-13 | ||
| 3noc_D | 169 | Designed Ankyrin Repeat Protein (Darpin) Binders To | 4e-13 | ||
| 3noc_D | 169 | Designed Ankyrin Repeat Protein (Darpin) Binders To | 2e-05 | ||
| 4hb5_A | 169 | Crystal Structure Of Engineered Protein. Northeast | 6e-13 | ||
| 1qym_A | 227 | X-Ray Structure Of Human Gankyrin Length = 227 | 6e-13 | ||
| 1uoh_A | 226 | Human Gankyrin Length = 226 | 6e-13 | ||
| 1ihd_A | 326 | Crystal Structure Of Trigonal Form Of D90e Mutant O | 1e-12 | ||
| 4eca_A | 326 | Asparaginase From E. Coli, Mutant T89v With Covalen | 2e-12 | ||
| 1mj0_A | 166 | Sank E3_5: An Artificial Ankyrin Repeat Protein Len | 4e-12 | ||
| 4gpm_A | 169 | Crystal Structure Of Engineered Protein. Northeast | 5e-12 | ||
| 2p2c_P | 169 | Inhibition Of Caspase-2 By A Designed Ankyrin Repea | 1e-11 | ||
| 2p2c_P | 169 | Inhibition Of Caspase-2 By A Designed Ankyrin Repea | 6e-05 | ||
| 4gmr_A | 169 | Crystal Structure Of Engineered Protein. Northeast | 2e-11 | ||
| 4gmr_A | 169 | Crystal Structure Of Engineered Protein. Northeast | 2e-06 | ||
| 4atz_D | 154 | Ad5 Knob In Complex With A Designed Ankyrin Repeat | 4e-11 | ||
| 4atz_D | 154 | Ad5 Knob In Complex With A Designed Ankyrin Repeat | 5e-05 | ||
| 1svx_A | 169 | Crystal Structure Of A Designed Selected Ankyrin Re | 4e-11 | ||
| 3q9u_C | 158 | In Silico And In Vitro Co-Evolution Of A High Affin | 4e-11 | ||
| 3q9u_C | 158 | In Silico And In Vitro Co-Evolution Of A High Affin | 6e-06 | ||
| 4drx_E | 169 | Gtp-Tubulin In Complex With A Darpin Length = 169 | 7e-11 | ||
| 2bkg_A | 166 | Crystal Structure Of E3_19 An Designed Ankyrin Repe | 8e-11 | ||
| 2bkg_A | 166 | Crystal Structure Of E3_19 An Designed Ankyrin Repe | 2e-05 | ||
| 4dui_A | 169 | Darpin D1 Binding To Tubulin Beta Chain (not In Com | 8e-11 | ||
| 2xeh_A | 157 | Structural Determinants For Improved Thermal Stabil | 1e-10 | ||
| 2xeh_A | 157 | Structural Determinants For Improved Thermal Stabil | 7e-04 | ||
| 1wsa_A | 330 | Structure Of L-Asparaginase Ii Precursor Length = 3 | 1e-10 | ||
| 3nog_D | 169 | Designed Ankyrin Repeat Protein (Darpin) Binders To | 2e-10 | ||
| 2qyj_A | 166 | Crystal Structure Of A Designed Full Consensus Anky | 3e-10 | ||
| 2xee_A | 157 | Structural Determinants For Improved Thermal Stabil | 3e-10 | ||
| 2xee_A | 157 | Structural Determinants For Improved Thermal Stabil | 9e-04 | ||
| 4f6r_D | 169 | Tubulin:stathmin-Like Domain Complex Length = 169 | 6e-10 | ||
| 3zu7_B | 169 | Crystal Structure Of A Designed Selected Ankyrin Re | 9e-10 | ||
| 2v5q_C | 167 | Crystal Structure Of Wild-type Plk-1 Kinase Domain | 9e-10 | ||
| 2v5q_C | 167 | Crystal Structure Of Wild-type Plk-1 Kinase Domain | 3e-04 | ||
| 1n0r_A | 126 | 4ank: A Designed Ankyrin Repeat Protein With Four I | 1e-09 | ||
| 1n0r_A | 126 | 4ank: A Designed Ankyrin Repeat Protein With Four I | 2e-05 | ||
| 2bkk_B | 169 | Crystal Structure Of Aminoglycoside Phosphotransfer | 1e-09 | ||
| 2bkk_B | 169 | Crystal Structure Of Aminoglycoside Phosphotransfer | 6e-04 | ||
| 1s70_B | 299 | Complex Between Protein Ser/thr Phosphatase-1 (delt | 3e-09 | ||
| 2j8s_D | 169 | Drug Export Pathway Of Multidrug Exporter Acrb Reve | 4e-09 | ||
| 2j8s_D | 169 | Drug Export Pathway Of Multidrug Exporter Acrb Reve | 8e-05 | ||
| 3pga_1 | 337 | Structural Characterization Of Pseudomonas 7a Gluta | 5e-09 | ||
| 3b7b_A | 237 | Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Le | 6e-09 | ||
| 3zuv_B | 136 | Crystal Structure Of A Designed Selected Ankyrin Re | 9e-09 | ||
| 3zuv_B | 136 | Crystal Structure Of A Designed Selected Ankyrin Re | 2e-05 | ||
| 2wlt_A | 332 | The Crystal Structure Of Helicobacter Pylori L-Aspa | 1e-08 | ||
| 2y1l_E | 169 | Caspase-8 In Complex With Darpin-8.4 Length = 169 | 2e-08 | ||
| 2y1l_E | 169 | Caspase-8 In Complex With Darpin-8.4 Length = 169 | 3e-05 | ||
| 4pga_A | 337 | Glutaminase-asparaginase From Pseudomonas 7a Length | 3e-08 | ||
| 1djo_A | 330 | Crystal Structure Of Pseudomonas 7a Glutaminase-Asp | 4e-08 | ||
| 1n11_A | 437 | D34 Region Of Human Ankyrin-R And Linker Length = 4 | 4e-08 | ||
| 3utm_A | 351 | Crystal Structure Of A Mouse Tankyrase-Axin Complex | 6e-08 | ||
| 2jab_A | 136 | A Designed Ankyrin Repeat Protein Evolved To Picomo | 1e-07 | ||
| 4grg_A | 135 | Crystal Structure Of Ige Complexed With E2_79, An A | 3e-07 | ||
| 4grg_A | 135 | Crystal Structure Of Ige Complexed With E2_79, An A | 8e-06 | ||
| 1n0q_A | 93 | 3ank: A Designed Ankyrin Repeat Protein With Three | 3e-07 | ||
| 1n0q_A | 93 | 3ank: A Designed Ankyrin Repeat Protein With Three | 2e-05 | ||
| 3hg0_D | 136 | Crystal Structure Of A Darpin In Complex With Orf49 | 1e-06 | ||
| 3hg0_D | 136 | Crystal Structure Of A Darpin In Complex With Orf49 | 5e-04 | ||
| 3aaa_C | 123 | Crystal Structure Of Actin Capping Protein In Compl | 1e-06 | ||
| 3aaa_C | 123 | Crystal Structure Of Actin Capping Protein In Compl | 3e-04 | ||
| 1myo_A | 118 | Solution Structure Of Myotrophin, Nmr, 44 Structure | 1e-06 | ||
| 1myo_A | 118 | Solution Structure Of Myotrophin, Nmr, 44 Structure | 2e-04 | ||
| 3twu_A | 167 | Crystal Structure Of Arc4 From Human Tankyrase 2 In | 3e-06 | ||
| 3twq_A | 175 | Crystal Structure Of Arc4 From Human Tankyrase 2 (A | 3e-06 | ||
| 3twr_A | 165 | Crystal Structure Of Arc4 From Human Tankyrase 2 In | 3e-06 | ||
| 2xzt_G | 136 | Caspase-3 In Complex With Darpin-3.4_i78s Length = | 5e-06 | ||
| 1ot8_A | 239 | Structure Of The Ankyrin Domain Of The Drosophila N | 7e-06 | ||
| 4b93_B | 269 | Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyri | 8e-06 | ||
| 3v2x_A | 167 | Crystal Structure Of The Peptide Bound Complex Of T | 9e-06 | ||
| 3v2o_A | 183 | Crystal Structure Of The Peptide Bound Complex Of T | 9e-06 | ||
| 3so8_A | 162 | Crystal Structure Of Ankra Length = 162 | 1e-05 | ||
| 2y0b_G | 136 | Caspase-3 In Complex With An Inhibitory Darpin-3.4_ | 1e-05 | ||
| 2y0b_G | 136 | Caspase-3 In Complex With An Inhibitory Darpin-3.4_ | 4e-05 | ||
| 3eu9_A | 240 | The Ankyrin Repeat Domain Of Huntingtin Interacting | 1e-05 | ||
| 3d9h_A | 285 | Crystal Structure Of The Splice Variant Of Human As | 1e-05 | ||
| 3v30_A | 172 | Crystal Structure Of The Peptide Bound Complex Of T | 3e-05 | ||
| 2xzd_G | 136 | Caspase-3 In Complex With An Inhibitory Darpin-3.4 | 3e-05 | ||
| 3uxg_A | 172 | Crystal Structure Of Rfxank Length = 172 | 3e-05 | ||
| 3zkj_A | 261 | Crystal Structure Of Ankyrin Repeat And Socs Box-co | 3e-05 | ||
| 2v4h_C | 136 | Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 | 4e-05 | ||
| 2v4h_C | 136 | Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 13 | 2e-04 | ||
| 3c5r_A | 137 | Crystal Structure Of The Bard1 Ankyrin Repeat Domai | 7e-05 | ||
| 3c5r_A | 137 | Crystal Structure Of The Bard1 Ankyrin Repeat Domai | 2e-04 | ||
| 2l6b_A | 115 | Nrc Consensus Ankyrin Repeat Protein Solution Struc | 9e-05 | ||
| 2l6b_A | 115 | Nrc Consensus Ankyrin Repeat Protein Solution Struc | 1e-04 | ||
| 1awc_B | 153 | Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 1 | 2e-04 | ||
| 2zgd_A | 110 | Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom | 2e-04 | ||
| 1agx_A | 331 | Refined Crystal Structure Of Acinetobacter Glutamin | 2e-04 | ||
| 1zcf_A | 327 | L-Asparaginase From Erwinia Carotovora Length = 327 | 4e-04 | ||
| 2jk0_A | 325 | Structural And Functional Insights Into Erwinia Car | 5e-04 | ||
| 2xen_A | 91 | Structural Determinants For Improved Thermal Stabil | 5e-04 | ||
| 2he0_A | 253 | Crystal Structure Of A Human Notch1 Ankyrin Domain | 6e-04 | ||
| 2zgg_A | 92 | Asn-Hydroxylation Stabilises The Ankyrin Repeat Dom | 6e-04 | ||
| 1o7j_A | 327 | Atomic Resolution Structure Of Erwinia Chrysanthemi | 7e-04 | ||
| 1hfj_A | 327 | Asparaginase From Erwinia Chrysanthemi, Hexagonal F | 8e-04 | ||
| 1yyh_A | 253 | Crystal Structure Of The Human Notch 1 Ankyrin Doma | 8e-04 | ||
| 4g8k_A | 337 | Intact Sensor Domain Of Human Rnase L In The Inacti | 8e-04 | ||
| 2f8x_K | 256 | Crystal Structure Of Activated Notch, Csl And Maml | 9e-04 |
| >pdb|2HIM|A Chain A, Crystal Structure And Allosteric Regulation Of The Cytoplasmic Escherichia Coli L-Asparaginase I Length = 358 | Back alignment and structure |
|
| >pdb|2P2D|A Chain A, Crystal Structure And Allosteric Regulation Of The Cytoplasmic Escherichia Coli L-Asparaginase I Length = 358 | Back alignment and structure |
| >pdb|3NTX|A Chain A, Crystal Structure Of L-Asparaginase I From Yersinia Pestis Length = 341 | Back alignment and structure |
| >pdb|2OCD|A Chain A, Crystal Structure Of L-Asparaginase I From Vibrio Cholerae O1 Biovar Eltor Str. N16961 Length = 337 | Back alignment and structure |
| >pdb|1WNF|A Chain A, Crystal Structure Of Ph0066 From Pyrococcus Horikoshii Length = 328 | Back alignment and structure |
| >pdb|1WLS|A Chain A, Crystal Structure Of L-Asparaginase I Homologue Protein From Pyrococcus Horikoshii Length = 328 | Back alignment and structure |
| >pdb|1ZQ1|A Chain A, Structure Of Gatde Trna-Dependent Amidotransferase From Pyrococcus Abyssi Length = 438 | Back alignment and structure |
| >pdb|2D6F|A Chain A, Crystal Structure Of Glu-Trna(Gln) Amidotransferase In The Complex With Trna(Gln) Length = 435 | Back alignment and structure |
| >pdb|3NXK|A Chain A, Crystal Structure Of Probable Cytoplasmic L-Asparaginase From Campylobacter Jejuni Length = 334 | Back alignment and structure |
| >pdb|2DVW|A Chain A, Structure Of The Oncoprotein Gankyrin In Complex With S6 Atpase Of The 26s Proteasome Length = 231 | Back alignment and structure |
| >pdb|3AJI|A Chain A, Structure Of Gankyrin-S6atpase Photo-Cross-Linked Site-Specifically, And Incoporated By Genetic Code Expansion Length = 231 | Back alignment and structure |
| >pdb|3ECA|A Chain A, Crystal Structure Of Escherichia Coli L-Asparaginase, An Enzyme Used In Cancer Therapy Length = 326 | Back alignment and structure |
| >pdb|1HO3|A Chain A, Crystal Structure Analysis Of E. Coli L-asparaginase Ii (y25f Mutant) Length = 326 | Back alignment and structure |
| >pdb|4HQD|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or265. Length = 169 | Back alignment and structure |
| >pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 | Back alignment and structure |
| >pdb|3NOC|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 | Back alignment and structure |
| >pdb|4HB5|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or267. Length = 169 | Back alignment and structure |
| >pdb|1QYM|A Chain A, X-Ray Structure Of Human Gankyrin Length = 227 | Back alignment and structure |
| >pdb|1UOH|A Chain A, Human Gankyrin Length = 226 | Back alignment and structure |
| >pdb|1IHD|A Chain A, Crystal Structure Of Trigonal Form Of D90e Mutant Of Escherichia Coli Asparaginase Ii Length = 326 | Back alignment and structure |
| >pdb|4ECA|A Chain A, Asparaginase From E. Coli, Mutant T89v With Covalently Bound Aspartate Length = 326 | Back alignment and structure |
| >pdb|1MJ0|A Chain A, Sank E3_5: An Artificial Ankyrin Repeat Protein Length = 166 | Back alignment and structure |
| >pdb|4GPM|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or264. Length = 169 | Back alignment and structure |
| >pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 | Back alignment and structure |
| >pdb|2P2C|P Chain P, Inhibition Of Caspase-2 By A Designed Ankyrin Repeat Protein (Darpin) Length = 169 | Back alignment and structure |
| >pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 | Back alignment and structure |
| >pdb|4GMR|A Chain A, Crystal Structure Of Engineered Protein. Northeast Structural Genomics Consortium Target Or266. Length = 169 | Back alignment and structure |
| >pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 | Back alignment and structure |
| >pdb|4ATZ|D Chain D, Ad5 Knob In Complex With A Designed Ankyrin Repeat Protein Length = 154 | Back alignment and structure |
| >pdb|1SVX|A Chain A, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Maltose Binding Protein Length = 169 | Back alignment and structure |
| >pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 | Back alignment and structure |
| >pdb|3Q9U|C Chain C, In Silico And In Vitro Co-Evolution Of A High Affinity Complementary Protein-Protein Interface Length = 158 | Back alignment and structure |
| >pdb|4DRX|E Chain E, Gtp-Tubulin In Complex With A Darpin Length = 169 | Back alignment and structure |
| >pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 | Back alignment and structure |
| >pdb|2BKG|A Chain A, Crystal Structure Of E3_19 An Designed Ankyrin Repeat Protein Length = 166 | Back alignment and structure |
| >pdb|4DUI|A Chain A, Darpin D1 Binding To Tubulin Beta Chain (not In Complex) Length = 169 | Back alignment and structure |
| >pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 | Back alignment and structure |
| >pdb|2XEH|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 | Back alignment and structure |
| >pdb|1WSA|A Chain A, Structure Of L-Asparaginase Ii Precursor Length = 330 | Back alignment and structure |
| >pdb|3NOG|D Chain D, Designed Ankyrin Repeat Protein (Darpin) Binders To Acrb: Plasticity Of The Interface Length = 169 | Back alignment and structure |
| >pdb|2QYJ|A Chain A, Crystal Structure Of A Designed Full Consensus Ankyrin Length = 166 | Back alignment and structure |
| >pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 | Back alignment and structure |
| >pdb|2XEE|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module. Length = 157 | Back alignment and structure |
| >pdb|4F6R|D Chain D, Tubulin:stathmin-Like Domain Complex Length = 169 | Back alignment and structure |
| >pdb|3ZU7|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Map Kinase Erk2 Length = 169 | Back alignment and structure |
| >pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 | Back alignment and structure |
| >pdb|2V5Q|C Chain C, Crystal Structure Of Wild-type Plk-1 Kinase Domain In Complex With A Selective Darpin Length = 167 | Back alignment and structure |
| >pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 | Back alignment and structure |
| >pdb|1N0R|A Chain A, 4ank: A Designed Ankyrin Repeat Protein With Four Identical Consensus Repeats Length = 126 | Back alignment and structure |
| >pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 | Back alignment and structure |
| >pdb|2BKK|B Chain B, Crystal Structure Of Aminoglycoside Phosphotransferase Aph (3')-Iiia In Complex With The Inhibitor Ar_3a Length = 169 | Back alignment and structure |
| >pdb|1S70|B Chain B, Complex Between Protein Ser/thr Phosphatase-1 (delta) And The Myosin Phosphatase Targeting Subunit 1 (mypt1) Length = 299 | Back alignment and structure |
| >pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 | Back alignment and structure |
| >pdb|2J8S|D Chain D, Drug Export Pathway Of Multidrug Exporter Acrb Revealed By Darpin Inhibitors Length = 169 | Back alignment and structure |
| >pdb|3PGA|1 Chain 1, Structural Characterization Of Pseudomonas 7a Glutaminase- Asparaginase Length = 337 | Back alignment and structure |
| >pdb|3B7B|A Chain A, Euhmt1 (Glp) Ankyrin Repeat Domain (Structure 1) Length = 237 | Back alignment and structure |
| >pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 | Back alignment and structure |
| >pdb|3ZUV|B Chain B, Crystal Structure Of A Designed Selected Ankyrin Repeat Protein In Complex With The Phosphorylated Map Kinase Erk2 Length = 136 | Back alignment and structure |
| >pdb|2WLT|A Chain A, The Crystal Structure Of Helicobacter Pylori L-Asparaginase At 1.4 A Resolution Length = 332 | Back alignment and structure |
| >pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 | Back alignment and structure |
| >pdb|2Y1L|E Chain E, Caspase-8 In Complex With Darpin-8.4 Length = 169 | Back alignment and structure |
| >pdb|4PGA|A Chain A, Glutaminase-asparaginase From Pseudomonas 7a Length = 337 | Back alignment and structure |
| >pdb|1DJO|A Chain A, Crystal Structure Of Pseudomonas 7a Glutaminase-Asparaginase With The Inhibitor Donv Covalently Bound In The Active Site Length = 330 | Back alignment and structure |
| >pdb|1N11|A Chain A, D34 Region Of Human Ankyrin-R And Linker Length = 437 | Back alignment and structure |
| >pdb|3UTM|A Chain A, Crystal Structure Of A Mouse Tankyrase-Axin Complex Length = 351 | Back alignment and structure |
| >pdb|2JAB|A Chain A, A Designed Ankyrin Repeat Protein Evolved To Picomolar Affinity To Her2 Length = 136 | Back alignment and structure |
| >pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 | Back alignment and structure |
| >pdb|4GRG|A Chain A, Crystal Structure Of Ige Complexed With E2_79, An Anti-Ige Inhibitor Length = 135 | Back alignment and structure |
| >pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 | Back alignment and structure |
| >pdb|1N0Q|A Chain A, 3ank: A Designed Ankyrin Repeat Protein With Three Identical Consensus Repeats Length = 93 | Back alignment and structure |
| >pdb|3HG0|D Chain D, Crystal Structure Of A Darpin In Complex With Orf49 From Lactococcal Phage Tp901-1 Length = 136 | Back alignment and structure |
| >pdb|3HG0|D Chain D, Crystal Structure Of A Darpin In Complex With Orf49 From Lactococcal Phage Tp901-1 Length = 136 | Back alignment and structure |
| >pdb|3AAA|C Chain C, Crystal Structure Of Actin Capping Protein In Complex With V-1 Length = 123 | Back alignment and structure |
| >pdb|3AAA|C Chain C, Crystal Structure Of Actin Capping Protein In Complex With V-1 Length = 123 | Back alignment and structure |
| >pdb|1MYO|A Chain A, Solution Structure Of Myotrophin, Nmr, 44 Structures Length = 118 | Back alignment and structure |
| >pdb|1MYO|A Chain A, Solution Structure Of Myotrophin, Nmr, 44 Structures Length = 118 | Back alignment and structure |
| >pdb|3TWU|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human Mcl1 Length = 167 | Back alignment and structure |
| >pdb|3TWQ|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 (Apo Form) Length = 175 | Back alignment and structure |
| >pdb|3TWR|A Chain A, Crystal Structure Of Arc4 From Human Tankyrase 2 In Complex With Peptide From Human 3bp2 Length = 165 | Back alignment and structure |
| >pdb|2XZT|G Chain G, Caspase-3 In Complex With Darpin-3.4_i78s Length = 136 | Back alignment and structure |
| >pdb|1OT8|A Chain A, Structure Of The Ankyrin Domain Of The Drosophila Notch Receptor Length = 239 | Back alignment and structure |
| >pdb|4B93|B Chain B, Complex Of Vamp7 Cytoplasmic Domain With 2nd Ankyrin Repeat Domain Of Varp Length = 269 | Back alignment and structure |
| >pdb|3V2X|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 167 | Back alignment and structure |
| >pdb|3V2O|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Ankra2 Length = 183 | Back alignment and structure |
| >pdb|3SO8|A Chain A, Crystal Structure Of Ankra Length = 162 | Back alignment and structure |
| >pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 | Back alignment and structure |
| >pdb|2Y0B|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4_s76r Length = 136 | Back alignment and structure |
| >pdb|3EU9|A Chain A, The Ankyrin Repeat Domain Of Huntingtin Interacting Protein 14 Length = 240 | Back alignment and structure |
| >pdb|3D9H|A Chain A, Crystal Structure Of The Splice Variant Of Human Asb9 (Hasb9-2), An Ankyrin Repeat Protein Length = 285 | Back alignment and structure |
| >pdb|3V30|A Chain A, Crystal Structure Of The Peptide Bound Complex Of The Ankyrin Repeat Domains Of Human Rfxank Length = 172 | Back alignment and structure |
| >pdb|2XZD|G Chain G, Caspase-3 In Complex With An Inhibitory Darpin-3.4 Length = 136 | Back alignment and structure |
| >pdb|3UXG|A Chain A, Crystal Structure Of Rfxank Length = 172 | Back alignment and structure |
| >pdb|3ZKJ|A Chain A, Crystal Structure Of Ankyrin Repeat And Socs Box-containing Protein 9 (asb9) In Complex With Elonginb And Elonginc Length = 261 | Back alignment and structure |
| >pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 | Back alignment and structure |
| >pdb|2V4H|C Chain C, Nemo Cc2-Lz Domain - 1d5 Darpin Complex Length = 136 | Back alignment and structure |
| >pdb|3C5R|A Chain A, Crystal Structure Of The Bard1 Ankyrin Repeat Domain And Its Functional Consequences Length = 137 | Back alignment and structure |
| >pdb|3C5R|A Chain A, Crystal Structure Of The Bard1 Ankyrin Repeat Domain And Its Functional Consequences Length = 137 | Back alignment and structure |
| >pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 | Back alignment and structure |
| >pdb|2L6B|A Chain A, Nrc Consensus Ankyrin Repeat Protein Solution Structure Length = 115 | Back alignment and structure |
| >pdb|1AWC|B Chain B, Mouse Gabp AlphaBETA DOMAIN BOUND TO DNA Length = 153 | Back alignment and structure |
| >pdb|2ZGD|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 110 | Back alignment and structure |
| >pdb|1AGX|A Chain A, Refined Crystal Structure Of Acinetobacter Glutaminasificans Glutaminase-Asparaginase Length = 331 | Back alignment and structure |
| >pdb|1ZCF|A Chain A, L-Asparaginase From Erwinia Carotovora Length = 327 | Back alignment and structure |
| >pdb|2JK0|A Chain A, Structural And Functional Insights Into Erwinia Carotovora L-Asparaginase Length = 325 | Back alignment and structure |
| >pdb|2XEN|A Chain A, Structural Determinants For Improved Thermal Stability Of Designed Ankyrin Repeat Proteins With A Redesigned C- Capping Module Length = 91 | Back alignment and structure |
| >pdb|2HE0|A Chain A, Crystal Structure Of A Human Notch1 Ankyrin Domain Mutant Length = 253 | Back alignment and structure |
| >pdb|2ZGG|A Chain A, Asn-Hydroxylation Stabilises The Ankyrin Repeat Domain Fold Length = 92 | Back alignment and structure |
| >pdb|1O7J|A Chain A, Atomic Resolution Structure Of Erwinia Chrysanthemi L-Asparaginase Length = 327 | Back alignment and structure |
| >pdb|1HFJ|A Chain A, Asparaginase From Erwinia Chrysanthemi, Hexagonal Form With Sulfate Length = 327 | Back alignment and structure |
| >pdb|1YYH|A Chain A, Crystal Structure Of The Human Notch 1 Ankyrin Domain Length = 253 | Back alignment and structure |
| >pdb|4G8K|A Chain A, Intact Sensor Domain Of Human Rnase L In The Inactive Signaling State Length = 337 | Back alignment and structure |
| >pdb|2F8X|K Chain K, Crystal Structure Of Activated Notch, Csl And Maml On Hes-1 Promoter Dna Sequence Length = 256 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 659 | |||
| 2him_A | 358 | L-asparaginase 1; hydrolase; 1.82A {Escherichia co | 1e-149 | |
| 1wls_A | 328 | L-asparaginase; structural genomics, hydrolase; 2. | 1e-141 | |
| 1zq1_A | 438 | Glutamyl-tRNA(Gln) amidotransferase subunit D; X-R | 1e-130 | |
| 2d6f_A | 435 | Glutamyl-tRNA(Gln) amidotransferase subunit D; lig | 1e-126 | |
| 1wsa_A | 330 | Asparaginase, asparagine amidohydrolase; periplasm | 3e-75 | |
| 1nns_A | 326 | L-asparaginase II; amidrohydrolase, crystallograph | 6e-75 | |
| 3nxk_A | 334 | Cytoplasmic L-asparaginase; structural genomics, c | 1e-71 | |
| 2wlt_A | 332 | L-asparaginase; hydrolase; 1.40A {Helicobacter pyl | 1e-70 | |
| 1o7j_A | 327 | L-asparaginase; atomic resolution, hydrolase; 1.0A | 1e-67 | |
| 4pga_A | 337 | Glutaminase-asparaginase; bacterial amidohydrolase | 1e-67 | |
| 1agx_A | 331 | Glutaminase-asparaginase; bacterial amidohydrolase | 3e-63 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 5e-27 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 2e-23 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 5e-23 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 1e-22 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 2e-22 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 1e-20 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 8e-14 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 9e-26 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 9e-17 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 7e-13 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 9e-13 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 9e-06 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 2e-25 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 8e-22 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 4e-18 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 3e-16 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 4e-11 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 6e-09 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 4e-25 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 7e-20 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 7e-18 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 6e-25 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 8e-23 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 2e-19 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 3e-17 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 2e-09 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 3e-06 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 9e-04 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 8e-25 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 4e-09 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 1e-05 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 1e-24 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 2e-20 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 8e-20 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 3e-13 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 1e-08 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 1e-24 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 1e-22 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 2e-17 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 1e-07 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 6e-24 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 7e-20 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 9e-20 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 3e-16 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 4e-09 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 7e-24 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 2e-20 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 3e-19 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 2e-08 | |
| 3c5r_A | 137 | BARD-1, BRCA1-associated ring domain protein 1; an | 1e-23 | |
| 3c5r_A | 137 | BARD-1, BRCA1-associated ring domain protein 1; an | 1e-18 | |
| 3c5r_A | 137 | BARD-1, BRCA1-associated ring domain protein 1; an | 1e-10 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 2e-23 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 3e-18 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 6e-08 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 3e-23 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 2e-21 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 2e-07 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 3e-23 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 4e-21 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 8e-10 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 8e-06 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 4e-23 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 1e-04 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 5e-23 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 5e-23 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 4e-15 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 2e-06 | |
| 1awc_B | 153 | Protein (GA binding protein beta 1); complex (tran | 5e-23 | |
| 1awc_B | 153 | Protein (GA binding protein beta 1); complex (tran | 3e-08 | |
| 1awc_B | 153 | Protein (GA binding protein beta 1); complex (tran | 7e-05 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 6e-23 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 9e-11 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 1e-22 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 8e-17 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 1e-16 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 4e-11 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 1e-06 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 2e-22 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 1e-18 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 3e-14 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 7e-14 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 2e-22 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 5e-15 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 3e-04 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 3e-22 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 8e-22 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 3e-05 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 4e-22 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 2e-15 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 1e-07 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 3e-06 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 4e-22 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 4e-20 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 3e-18 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 8e-18 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 9e-16 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 8e-08 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 9e-22 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 7e-21 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 2e-19 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 2e-09 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 1e-21 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 3e-18 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 1e-14 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 3e-21 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 1e-15 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 3e-21 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 2e-17 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 1e-15 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 2e-14 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 2e-11 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 4e-21 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 1e-20 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 2e-17 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 9e-17 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 6e-10 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 1e-07 | |
| 3twr_A | 165 | Tankyrase-2; ankyrin repeat, protein-protein inter | 4e-21 | |
| 3twr_A | 165 | Tankyrase-2; ankyrin repeat, protein-protein inter | 2e-16 | |
| 3twr_A | 165 | Tankyrase-2; ankyrin repeat, protein-protein inter | 4e-07 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 2e-20 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 1e-18 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 8e-16 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 3e-11 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 3e-20 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 4e-17 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 1e-16 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 2e-07 | |
| 1d9s_A | 136 | Cyclin-dependent kinase 4 inhibitor B; helix-turn- | 2e-19 | |
| 1d9s_A | 136 | Cyclin-dependent kinase 4 inhibitor B; helix-turn- | 2e-17 | |
| 1d9s_A | 136 | Cyclin-dependent kinase 4 inhibitor B; helix-turn- | 1e-09 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 2e-19 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 2e-18 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 9e-16 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 5e-19 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 3e-16 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 4e-06 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 2e-04 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 5e-19 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 3e-18 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 4e-17 | |
| 1n0r_A | 126 | 4ANK, 4 ankyrin repeats; structural protein; 1.50A | 2e-18 | |
| 1n0r_A | 126 | 4ANK, 4 ankyrin repeats; structural protein; 1.50A | 7e-18 | |
| 1n0r_A | 126 | 4ANK, 4 ankyrin repeats; structural protein; 1.50A | 1e-10 | |
| 1n0r_A | 126 | 4ANK, 4 ankyrin repeats; structural protein; 1.50A | 3e-06 | |
| 2jab_A | 136 | H10-2-G3; HER2, darpin, ankyrin repeat protein, me | 3e-18 | |
| 2jab_A | 136 | H10-2-G3; HER2, darpin, ankyrin repeat protein, me | 6e-18 | |
| 2l6b_A | 115 | NR1C; ankyrin, consensus, repeat protein, ising mo | 9e-18 | |
| 2l6b_A | 115 | NR1C; ankyrin, consensus, repeat protein, ising mo | 2e-11 | |
| 2l6b_A | 115 | NR1C; ankyrin, consensus, repeat protein, ising mo | 3e-07 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 1e-17 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 3e-17 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 7e-07 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 2e-05 | |
| 1sw6_A | 327 | Regulatory protein SWI6; transcription regulation, | 3e-17 | |
| 1sw6_A | 327 | Regulatory protein SWI6; transcription regulation, | 1e-12 | |
| 1sw6_A | 327 | Regulatory protein SWI6; transcription regulation, | 2e-11 | |
| 1sw6_A | 327 | Regulatory protein SWI6; transcription regulation, | 9e-06 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 1e-16 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 1e-11 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 6e-08 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 3e-04 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 4e-16 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 1e-15 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 6e-14 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 2e-10 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 7e-16 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 2e-11 | |
| 2zgd_A | 110 | 3 repeat synthetic ankyrin; ankyrin repeat, hydrox | 6e-15 | |
| 2zgd_A | 110 | 3 repeat synthetic ankyrin; ankyrin repeat, hydrox | 1e-10 | |
| 2zgd_A | 110 | 3 repeat synthetic ankyrin; ankyrin repeat, hydrox | 9e-10 | |
| 1n0q_A | 93 | 3ANK, 3 ankyrin repeats; structural protein; 1.26A | 7e-15 | |
| 1n0q_A | 93 | 3ANK, 3 ankyrin repeats; structural protein; 1.26A | 4e-12 | |
| 1n0q_A | 93 | 3ANK, 3 ankyrin repeats; structural protein; 1.26A | 3e-08 | |
| 1n0q_A | 93 | 3ANK, 3 ankyrin repeats; structural protein; 1.26A | 1e-06 | |
| 2pnn_A | 273 | Transient receptor potential cation channel subfa | 1e-13 | |
| 2pnn_A | 273 | Transient receptor potential cation channel subfa | 2e-11 | |
| 3jxi_A | 260 | Vanilloid receptor-related osmotically activated p | 2e-11 | |
| 3jxi_A | 260 | Vanilloid receptor-related osmotically activated p | 3e-10 | |
| 2aja_A | 376 | Ankyrin repeat family protein; NESG, Q5ZSV0, struc | 2e-11 | |
| 2aja_A | 376 | Ankyrin repeat family protein; NESG, Q5ZSV0, struc | 1e-07 | |
| 2aja_A | 376 | Ankyrin repeat family protein; NESG, Q5ZSV0, struc | 3e-04 | |
| 2b0o_E | 301 | UPLC1; arfgap, structural genomics, structural gen | 5e-11 | |
| 2b0o_E | 301 | UPLC1; arfgap, structural genomics, structural gen | 3e-08 | |
| 2b0o_E | 301 | UPLC1; arfgap, structural genomics, structural gen | 2e-07 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 5e-11 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 2e-05 | |
| 1dcq_A | 278 | PYK2-associated protein beta; zinc-binding module, | 8e-11 | |
| 1dcq_A | 278 | PYK2-associated protein beta; zinc-binding module, | 3e-08 | |
| 1dcq_A | 278 | PYK2-associated protein beta; zinc-binding module, | 8e-07 | |
| 3jue_A | 368 | Arfgap with coiled-coil, ANK repeat and PH domain | 6e-10 | |
| 3jue_A | 368 | Arfgap with coiled-coil, ANK repeat and PH domain | 4e-07 | |
| 3lvq_E | 497 | ARF-GAP with SH3 domain, ANK repeat and PH domain | 1e-07 | |
| 3lvq_E | 497 | ARF-GAP with SH3 domain, ANK repeat and PH domain | 1e-05 | |
| 3lvq_E | 497 | ARF-GAP with SH3 domain, ANK repeat and PH domain | 2e-04 |
| >2him_A L-asparaginase 1; hydrolase; 1.82A {Escherichia coli} PDB: 2p2d_A 2p2n_A 3ntx_A* 2ocd_A Length = 358 | Back alignment and structure |
|---|
Score = 436 bits (1124), Expect = e-149
Identities = 160/374 (42%), Positives = 215/374 (57%), Gaps = 26/374 (6%)
Query: 60 RRASLTLNSSEDRLESKVLVLYTGGTIGMEDNEQGALAPSSKPLTDKIRENPLLYDRHYD 119
+S + + + V YTGGTIGM+ +EQG P S L ++ P +
Sbjct: 9 HHSSGLVPRGSHMQKKSIYVAYTGGTIGMQRSEQG-YIPVSGHLQRQLALMPEFHRPEM- 66
Query: 120 VCKTQDGNVLVLPRVKDTRRVLYKVVEYTPLLDSSNMCQVHWIKIANDIKEYYESYDGFV 179
+ + EYTPL+DSS+M W IA DIK +Y+ YDGFV
Sbjct: 67 --------------------PDFTIHEYTPLMDSSDMTPEDWQHIAEDIKAHYDDYDGFV 106
Query: 180 ILHGTDTLSYTASALSFMLENLGKPVIVTGSQISIFQIRSDGVHNFIGALILAGNYDIPE 239
ILHGTDT++YTASALSFMLENLGKPVIVTGSQI + ++RSDG N + AL +A NY I E
Sbjct: 107 ILHGTDTMAYTASALSFMLENLGKPVIVTGSQIPLAELRSDGQINLLNALYVAANYPINE 166
Query: 240 VTVYFNHKLIRGNRTVKMSVKEFDAFDSPNFPNLAKVGLTIDVNMKSIFRSSTIKKFDVQ 299
VT++FN++L RGNRT K FDAF SPN P L + G+ I + + V
Sbjct: 167 VTLFFNNRLYRGNRTAKAHADGFDAFASPNLPPLLEAGIHIRRL-NTPPAPHGEGELIVH 225
Query: 300 SQLNLNVGILRIYPHISNHTVRSFMQSPMEGVILLTYGSGNFPSNRSDLIDELRLASDRN 359
+G++ IYP IS VR+F++ P++ +IL +YG GN P N+ + EL+ ASDR
Sbjct: 226 PITPQPIGVVTIYPGISADVVRNFLRQPVKALILRSYGVGNAPQNK-AFLQELQEASDRG 284
Query: 360 VIIVNCSQCSRGGTS-DTYEAGKILSGIGVINGYDMTPEAALTKLSYVLSKSELTLQQKK 418
+++VN +QC G + Y G L+ GVI G DMT EA LTKL Y+LS+ L + +
Sbjct: 285 IVVVNLTQCMSGKVNMGGYATGNALAHAGVIGGADMTVEATLTKLHYLLSQE-LDTETIR 343
Query: 419 DIMMTNIRGELSTD 432
M N+RGEL+ D
Sbjct: 344 KAMSQNLRGELTPD 357
|
| >1wls_A L-asparaginase; structural genomics, hydrolase; 2.16A {Pyrococcus horikoshii} PDB: 1wnf_A Length = 328 | Back alignment and structure |
|---|
| >1zq1_A Glutamyl-tRNA(Gln) amidotransferase subunit D; X-RAY, 3D structure, asparaginase 1 family, GATD subfamily, lyase; 3.00A {Pyrococcus abyssi} SCOP: b.38.3.1 c.88.1.1 Length = 438 | Back alignment and structure |
|---|
| >2d6f_A Glutamyl-tRNA(Gln) amidotransferase subunit D; ligase, ligase/RNA complex; 3.15A {Methanothermobacterthermautotrophicus} SCOP: b.38.3.1 c.88.1.1 Length = 435 | Back alignment and structure |
|---|
| >1wsa_A Asparaginase, asparagine amidohydrolase; periplasmic; 2.20A {Wolinella succinogenes} SCOP: c.88.1.1 Length = 330 | Back alignment and structure |
|---|
| >1nns_A L-asparaginase II; amidrohydrolase, crystallographic comparison hydrolase; 1.95A {Escherichia coli} SCOP: c.88.1.1 PDB: 3eca_A 1ho3_A 1jaz_A 1ihd_A 1jja_A 4eca_A* Length = 326 | Back alignment and structure |
|---|
| >3nxk_A Cytoplasmic L-asparaginase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; 2.40A {Campylobacter jejuni subsp} Length = 334 | Back alignment and structure |
|---|
| >2wlt_A L-asparaginase; hydrolase; 1.40A {Helicobacter pylori} PDB: 2wt4_A Length = 332 | Back alignment and structure |
|---|
| >1o7j_A L-asparaginase; atomic resolution, hydrolase; 1.0A {Erwinia chrysanthemi} SCOP: c.88.1.1 PDB: 1hfj_A 1hfk_A* 1hg0_A 1hg1_A 1hfw_A* 1jsr_A* 1jsl_A 2gvn_A 1zcf_A 2hln_A* 2jk0_A Length = 327 | Back alignment and structure |
|---|
| >4pga_A Glutaminase-asparaginase; bacterial amidohydrolase; 1.70A {Pseudomonas SP} SCOP: c.88.1.1 PDB: 1djp_A* 1djo_A* 3pga_1 Length = 337 | Back alignment and structure |
|---|
| >1agx_A Glutaminase-asparaginase; bacterial amidohydrolase; 2.90A {Acinetobacter glutaminasificans} SCOP: c.88.1.1 Length = 331 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 Length = 437 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A Length = 222 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} Length = 351 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A Length = 223 | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A Length = 167 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A Length = 253 | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A Length = 231 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} Length = 364 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} Length = 240 | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 Length = 137 | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A Length = 179 | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A Length = 172 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E Length = 236 | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} Length = 186 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D Length = 282 | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 Length = 153 | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* Length = 169 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A Length = 241 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 Length = 299 | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B Length = 156 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A Length = 228 | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A Length = 123 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 Length = 285 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* Length = 237 | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B Length = 239 | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} Length = 192 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 Length = 373 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} Length = 285 | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* Length = 165 | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} Length = 229 | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A Length = 162 | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 Length = 136 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} Length = 201 | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} Length = 232 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} Length = 285 | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 Length = 126 | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C Length = 136 | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} Length = 115 | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A Length = 156 | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 Length = 327 | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A Length = 183 | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A Length = 244 | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A Length = 256 | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A Length = 110 | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 Length = 93 | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* Length = 273 | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A Length = 260 | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 Length = 376 | Back alignment and structure |
|---|
| >2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 | Back alignment and structure |
|---|
| >2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 | Back alignment and structure |
|---|
| >2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} Length = 301 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 | Back alignment and structure |
|---|
| >1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 | Back alignment and structure |
|---|
| >1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 Length = 278 | Back alignment and structure |
|---|
| >3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 | Back alignment and structure |
|---|
| >3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} Length = 368 | Back alignment and structure |
|---|
| >3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 | Back alignment and structure |
|---|
| >3lvq_E ARF-GAP with SH3 domain, ANK repeat and PH domain containing protein 3, ADP-ribosylation...; GDP, ASAP3, UPLC1, linkers, alternat splicing; HET: GDP; 3.38A {Homo sapiens} PDB: 3lvr_E* Length = 497 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 659 | |||
| 2him_A | 358 | L-asparaginase 1; hydrolase; 1.82A {Escherichia co | 100.0 | |
| 1wls_A | 328 | L-asparaginase; structural genomics, hydrolase; 2. | 100.0 | |
| 1zq1_A | 438 | Glutamyl-tRNA(Gln) amidotransferase subunit D; X-R | 100.0 | |
| 2d6f_A | 435 | Glutamyl-tRNA(Gln) amidotransferase subunit D; lig | 100.0 | |
| 1nns_A | 326 | L-asparaginase II; amidrohydrolase, crystallograph | 100.0 | |
| 2wlt_A | 332 | L-asparaginase; hydrolase; 1.40A {Helicobacter pyl | 100.0 | |
| 1wsa_A | 330 | Asparaginase, asparagine amidohydrolase; periplasm | 100.0 | |
| 1agx_A | 331 | Glutaminase-asparaginase; bacterial amidohydrolase | 100.0 | |
| 4pga_A | 337 | Glutaminase-asparaginase; bacterial amidohydrolase | 100.0 | |
| 3nxk_A | 334 | Cytoplasmic L-asparaginase; structural genomics, c | 100.0 | |
| 1o7j_A | 327 | L-asparaginase; atomic resolution, hydrolase; 1.0A | 100.0 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 100.0 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 100.0 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 100.0 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 100.0 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 100.0 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 100.0 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 100.0 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 100.0 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 100.0 | |
| 1yyh_A | 253 | HN1;, notch 1, ankyrin domain; ankyrin repeats, ce | 100.0 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 100.0 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 100.0 | |
| 1wdy_A | 285 | 2-5A-dependent ribonuclease; hydrolase, RNA-bindin | 100.0 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 100.0 | |
| 1k1a_A | 241 | B-cell lymphoma 3-encoded protein; BCL-3, NF-kappa | 100.0 | |
| 3aji_A | 231 | 26S proteasome non-ATPase regulatory subunit 10; g | 100.0 | |
| 4b93_B | 269 | Ankyrin repeat domain-containing protein 27; endoc | 100.0 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 100.0 | |
| 4gpm_A | 169 | Engineered protein OR264; de novo protein, structu | 100.0 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 100.0 | |
| 4b93_B | 269 | Ankyrin repeat domain-containing protein 27; endoc | 100.0 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 100.0 | |
| 2xai_A | 261 | ASB-9, ankyrin repeat and SOCS box protein 9; tran | 100.0 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 100.0 | |
| 4g8k_A | 337 | 2-5A-dependent ribonuclease; ankyrin-repeat domain | 100.0 | |
| 4gpm_A | 169 | Engineered protein OR264; de novo protein, structu | 100.0 | |
| 3b7b_A | 237 | Euchromatic histone-lysine N-methyltransferase 1; | 100.0 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 100.0 | |
| 2dzn_A | 228 | Probable 26S proteasome regulatory subunit P28; an | 100.0 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 100.0 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 100.0 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 100.0 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 100.0 | |
| 3d9h_A | 285 | CDNA FLJ77766, highly similar to HOMO sapiens anky | 100.0 | |
| 1oy3_D | 282 | Transcription factor inhibitor I-kappa-B-beta; pro | 100.0 | |
| 2pnn_A | 273 | Transient receptor potential cation channel subfa | 100.0 | |
| 4g8k_A | 337 | 2-5A-dependent ribonuclease; ankyrin-repeat domain | 99.98 | |
| 1n11_A | 437 | Ankyrin; clathrin, BAND 3, anion exchanger, struct | 99.98 | |
| 2f8y_A | 223 | Notch homolog 1, translocation-associated (drosoph | 99.98 | |
| 2fo1_E | 373 | LIN-12 protein; beta-barrel, protein-DNA complex, | 99.98 | |
| 3jxi_A | 260 | Vanilloid receptor-related osmotically activated p | 99.97 | |
| 3utm_A | 351 | Tankyrase-1; tankyrase, TNKS, ankryin repeat clust | 99.97 | |
| 3eu9_A | 240 | Huntingtin-interacting protein 14; epigenetics, an | 99.97 | |
| 1s70_B | 299 | 130 kDa myosin-binding subunit of smooth muscle my | 99.97 | |
| 4hbd_A | 276 | KN motif and ankyrin repeat domain-containing Pro; | 99.97 | |
| 3kea_A | 285 | K1L; tropism, ANK repeat, viral protein; 2.30A {Va | 99.97 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 99.97 | |
| 3ljn_A | 364 | Hypothetical protein; ankyrin, structural genomics | 99.97 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 99.97 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 99.96 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 99.96 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 99.96 | |
| 1ihb_A | 162 | P18-INK4C(INK6), cyclin-dependent kinase 6 inhibit | 99.96 | |
| 2y1l_E | 169 | Darpin-8.4; hydrolase-inhibitor complex, DEVD darp | 99.96 | |
| 3v30_A | 172 | DNA-binding protein rfxank; structural genomics co | 99.96 | |
| 1sw6_A | 327 | Regulatory protein SWI6; transcription regulation, | 99.96 | |
| 3v31_A | 167 | Ankyrin repeat family A protein 2; structural geno | 99.96 | |
| 1awc_B | 153 | Protein (GA binding protein beta 1); complex (tran | 99.96 | |
| 2rfm_A | 192 | Putative ankyrin repeat protein TV1425; ANK repeat | 99.96 | |
| 1sw6_A | 327 | Regulatory protein SWI6; transcription regulation, | 99.96 | |
| 2rfa_A | 232 | Transient receptor potential cation channel subfa | 99.96 | |
| 3hra_A | 201 | Ankyrin repeat family protein; structural protein; | 99.96 | |
| 1ikn_D | 236 | Protein (I-kappa-B-alpha), protein (NF-kappa-B P50 | 99.96 | |
| 3twr_A | 165 | Tankyrase-2; ankyrin repeat, protein-protein inter | 99.96 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 99.96 | |
| 2pnn_A | 273 | Transient receptor potential cation channel subfa | 99.96 | |
| 3f6q_A | 179 | Integrin-linked protein kinase; ILK, integrin-link | 99.95 | |
| 1awc_B | 153 | Protein (GA binding protein beta 1); complex (tran | 99.95 | |
| 2etb_A | 256 | Transient receptor potential cation channel subfam | 99.95 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 99.95 | |
| 3twr_A | 165 | Tankyrase-2; ankyrin repeat, protein-protein inter | 99.95 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 99.95 | |
| 1bd8_A | 156 | P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyr | 99.95 | |
| 3jxi_A | 260 | Vanilloid receptor-related osmotically activated p | 99.95 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 99.94 | |
| 4hbd_A | 276 | KN motif and ankyrin repeat domain-containing Pro; | 99.94 | |
| 1ycs_B | 239 | 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppres | 99.94 | |
| 1d9s_A | 136 | Cyclin-dependent kinase 4 inhibitor B; helix-turn- | 99.93 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 99.93 | |
| 1d9s_A | 136 | Cyclin-dependent kinase 4 inhibitor B; helix-turn- | 99.93 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 99.92 | |
| 3t8k_A | 186 | Uncharacterized protein; structural genomics, PSI- | 99.92 | |
| 2vge_A | 229 | RELA-associated inhibitor; iaspp, nucleus, apoptos | 99.92 | |
| 1bi7_B | 156 | P16INK4A, MTS1, multiple tumor suppressor; cyclin | 99.91 | |
| 1n0r_A | 126 | 4ANK, 4 ankyrin repeats; structural protein; 1.50A | 99.91 | |
| 2jab_A | 136 | H10-2-G3; HER2, darpin, ankyrin repeat protein, me | 99.91 | |
| 1n0r_A | 126 | 4ANK, 4 ankyrin repeats; structural protein; 1.50A | 99.91 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 99.9 | |
| 2jab_A | 136 | H10-2-G3; HER2, darpin, ankyrin repeat protein, me | 99.9 | |
| 3c5r_A | 137 | BARD-1, BRCA1-associated ring domain protein 1; an | 99.9 | |
| 2aja_A | 376 | Ankyrin repeat family protein; NESG, Q5ZSV0, struc | 99.9 | |
| 3c5r_A | 137 | BARD-1, BRCA1-associated ring domain protein 1; an | 99.89 | |
| 2aja_A | 376 | Ankyrin repeat family protein; NESG, Q5ZSV0, struc | 99.88 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 99.88 | |
| 3deo_A | 183 | Signal recognition particle 43 kDa protein; chloro | 99.88 | |
| 3ui2_A | 244 | Signal recognition particle 43 kDa protein, chlor; | 99.87 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 99.87 | |
| 2b0o_E | 301 | UPLC1; arfgap, structural genomics, structural gen | 99.87 | |
| 2b0o_E | 301 | UPLC1; arfgap, structural genomics, structural gen | 99.87 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 99.86 | |
| 3aaa_C | 123 | Myotrophin, protein V-1; actin capping protein, ba | 99.86 | |
| 3ehr_A | 222 | Osteoclast-stimulating factor 1; beta barrel, heli | 99.86 | |
| 3jue_A | 368 | Arfgap with coiled-coil, ANK repeat and PH domain | 99.83 | |
| 3lvq_E | 497 | ARF-GAP with SH3 domain, ANK repeat and PH domain | 99.83 | |
| 1dcq_A | 278 | PYK2-associated protein beta; zinc-binding module, | 99.83 | |
| 3lvq_E | 497 | ARF-GAP with SH3 domain, ANK repeat and PH domain | 99.83 | |
| 3jue_A | 368 | Arfgap with coiled-coil, ANK repeat and PH domain | 99.83 | |
| 1n0q_A | 93 | 3ANK, 3 ankyrin repeats; structural protein; 1.26A | 99.8 | |
| 1n0q_A | 93 | 3ANK, 3 ankyrin repeats; structural protein; 1.26A | 99.8 | |
| 1dcq_A | 278 | PYK2-associated protein beta; zinc-binding module, | 99.8 | |
| 2l6b_A | 115 | NR1C; ankyrin, consensus, repeat protein, ising mo | 99.78 | |
| 2l6b_A | 115 | NR1C; ankyrin, consensus, repeat protein, ising mo | 99.77 | |
| 2zgd_A | 110 | 3 repeat synthetic ankyrin; ankyrin repeat, hydrox | 99.66 | |
| 2zgd_A | 110 | 3 repeat synthetic ankyrin; ankyrin repeat, hydrox | 99.66 |
| >2him_A L-asparaginase 1; hydrolase; 1.82A {Escherichia coli} PDB: 2p2d_A 2p2n_A 3ntx_A* 2ocd_A | Back alignment and structure |
|---|
Probab=100.00 E-value=5.5e-79 Score=644.59 Aligned_cols=335 Identities=47% Similarity=0.753 Sum_probs=288.3
Q ss_pred CCCCeEEEEecCCccccccCCCCccccCCCchhhHHhhCCCCcccccccccccCCcccccccccccceeEEEEEEecCCC
Q psy9757 72 RLESKVLVLYTGGTIGMEDNEQGALAPSSKPLTDKIRENPLLYDRHYDVCKTQDGNVLVLPRVKDTRRVLYKVVEYTPLL 151 (659)
Q Consensus 72 ~~~~~i~ii~TGGTI~~~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~ 151 (659)
.++|||+||+|||||+|+.++.| +.|.....+++++.+|++.... ...+++.++.+++
T Consensus 21 m~~~~I~vi~TGGTIa~~~~~~g-~~p~~~~~~~ll~~vp~l~~~~---------------------~~~i~~~~~~~li 78 (358)
T 2him_A 21 MQKKSIYVAYTGGTIGMQRSEQG-YIPVSGHLQRQLALMPEFHRPE---------------------MPDFTIHEYTPLM 78 (358)
T ss_dssp --CCEEEEEEEESGGGBCC------CBCTTHHHHHHTTCGGGGSTT---------------------SCEEEEEEEEEEE
T ss_pred CCCCcEEEEECCcccccccCCCC-cccCCcchHHHHHhCccccccC---------------------cceEEEEECCccC
Confidence 45789999999999999866544 7775444457777777653111 1135677887768
Q ss_pred CCCCCCHHHHHHHHHHHHHHhcCcCeEEEEcCcccHHHHHHHHHHHHhcCCCcEEEeccCCCCCCCCChHHHHHHHHHHH
Q psy9757 152 DSSNMCQVHWIKIANDIKEYYESYDGFVILHGTDTLSYTASALSFMLENLGKPVIVTGSQISIFQIRSDGVHNFIGALIL 231 (659)
Q Consensus 152 dS~~~~~~~~~~l~~~i~~~~~~~~g~vv~hGTdt~~~ta~~l~~~~~~~~~pvv~tga~~p~~~~~~Dg~~Nl~~a~~~ 231 (659)
||++|||++|.+|++.|++.+++||||||||||||||||||||+|++.+++|||||||||||++.+++||+.||++||.+
T Consensus 79 dSs~mt~~~w~~la~~I~~~~~~~dG~VItHGTDTmeeTA~~Ls~~l~~~~kPVVlTGAmrP~~~~~sDg~~NL~~Av~~ 158 (358)
T 2him_A 79 DSSDMTPEDWQHIAEDIKAHYDDYDGFVILHGTDTMAYTASALSFMLENLGKPVIVTGSQIPLAELRSDGQINLLNALYV 158 (358)
T ss_dssp CGGGCCHHHHHHHHHHHHHHGGGCSEEEEECCSTTHHHHHHHHHHHEETCCSCEEEECCSSCTTSTTCSHHHHHHHHHHH
T ss_pred CcccCCHHHHHHHHHHHHHHHhcCCeEEEecCchHHHHHHHHHHHHHhcCCCCEEEeCCCCCCcCCCcchHHHHHHHHHH
Confidence 99999999999999999999989999999999999999999999999889999999999999999999999999999999
Q ss_pred HcCCCCCeEEEEeCCeeeecCceEeccCCCCCCCCCCCCcccEEEeeeeEEecccccccCCCCCccccCCCCCcEEEEEe
Q psy9757 232 AGNYDIPEVTVYFNHKLIRGNRTVKMSVKEFDAFDSPNFPNLAKVGLTIDVNMKSIFRSSTIKKFDVQSQLNLNVGILRI 311 (659)
Q Consensus 232 a~~~~~~gv~v~~~~~i~~~~~~~k~~~~~~~aF~sp~~~~lg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~V~il~~ 311 (659)
|+++..+||+|||||+||+|+|++|+|+.+++||.|||+||||+++.++.+.+....+ .+..+|.+.....++|+|+++
T Consensus 159 A~~~~~~GV~V~fn~~i~~a~~v~K~~t~~~daF~S~~~gplg~v~~~v~~~~~~~~~-~~~~~~~~~~~~~~~V~il~~ 237 (358)
T 2him_A 159 AANYPINEVTLFFNNRLYRGNRTAKAHADGFDAFASPNLPPLLEAGIHIRRLNTPPAP-HGEGELIVHPITPQPIGVVTI 237 (358)
T ss_dssp HHHSCCSSEEEEETTEEEEGGGCEECBTTSSSCEECTTSCCSEEESSSEEECCCCCCC-CCCSSCEECCCCCCCEEEEEC
T ss_pred HhCCCCCCeEEEECCEEeecCcEEEcccCCcccccCCCCCceEEEeceEEEecccccc-CCCCcccccccCCCcEEEEEe
Confidence 9998889999999999999999999999999999999999999998765544333222 233567766667899999999
Q ss_pred CCCCCHHHHHHhHhCCCcEEEEEecCCCCCCCCchHHHHHHHHHHhCCCeEEEeccCCCCCcC-Cchhhhhhhhcccccc
Q psy9757 312 YPHISNHTVRSFMQSPMEGVILLTYGSGNFPSNRSDLIDELRLASDRNVIIVNCSQCSRGGTS-DTYEAGKILSGIGVIN 390 (659)
Q Consensus 312 ~pg~~~~~l~~~~~~~~~giVl~~~G~G~~p~~~~~~~~~l~~a~~~gi~vV~~sq~~~G~v~-~~y~~g~~L~~~G~i~ 390 (659)
|||+++++++++++.|++|||||+||+||+|. .+++.++|++|.++|++||++|||..|.|. +.|+.|.+|.+.|+|+
T Consensus 238 ~pG~~~~~l~a~~~~g~~GiVle~~G~Gn~p~-~~~~~~~l~~a~~~Gi~VV~~Src~~G~v~~~~Y~~g~~l~~~GvI~ 316 (358)
T 2him_A 238 YPGISADVVRNFLRQPVKALILRSYGVGNAPQ-NKAFLQELQEASDRGIVVVNLTQCMSGKVNMGGYATGNALAHAGVIG 316 (358)
T ss_dssp CTTCCHHHHHHHTSSSCSEEEEEEBTTTBCCC-CHHHHHHHHHHHHTTCEEEEEESSSBCCCCCC-----CHHHHTTCEE
T ss_pred CCCCCHHHHHHHHhCCCCEEEEecCCCCCCCC-cHHHHHHHHHHHHCCCEEEEEcCCCCCCCCccchhhhhHHhhCCEEE
Confidence 99999999999999999999999999999994 458999999999999999999999999998 8999999999999999
Q ss_pred cCCCCHHHHHHHHHHhhhcccchhhhhhhhhhccccCCCcc
Q psy9757 391 GYDMTPEAALTKLSYVLSKSELTLQQKKDIMMTNIRGELST 431 (659)
Q Consensus 391 ~~dmt~e~a~~kL~~~l~k~~~~~~~vk~l~~~~l~gelt~ 431 (659)
++||++++|++||+|+|++ ..+.++++++|.++++||++.
T Consensus 317 ~~dlt~ekAr~kL~~~L~~-~~~~~~i~~~f~~~l~gE~~~ 356 (358)
T 2him_A 317 GADMTVEATLTKLHYLLSQ-ELDTETIRKAMSQNLRGELTP 356 (358)
T ss_dssp CTTCCHHHHHHHHHHHHHS-SCCHHHHHHHHTSCSSSSSCC
T ss_pred CCCCCHHHHHHHHHHHHhC-CCCHHHHHHHHHhhccCCcCC
Confidence 9999999999999999999 579999999999999999874
|
| >1wls_A L-asparaginase; structural genomics, hydrolase; 2.16A {Pyrococcus horikoshii} PDB: 1wnf_A | Back alignment and structure |
|---|
| >1zq1_A Glutamyl-tRNA(Gln) amidotransferase subunit D; X-RAY, 3D structure, asparaginase 1 family, GATD subfamily, lyase; 3.00A {Pyrococcus abyssi} SCOP: b.38.3.1 c.88.1.1 | Back alignment and structure |
|---|
| >2d6f_A Glutamyl-tRNA(Gln) amidotransferase subunit D; ligase, ligase/RNA complex; 3.15A {Methanothermobacterthermautotrophicus} SCOP: b.38.3.1 c.88.1.1 | Back alignment and structure |
|---|
| >1nns_A L-asparaginase II; amidrohydrolase, crystallographic comparison hydrolase; 1.95A {Escherichia coli} SCOP: c.88.1.1 PDB: 3eca_A 1ho3_A 1jaz_A 1ihd_A 1jja_A 4eca_A* | Back alignment and structure |
|---|
| >2wlt_A L-asparaginase; hydrolase; 1.40A {Helicobacter pylori} PDB: 2wt4_A | Back alignment and structure |
|---|
| >1wsa_A Asparaginase, asparagine amidohydrolase; periplasmic; 2.20A {Wolinella succinogenes} SCOP: c.88.1.1 | Back alignment and structure |
|---|
| >1agx_A Glutaminase-asparaginase; bacterial amidohydrolase; 2.90A {Acinetobacter glutaminasificans} SCOP: c.88.1.1 | Back alignment and structure |
|---|
| >4pga_A Glutaminase-asparaginase; bacterial amidohydrolase; 1.70A {Pseudomonas SP} SCOP: c.88.1.1 PDB: 1djp_A* 1djo_A* 3pga_1 | Back alignment and structure |
|---|
| >3nxk_A Cytoplasmic L-asparaginase; structural genomics, center for structural genomics of infec diseases, csgid, alpha-beta-alpha sandwich; 2.40A {Campylobacter jejuni subsp} | Back alignment and structure |
|---|
| >1o7j_A L-asparaginase; atomic resolution, hydrolase; 1.0A {Erwinia chrysanthemi} SCOP: c.88.1.1 PDB: 1hfj_A 1hfk_A* 1hg0_A 1hg1_A 1hfw_A* 1jsr_A* 1jsl_A 2gvn_A 1zcf_A 2hln_A* 2jk0_A | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >1yyh_A HN1;, notch 1, ankyrin domain; ankyrin repeats, cell cycle,transcription; 1.90A {Homo sapiens} PDB: 2he0_A 2f8x_K 3nbn_B 3v79_K* 1ot8_A | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >1wdy_A 2-5A-dependent ribonuclease; hydrolase, RNA-binding; HET: 25A; 1.80A {Homo sapiens} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1k1a_A B-cell lymphoma 3-encoded protein; BCL-3, NF-kappab transcription factors, ikappab proteins; 1.86A {Homo sapiens} SCOP: d.211.1.1 PDB: 1k1b_A | Back alignment and structure |
|---|
| >3aji_A 26S proteasome non-ATPase regulatory subunit 10; gankyrin, S6 ATPase, P-benzoyl-L-phenylalanine, PBPA, amber suppression; HET: PBF; 2.05A {Mus musculus} PDB: 2dvw_A 2dwz_A* 1tr4_A 1uoh_A 1qym_A | Back alignment and structure |
|---|
| >4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A | Back alignment and structure |
|---|
| >4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E | Back alignment and structure |
|---|
| >4b93_B Ankyrin repeat domain-containing protein 27; endocytosis, exocytosis, snare; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} | Back alignment and structure |
|---|
| >4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* | Back alignment and structure |
|---|
| >4gpm_A Engineered protein OR264; de novo protein, structural genomics, PSI-biology, northeast structural genomics consortium, NESG; 2.00A {Synthetic construct} PDB: 4gmr_A | Back alignment and structure |
|---|
| >3b7b_A Euchromatic histone-lysine N-methyltransferase 1; ankyrin repeat, alternative splicing, ANK repeat, chromatin regulator, nucleus, phosphorylation; 2.99A {Homo sapiens} SCOP: k.37.1.1 PDB: 3b95_A* | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A | Back alignment and structure |
|---|
| >2dzn_A Probable 26S proteasome regulatory subunit P28; ankyrin repeats, A-helical domain, structural genomics, NPPSFA; 2.20A {Saccharomyces cerevisiae} SCOP: d.211.1.1 PDB: 2dzo_A 1ixv_A 1wg0_A | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} | Back alignment and structure |
|---|
| >3d9h_A CDNA FLJ77766, highly similar to HOMO sapiens ankyrin repeat and SOCS box-containing...; ASB9, ANK repeat, L-shaped, structural protein; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >1oy3_D Transcription factor inhibitor I-kappa-B-beta; protein-protein complex, transcription factors, nuclear localization, DNA binding protein; 2.05A {Mus musculus} SCOP: d.211.1.1 PDB: 1k3z_D | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* | Back alignment and structure |
|---|
| >4g8k_A 2-5A-dependent ribonuclease; ankyrin-repeat domain, single-stranded RNA, hydrolase; 2.40A {Homo sapiens} PDB: 4g8l_A* | Back alignment and structure |
|---|
| >1n11_A Ankyrin; clathrin, BAND 3, anion exchanger, structural protein; 2.70A {Homo sapiens} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >2f8y_A Notch homolog 1, translocation-associated (drosophila); ankyrin repeats, transcription; 1.55A {Homo sapiens} PDB: 2qc9_A 1ymp_A | Back alignment and structure |
|---|
| >2fo1_E LIN-12 protein; beta-barrel, protein-DNA complex, double helix, ankyrin repeat, gene regulation/signalling protein/DNA complex; 3.12A {Caenorhabditis elegans} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* | Back alignment and structure |
|---|
| >3utm_A Tankyrase-1; tankyrase, TNKS, ankryin repeat clusters, WNT signaling, POL ribosylation, transferase-signaling protein complex; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >3eu9_A Huntingtin-interacting protein 14; epigenetics, ankyrin repeats, methyllyine binding, huntingti interacting protein 14, acyltransferase, ANK repeat; HET: HIS; 1.99A {Homo sapiens} | Back alignment and structure |
|---|
| >1s70_B 130 kDa myosin-binding subunit of smooth muscle myosin phophatase (M130), serine/threonine protein phosphatase PP1-beta (OR delta) catalytic subunit; myosin phosphatase; HET: PGE; 2.70A {Gallus gallus} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} | Back alignment and structure |
|---|
| >3kea_A K1L; tropism, ANK repeat, viral protein; 2.30A {Vaccinia virus} | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >3ljn_A Hypothetical protein; ankyrin, structural genomics, PSI, structural genomics of pathogenic protozoa consortium, SGPP, ANK repeat; 2.90A {Leishmania major} | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A | Back alignment and structure |
|---|
| >1ihb_A P18-INK4C(INK6), cyclin-dependent kinase 6 inhibitor; cell cycle inhibitor, ankyrin repeat, CDK 4/6 inhibitor; 1.95A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bu9_A 1g3n_B 1mx4_A 1mx2_A 1mx6_A | Back alignment and structure |
|---|
| >2y1l_E Darpin-8.4; hydrolase-inhibitor complex, DEVD darpin, ankyrin repeat Pro ribosome display, apoptosis; 1.80A {Synthetic source} PDB: 3noc_D* 4dx5_D* 2j8s_D* 4dx6_D* 4dx7_D* 3nog_D* 1mj0_A 1svx_A 2qyj_A 2bkg_A 2p2c_P 2bkk_B* 2v5q_C 2xee_A 2xeh_A 3q9n_C* 3q9u_C* | Back alignment and structure |
|---|
| >3v30_A DNA-binding protein rfxank; structural genomics consortium, SGC, rfxank, ANK repeat, Pro binding; 1.57A {Homo sapiens} PDB: 3uxg_A | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >3v31_A Ankyrin repeat family A protein 2; structural genomics consortium, SGC, ankra2, ANK repeat, Pro binding, HDAC4; 1.57A {Homo sapiens} PDB: 3v2x_A 3v2o_A 3so8_A | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >2rfm_A Putative ankyrin repeat protein TV1425; ANK repeat, protein binding; HET: BU2 GOL; 1.65A {Thermoplasma volcanium} | Back alignment and structure |
|---|
| >1sw6_A Regulatory protein SWI6; transcription regulation, ankyrin repeats, cell-cycle; 2.10A {Saccharomyces cerevisiae} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >2rfa_A Transient receptor potential cation channel subfa member 6; TRPV6, ankyrin reapeat, ANK RE calcium channel, calcium transport, calmodulin-binding; 1.70A {Mus musculus} | Back alignment and structure |
|---|
| >3hra_A Ankyrin repeat family protein; structural protein; 1.69A {Enterococcus faecalis} | Back alignment and structure |
|---|
| >1ikn_D Protein (I-kappa-B-alpha), protein (NF-kappa-B P50D subunit); transcription factor, IKB/NFKB complex; 2.30A {Homo sapiens} SCOP: d.211.1.1 PDB: 1nfi_E | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A | Back alignment and structure |
|---|
| >2pnn_A Transient receptor potential cation channel subfa member 1; TRPV1, ankyrin repeat domain, transport protein; HET: ATP; 2.70A {Rattus norvegicus} PDB: 2nyj_A* | Back alignment and structure |
|---|
| >3f6q_A Integrin-linked protein kinase; ILK, integrin-linked kinase, pinch, ankyrin repeat, ANK, IPP; 1.60A {Homo sapiens} PDB: 3ixe_A 2kbx_A | Back alignment and structure |
|---|
| >1awc_B Protein (GA binding protein beta 1); complex (transcription regulation/DNA), DNA-binding, nuclear protein, ETS domain, ankyrin repeats; HET: DNA BRU CBR; 2.15A {Mus musculus} SCOP: d.211.1.1 | Back alignment and structure |
|---|
| >2etb_A Transient receptor potential cation channel subfamily V member 2; TRPV2, ankyrin repeat domain, transport protein; 1.65A {Rattus norvegicus} PDB: 2eta_A 2etc_A 2f37_A | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B | Back alignment and structure |
|---|
| >3twr_A Tankyrase-2; ankyrin repeat, protein-protein interaction, substrate recru poly(ADP-ribosyl)ation; HET: PE8; 1.55A {Homo sapiens} SCOP: d.211.1.0 PDB: 3tws_A* 3twt_A* 3twv_A* 3tww_A 3twx_A 3twq_A 3twu_A 2y0i_S* | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1bd8_A P19INK4D CDK4/6 inhibitor; tumor suppressor, ankyrin motif; 1.80A {Homo sapiens} SCOP: d.211.1.1 PDB: 1bi8_B 1ap7_A 1blx_B | Back alignment and structure |
|---|
| >3jxi_A Vanilloid receptor-related osmotically activated protein; ankyrin repeats, ANK repeat, ION transport, ionic channel, R transmembrane, transport; 2.30A {Gallus gallus} PDB: 3jxj_A 4dx1_A 4dx2_A* | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B | Back alignment and structure |
|---|
| >4hbd_A KN motif and ankyrin repeat domain-containing Pro; structural genomics consortium, SGC, protein binding; 1.72A {Homo sapiens} | Back alignment and structure |
|---|
| >1ycs_B 53BP2, P53BP2; ankyrin repeats, SH3, tumor suppressor, multigene family, nuclear protein, phosphorylation, disease mutation, polymorphism; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.211.1.1 PDB: 4a63_B | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A | Back alignment and structure |
|---|
| >1d9s_A Cyclin-dependent kinase 4 inhibitor B; helix-turn-helix, ankyrin repeat, signaling protein; NMR {Mus musculus} SCOP: i.11.1.1 | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} | Back alignment and structure |
|---|
| >3t8k_A Uncharacterized protein; structural genomics, PSI-biology, protein structure initiati midwest center F or structural genomics, MCSG; 1.77A {Leptotrichia buccalis} | Back alignment and structure |
|---|
| >2vge_A RELA-associated inhibitor; iaspp, nucleus, apoptosis, repressor, cytoplasm, phosphorylation, P53 binding protein, ANK repeat, SH3 domain; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >1bi7_B P16INK4A, MTS1, multiple tumor suppressor; cyclin dependent kinase, cyclin dependent kinase inhibitory protein, CDK, cell cycle; 3.40A {Homo sapiens} SCOP: d.211.1.1 PDB: 1a5e_A 1dc2_A 2a5e_A | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C | Back alignment and structure |
|---|
| >1n0r_A 4ANK, 4 ankyrin repeats; structural protein; 1.50A {} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A | Back alignment and structure |
|---|
| >2jab_A H10-2-G3; HER2, darpin, ankyrin repeat protein, membrane protein, human epidermal growth factor receptor 2, de novo protein; 1.70A {} PDB: 3hg0_D 2xzt_G 2xzd_G 2y0b_G 2v4h_C | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 | Back alignment and structure |
|---|
| >3c5r_A BARD-1, BRCA1-associated ring domain protein 1; ankyrin repeat, helix, extended loop, four repeat, PR ANK repeat, disease mutation, metal-binding; 2.00A {Homo sapiens} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >2aja_A Ankyrin repeat family protein; NESG, Q5ZSV0, structural genomics, PSI, protein structure initiative; 2.80A {Legionella pneumophila} SCOP: a.118.24.1 | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A | Back alignment and structure |
|---|
| >3deo_A Signal recognition particle 43 kDa protein; chloroplast SRP system, signal sequence, ankyrin repeat, chromodomain, type I turn; 1.50A {Arabidopsis thaliana} SCOP: b.34.13.2 k.37.1.1 PDB: 3dep_A 1x32_A | Back alignment and structure |
|---|
| >3ui2_A Signal recognition particle 43 kDa protein, chlor; ankyrin repeat, chromodomain, aromatic CAGE, signal recognit particle, protein targeting; 3.18A {Arabidopsis thaliana} PDB: 1x3q_A 2hug_A | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A | Back alignment and structure |
|---|
| >2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} | Back alignment and structure |
|---|
| >2b0o_E UPLC1; arfgap, structural genomics, structural genomics consortium, SGC, metal binding protein; 2.06A {Homo sapiens} | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A | Back alignment and structure |
|---|
| >3aaa_C Myotrophin, protein V-1; actin capping protein, barbed END capping, inhibition, prote binding, actin capping, actin-binding, cytoskeleton, ANK RE; 2.20A {Homo sapiens} PDB: 1myo_A 2kxp_C 2myo_A | Back alignment and structure |
|---|
| >3ehr_A Osteoclast-stimulating factor 1; beta barrel, helix-turn-helix, SH3, ankyrin repeat, signaling protein, ANK repeat, cytoplasm, phosphoprotein; 1.95A {Homo sapiens} PDB: 3ehq_A | Back alignment and structure |
|---|
| >3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A | Back alignment and structure |
|---|
| >1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 | Back alignment and structure |
|---|
| >3jue_A Arfgap with coiled-coil, ANK repeat and PH domain containing protein 1; arfgap domain, zinc-binding module, GTPase activ metal-binding, nitration; 2.30A {Homo sapiens} PDB: 3t9k_A 4f1p_A | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >1n0q_A 3ANK, 3 ankyrin repeats; structural protein; 1.26A {} SCOP: k.37.1.1 | Back alignment and structure |
|---|
| >1dcq_A PYK2-associated protein beta; zinc-binding module, ankyrin repeats, metal binding protein; 2.10A {Mus musculus} SCOP: d.211.1.1 g.45.1.1 | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >2l6b_A NR1C; ankyrin, consensus, repeat protein, ising model, DE NOV; NMR {Escherichia coli} | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A | Back alignment and structure |
|---|
| >2zgd_A 3 repeat synthetic ankyrin; ankyrin repeat, hydroxylated, de novo protein; 1.90A {Synthetic} PDB: 2zgg_A 2xen_A | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 659 | ||||
| d2ocda1 | 336 | c.88.1.1 (A:2-337) Asparaginase type II {Vibrio ch | 2e-91 | |
| d2d6fa2 | 352 | c.88.1.1 (A:84-435) Glutamyl-tRNA(Gln) amidotransf | 1e-79 | |
| d1zq1a2 | 363 | c.88.1.1 (A:76-438) Glutamyl-tRNA(Gln) amidotransf | 8e-76 | |
| d1wsaa_ | 328 | c.88.1.1 (A:) Asparaginase type II {Wolinella succ | 1e-71 | |
| d1nnsa_ | 326 | c.88.1.1 (A:) Asparaginase type II {Escherichia co | 5e-68 | |
| d1o7ja_ | 325 | c.88.1.1 (A:) Asparaginase type II {Erwinia chrysa | 6e-67 | |
| d1agxa_ | 331 | c.88.1.1 (A:) Glutaminase-asparaginase {Acinetobac | 2e-64 | |
| d4pgaa_ | 330 | c.88.1.1 (A:) Glutaminase-asparaginase {Pseudomona | 6e-63 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 9e-27 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 5e-23 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 4e-19 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 7e-19 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 3e-17 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 2e-15 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 5e-12 | |
| d1n11a_ | 408 | d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [Ta | 1e-07 | |
| d1uoha_ | 223 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 1e-18 | |
| d1sw6a_ | 301 | d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker | 2e-17 | |
| d1sw6a_ | 301 | d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker | 2e-09 | |
| d1sw6a_ | 301 | d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker | 2e-06 | |
| d1sw6a_ | 301 | d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker | 4e-04 | |
| d1wdya_ | 285 | d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas | 8e-17 | |
| d1wdya_ | 285 | d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas | 2e-15 | |
| d1wdya_ | 285 | d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas | 2e-14 | |
| d1wdya_ | 285 | d.211.1.1 (A:) RNase L, 2-5a-dependent ribonucleas | 2e-12 | |
| d1s70b_ | 291 | d.211.1.1 (B:) Myosin phosphatase targeting subuni | 2e-12 | |
| d1s70b_ | 291 | d.211.1.1 (B:) Myosin phosphatase targeting subuni | 5e-11 | |
| d1s70b_ | 291 | d.211.1.1 (B:) Myosin phosphatase targeting subuni | 4e-09 | |
| d2fo1e1 | 277 | d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele | 2e-12 | |
| d2fo1e1 | 277 | d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele | 3e-10 | |
| d2fo1e1 | 277 | d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele | 1e-08 | |
| d2fo1e1 | 277 | d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele | 2e-05 | |
| d2fo1e1 | 277 | d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele | 2e-04 | |
| d2fo1e1 | 277 | d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis ele | 6e-04 | |
| d1bi7b_ | 125 | d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Huma | 9e-12 | |
| d1dcqa1 | 154 | d.211.1.1 (A:369-522) Pyk2-associated protein beta | 2e-11 | |
| d1dcqa1 | 154 | d.211.1.1 (A:369-522) Pyk2-associated protein beta | 9e-08 | |
| d1ixva_ | 229 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 3e-11 | |
| d1ixva_ | 229 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 1e-08 | |
| d1ixva_ | 229 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 1e-05 | |
| d1ixva_ | 229 | d.211.1.1 (A:) 26S proteasome non-ATPase regulator | 1e-04 | |
| d2ajaa1 | 346 | a.118.24.1 (A:3-348) Hypothetical protein LPG2416 | 1e-10 | |
| d2ajaa1 | 346 | a.118.24.1 (A:3-348) Hypothetical protein LPG2416 | 5e-09 | |
| d2ajaa1 | 346 | a.118.24.1 (A:3-348) Hypothetical protein LPG2416 | 3e-08 | |
| d2ajaa1 | 346 | a.118.24.1 (A:3-348) Hypothetical protein LPG2416 | 2e-07 | |
| d1awcb_ | 153 | d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { | 1e-10 | |
| d1awcb_ | 153 | d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { | 5e-10 | |
| d1awcb_ | 153 | d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 { | 1e-07 | |
| d1oy3d_ | 255 | d.211.1.1 (D:) Transcription factor inhibitor I-ka | 3e-10 | |
| d1oy3d_ | 255 | d.211.1.1 (D:) Transcription factor inhibitor I-ka | 2e-08 | |
| d1oy3d_ | 255 | d.211.1.1 (D:) Transcription factor inhibitor I-ka | 3e-08 | |
| d1oy3d_ | 255 | d.211.1.1 (D:) Transcription factor inhibitor I-ka | 7e-08 | |
| d1oy3d_ | 255 | d.211.1.1 (D:) Transcription factor inhibitor I-ka | 5e-06 | |
| d1ot8a_ | 209 | d.211.1.1 (A:) Neurogenic locus notch receptor dom | 5e-10 | |
| d1ot8a_ | 209 | d.211.1.1 (A:) Neurogenic locus notch receptor dom | 8e-09 | |
| d1ot8a_ | 209 | d.211.1.1 (A:) Neurogenic locus notch receptor dom | 4e-05 | |
| d1k1aa_ | 228 | d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: | 5e-10 | |
| d1k1aa_ | 228 | d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: | 4e-06 | |
| d1k1aa_ | 228 | d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: | 3e-05 | |
| d1ihba_ | 156 | d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens | 5e-10 | |
| d1bd8a_ | 156 | d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma | 7e-10 | |
| d1bd8a_ | 156 | d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Huma | 3e-08 | |
| d1ycsb1 | 130 | d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) | 2e-09 | |
| d1ycsb1 | 130 | d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) | 0.002 | |
| d1iknd_ | 221 | d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien | 3e-09 | |
| d1iknd_ | 221 | d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapien | 2e-07 | |
| d1myoa_ | 118 | d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) | 5e-06 |
| >d2ocda1 c.88.1.1 (A:2-337) Asparaginase type II {Vibrio cholerae [TaxId: 666]} Length = 336 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Glutaminase/Asparaginase superfamily: Glutaminase/Asparaginase family: Glutaminase/Asparaginase domain: Asparaginase type II species: Vibrio cholerae [TaxId: 666]
Score = 284 bits (728), Expect = 2e-91
Identities = 149/356 (41%), Positives = 212/356 (59%), Gaps = 25/356 (7%)
Query: 76 KVLVLYTGGTIGMEDNEQGALAPSSKPLTDKIRENPLLYDRHYDVCKTQDGNVLVLPRVK 135
+ + YTGGTIGM+ ++ G + + + + +P
Sbjct: 4 HIYIAYTGGTIGMKKSDHGYVPVAG----------------------FMEKQLASMPEFH 41
Query: 136 DTRRVLYKVVEYTPLLDSSNMCQVHWIKIANDIKEYYESYDGFVILHGTDTLSYTASALS 195
L+ + EY PL+DSS+M W IA+DI Y+ YDGFVILHGTDT++YTASALS
Sbjct: 42 RPEMPLFTIHEYDPLMDSSDMTPADWQLIADDIAANYDKYDGFVILHGTDTMAYTASALS 101
Query: 196 FMLENLGKPVIVTGSQISIFQIRSDGVHNFIGALILAGNYDIPEVTVYFNHKLIRGNRTV 255
FM ENLGKPVIVTGSQI + +RSDG N + AL +A NY I EVT++FN++L+RGNR+
Sbjct: 102 FMFENLGKPVIVTGSQIPLADLRSDGQANLLNALHVAANYPINEVTLFFNNRLMRGNRSR 161
Query: 256 KMSVKEFDAFDSPNFPNLAKVGLTIDVNMKSIFRSSTIKKFDVQSQLNLNVGILRIYPHI 315
K F AF SPN P L + G+ I+++ +F V +G++ +YP I
Sbjct: 162 KSHADGFSAFSSPNLPPLLEAGINIELSTNVKVDEKPSGEFKVNPITPQPIGVITMYPGI 221
Query: 316 SNHTVRSFMQSPMEGVILLTYGSGNFPSNRSDLIDELRLASDRNVIIVNCSQCSRGGTS- 374
S+ +R+ + P+ +ILLT+G GN P N +L+ +L+ AS+R VI+VN +QC G +
Sbjct: 222 SHEVIRNTLLQPVNAMILLTFGVGNAPQNP-ELLAQLKAASERGVIVVNLTQCLAGKVNM 280
Query: 375 DTYEAGKILSGIGVINGYDMTPEAALTKLSYVLSKSELTLQQKKDIMMTNIRGELS 430
Y G L+ GVI+GYDMTPEAAL KL Y+LS+ L+ ++ K M +RGE++
Sbjct: 281 GGYATGCALADAGVISGYDMTPEAALAKLHYLLSQ-NLSYEEVKAKMQQVLRGEMT 335
|
| >d2d6fa2 c.88.1.1 (A:84-435) Glutamyl-tRNA(Gln) amidotransferase subunit D, GatD {Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 352 | Back information, alignment and structure |
|---|
| >d1zq1a2 c.88.1.1 (A:76-438) Glutamyl-tRNA(Gln) amidotransferase subunit D, GatD {Pyrococcus abyssi [TaxId: 29292]} Length = 363 | Back information, alignment and structure |
|---|
| >d1wsaa_ c.88.1.1 (A:) Asparaginase type II {Wolinella succinogenes [TaxId: 844]} Length = 328 | Back information, alignment and structure |
|---|
| >d1nnsa_ c.88.1.1 (A:) Asparaginase type II {Escherichia coli [TaxId: 562]} Length = 326 | Back information, alignment and structure |
|---|
| >d1o7ja_ c.88.1.1 (A:) Asparaginase type II {Erwinia chrysanthemi [TaxId: 556]} Length = 325 | Back information, alignment and structure |
|---|
| >d1agxa_ c.88.1.1 (A:) Glutaminase-asparaginase {Acinetobacter glutaminasificans [TaxId: 474]} Length = 331 | Back information, alignment and structure |
|---|
| >d4pgaa_ c.88.1.1 (A:) Glutaminase-asparaginase {Pseudomonas sp., 7A [TaxId: 306]} Length = 330 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} Length = 408 | Back information, alignment and structure |
|---|
| >d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} Length = 223 | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 301 | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} Length = 285 | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} Length = 291 | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} Length = 277 | Back information, alignment and structure |
|---|
| >d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} Length = 125 | Back information, alignment and structure |
|---|
| >d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 | Back information, alignment and structure |
|---|
| >d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} Length = 154 | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 229 | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} Length = 346 | Back information, alignment and structure |
|---|
| >d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 | Back information, alignment and structure |
|---|
| >d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 | Back information, alignment and structure |
|---|
| >d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} Length = 153 | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} Length = 255 | Back information, alignment and structure |
|---|
| >d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 | Back information, alignment and structure |
|---|
| >d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 | Back information, alignment and structure |
|---|
| >d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 209 | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 228 | Back information, alignment and structure |
|---|
| >d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
| >d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
| >d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} Length = 156 | Back information, alignment and structure |
|---|
| >d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 | Back information, alignment and structure |
|---|
| >d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} Length = 130 | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 221 | Back information, alignment and structure |
|---|
| >d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 118 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 659 | |||
| d2ocda1 | 336 | Asparaginase type II {Vibrio cholerae [TaxId: 666] | 100.0 | |
| d1zq1a2 | 363 | Glutamyl-tRNA(Gln) amidotransferase subunit D, Gat | 100.0 | |
| d2d6fa2 | 352 | Glutamyl-tRNA(Gln) amidotransferase subunit D, Gat | 100.0 | |
| d1nnsa_ | 326 | Asparaginase type II {Escherichia coli [TaxId: 562 | 100.0 | |
| d1wsaa_ | 328 | Asparaginase type II {Wolinella succinogenes [TaxI | 100.0 | |
| d1o7ja_ | 325 | Asparaginase type II {Erwinia chrysanthemi [TaxId: | 100.0 | |
| d4pgaa_ | 330 | Glutaminase-asparaginase {Pseudomonas sp., 7A [Tax | 100.0 | |
| d1agxa_ | 331 | Glutaminase-asparaginase {Acinetobacter glutaminas | 100.0 | |
| d1oy3d_ | 255 | Transcription factor inhibitor I-kappa-B-beta, IKB | 100.0 | |
| d1uoha_ | 223 | 26S proteasome non-ATPase regulatory subunit 10, g | 100.0 | |
| d1uoha_ | 223 | 26S proteasome non-ATPase regulatory subunit 10, g | 99.97 | |
| d2fo1e1 | 277 | Lin-12 {Caenorhabditis elegans [TaxId: 6239]} | 99.97 | |
| d1ixva_ | 229 | 26S proteasome non-ATPase regulatory subunit 10, g | 99.97 | |
| d1iknd_ | 221 | I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 | 99.96 | |
| d1wdya_ | 285 | RNase L, 2-5a-dependent ribonuclease {Human (Homo | 99.96 | |
| d1n11a_ | 408 | Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} | 99.96 | |
| d1s70b_ | 291 | Myosin phosphatase targeting subunit 1, MYPT1 {Chi | 99.96 | |
| d1k1aa_ | 228 | bcl-3 {Human (Homo sapiens) [TaxId: 9606]} | 99.95 | |
| d1ot8a_ | 209 | Neurogenic locus notch receptor domain {Fruit fly | 99.95 | |
| d1oy3d_ | 255 | Transcription factor inhibitor I-kappa-B-beta, IKB | 99.95 | |
| d1n11a_ | 408 | Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} | 99.95 | |
| d1ihba_ | 156 | p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] | 99.95 | |
| d1ihba_ | 156 | p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606] | 99.94 | |
| d1s70b_ | 291 | Myosin phosphatase targeting subunit 1, MYPT1 {Chi | 99.94 | |
| d1awcb_ | 153 | GA bindinig protein (GABP) beta 1 {Mouse (Mus musc | 99.94 | |
| d1bd8a_ | 156 | Cell cycle inhibitor p19ink4D {Human (Homo sapiens | 99.94 | |
| d1bd8a_ | 156 | Cell cycle inhibitor p19ink4D {Human (Homo sapiens | 99.93 | |
| d2fo1e1 | 277 | Lin-12 {Caenorhabditis elegans [TaxId: 6239]} | 99.93 | |
| d1awcb_ | 153 | GA bindinig protein (GABP) beta 1 {Mouse (Mus musc | 99.92 | |
| d2ajaa1 | 346 | Hypothetical protein LPG2416 {Legionella pneumophi | 99.92 | |
| d1wdya_ | 285 | RNase L, 2-5a-dependent ribonuclease {Human (Homo | 99.92 | |
| d1ixva_ | 229 | 26S proteasome non-ATPase regulatory subunit 10, g | 99.92 | |
| d1ot8a_ | 209 | Neurogenic locus notch receptor domain {Fruit fly | 99.91 | |
| d1iknd_ | 221 | I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606 | 99.91 | |
| d1k1aa_ | 228 | bcl-3 {Human (Homo sapiens) [TaxId: 9606]} | 99.9 | |
| d1bi7b_ | 125 | Cell cycle inhibitor p16ink4A {Human (Homo sapiens | 99.89 | |
| d1sw6a_ | 301 | Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch | 99.89 | |
| d1bi7b_ | 125 | Cell cycle inhibitor p16ink4A {Human (Homo sapiens | 99.88 | |
| d1myoa_ | 118 | Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] | 99.87 | |
| d1ycsb1 | 130 | 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | 99.86 | |
| d1myoa_ | 118 | Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116] | 99.86 | |
| d1ycsb1 | 130 | 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | 99.86 | |
| d1dcqa1 | 154 | Pyk2-associated protein beta {Mouse (Mus musculus) | 99.82 | |
| d2ajaa1 | 346 | Hypothetical protein LPG2416 {Legionella pneumophi | 99.82 | |
| d1dcqa1 | 154 | Pyk2-associated protein beta {Mouse (Mus musculus) | 99.82 | |
| d1sw6a_ | 301 | Swi6 ankyrin-repeat fragment {Baker's yeast (Sacch | 99.81 |
| >d2ocda1 c.88.1.1 (A:2-337) Asparaginase type II {Vibrio cholerae [TaxId: 666]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Glutaminase/Asparaginase superfamily: Glutaminase/Asparaginase family: Glutaminase/Asparaginase domain: Asparaginase type II species: Vibrio cholerae [TaxId: 666]
Probab=100.00 E-value=4.2e-78 Score=635.40 Aligned_cols=334 Identities=44% Similarity=0.778 Sum_probs=297.1
Q ss_pred CCCeEEEEecCCccccccCCCCccccCCCchhhHHhhCCCCcccccccccccCCcccccccccccceeEEEEEEecCCCC
Q psy9757 73 LESKVLVLYTGGTIGMEDNEQGALAPSSKPLTDKIRENPLLYDRHYDVCKTQDGNVLVLPRVKDTRRVLYKVVEYTPLLD 152 (659)
Q Consensus 73 ~~~~i~ii~TGGTI~~~~~~~~~~~~~~~~~~~~l~~~~~l~~~~~~~~~~~~~~~~~~p~~~~~~~~~~~~~~~~~~~d 152 (659)
.+|||+||+|||||||+.++. ++.|......+++..+|++... ....+++.++.+++|
T Consensus 1 ak~~I~vi~TGGTIa~~~~~~-g~~~~~~~~~~~l~~~p~l~~~---------------------~~~~~~v~~~~~~~d 58 (336)
T d2ocda1 1 ARKHIYIAYTGGTIGMKKSDH-GYVPVAGFMEKQLASMPEFHRP---------------------EMPLFTIHEYDPLMD 58 (336)
T ss_dssp CCCEEEEEECCSGGGBCCCC-----CBCTTHHHHHTCCGGGSST---------------------TSCEEEEEECSSCCC
T ss_pred CCCeEEEEEeCCccceeECCC-CccCCCCchHHHHHhCcccccc---------------------cCCceEEEEecCCCC
Confidence 378999999999999986554 4566666778888887765421 112467778888899
Q ss_pred CCCCCHHHHHHHHHHHHHHhcCcCeEEEEcCcccHHHHHHHHHHHHhcCCCcEEEeccCCCCCCCCChHHHHHHHHHHHH
Q psy9757 153 SSNMCQVHWIKIANDIKEYYESYDGFVILHGTDTLSYTASALSFMLENLGKPVIVTGSQISIFQIRSDGVHNFIGALILA 232 (659)
Q Consensus 153 S~~~~~~~~~~l~~~i~~~~~~~~g~vv~hGTdt~~~ta~~l~~~~~~~~~pvv~tga~~p~~~~~~Dg~~Nl~~a~~~a 232 (659)
|++|||++|.+|++.|++.+++||||||||||||||||||||+|++.+++|||||||||||++.+++||+.||.+|+++|
T Consensus 59 S~~~~~~~w~~l~~~i~~~~~~~dGiVItHGTDTleeTA~~L~~~l~~~~kPVVlTGAmrp~~~~~sDg~~NL~~Av~~A 138 (336)
T d2ocda1 59 SSDMTPADWQLIADDIAANYDKYDGFVILHGTDTMAYTASALSFMFENLGKPVIVTGSQIPLADLRSDGQANLLNALHVA 138 (336)
T ss_dssp GGGCCHHHHHHHHHHHHHTTTTCSEEEEECCSTTHHHHHHHHHHHEESCCSCEEEECCSSCTTSTTCTHHHHHHHHHHHH
T ss_pred chhCCHHHHHHHHHHHHHhhccCCCEEEEeCCchHHHHHHHHHHHhcCCCCCEEEecccccccCcCccchhHHHHHHHHh
Confidence 99999999999999999999899999999999999999999999998889999999999999999999999999999999
Q ss_pred cCCCCCeEEEEeCCeeeecCceEeccCCCCCCCCCCCCcccEEEeeeeEEecccccccCCCCCccccCCCCCcEEEEEeC
Q psy9757 233 GNYDIPEVTVYFNHKLIRGNRTVKMSVKEFDAFDSPNFPNLAKVGLTIDVNMKSIFRSSTIKKFDVQSQLNLNVGILRIY 312 (659)
Q Consensus 233 ~~~~~~gv~v~~~~~i~~~~~~~k~~~~~~~aF~sp~~~~lg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~V~il~~~ 312 (659)
+++..+||+||||++||+|++++|+|+.+++||.|||+||||+++.+..+.+....++.+...|.+...++++|+++++|
T Consensus 139 ~~~~~~gv~v~~~~~i~~~~~~~K~~t~~~dAF~Sp~~gpLg~i~~~~~~~~~~~~~~~~~~~~~~~~~~~~~V~il~~~ 218 (336)
T d2ocda1 139 ANYPINEVTLFFNNRLMRGNRSRKSHADGFSAFSSPNLPPLLEAGINIELSTNVKVDEKPSGEFKVNPITPQPIGVITMY 218 (336)
T ss_dssp HHSCCSSEEEEETTEEEEGGGCEEEEESSSCEEECTTSCCSEEESSSEEECTTCCTTCCCSSCCEECCCCCCCEEEEECC
T ss_pred hcccCCceEEEEeeeeecccceeeecccccccccCCCCCceEEEEcceEEeecccccCCCccccccccCCCCcEEEEEeC
Confidence 99888999999999999999999999999999999999999999887776665555555566788777778899999999
Q ss_pred CCCCHHHHHHhHhCCCcEEEEEecCCCCCCCCchHHHHHHHHHHhCCCeEEEeccCCCCCcC-Cchhhhhhhhccccccc
Q psy9757 313 PHISNHTVRSFMQSPMEGVILLTYGSGNFPSNRSDLIDELRLASDRNVIIVNCSQCSRGGTS-DTYEAGKILSGIGVING 391 (659)
Q Consensus 313 pg~~~~~l~~~~~~~~~giVl~~~G~G~~p~~~~~~~~~l~~a~~~gi~vV~~sq~~~G~v~-~~y~~g~~L~~~G~i~~ 391 (659)
||+++++|+++++.|++||||++||+||+|. .+.+.++|+++.++|+|||++|||..|.|. ..|+.|.+|.+.|+|++
T Consensus 219 pG~~~~~l~~~l~~~~~GiVL~~~G~Gn~p~-~~~~~~~l~~a~~~gi~VV~~Src~~G~v~~~~Y~~g~~l~~~GvI~~ 297 (336)
T d2ocda1 219 PGISHEVIRNTLLQPVNAMILLTFGVGNAPQ-NPELLAQLKAASERGVIVVNLTQCLAGKVNMGGYATGCALADAGVISG 297 (336)
T ss_dssp TTCCHHHHHHHTCTTCCEEEEEEBTTTBCCC-CHHHHHHHHHHHHTTCEEEEEESSSEECCCCCC----CHHHHHTCEEC
T ss_pred CCCCHHHHHHHHhcCCCceEEEEecCCCCcC-CHHHHHHHHHHHhcCCEEEEecccCCCccccccccchHHHHhCCEEEC
Confidence 9999999999999999999999999999997 468999999999999999999999999997 78999999999999999
Q ss_pred CCCCHHHHHHHHHHhhhcccchhhhhhhhhhccccCCCc
Q psy9757 392 YDMTPEAALTKLSYVLSKSELTLQQKKDIMMTNIRGELS 430 (659)
Q Consensus 392 ~dmt~e~a~~kL~~~l~k~~~~~~~vk~l~~~~l~gelt 430 (659)
+||++++|++||+|+|++ ..+.++++++|.++++||++
T Consensus 298 ~~lt~ekArvkL~~~L~~-~~~~~~i~~~f~~~l~GE~t 335 (336)
T d2ocda1 298 YDMTPEAALAKLHYLLSQ-NLSYEEVKAKMQQVLRGEMT 335 (336)
T ss_dssp TTCCHHHHHHHHHHHHHT-CCCHHHHHHHHTSCSSSCCC
T ss_pred CCCCHHHHHHHHHHHHcC-CCCHHHHHHHHhhhcCCccc
Confidence 999999999999999999 47999999999999999986
|
| >d1zq1a2 c.88.1.1 (A:76-438) Glutamyl-tRNA(Gln) amidotransferase subunit D, GatD {Pyrococcus abyssi [TaxId: 29292]} | Back information, alignment and structure |
|---|
| >d2d6fa2 c.88.1.1 (A:84-435) Glutamyl-tRNA(Gln) amidotransferase subunit D, GatD {Methanobacterium thermoautotrophicum [TaxId: 145262]} | Back information, alignment and structure |
|---|
| >d1nnsa_ c.88.1.1 (A:) Asparaginase type II {Escherichia coli [TaxId: 562]} | Back information, alignment and structure |
|---|
| >d1wsaa_ c.88.1.1 (A:) Asparaginase type II {Wolinella succinogenes [TaxId: 844]} | Back information, alignment and structure |
|---|
| >d1o7ja_ c.88.1.1 (A:) Asparaginase type II {Erwinia chrysanthemi [TaxId: 556]} | Back information, alignment and structure |
|---|
| >d4pgaa_ c.88.1.1 (A:) Glutaminase-asparaginase {Pseudomonas sp., 7A [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1agxa_ c.88.1.1 (A:) Glutaminase-asparaginase {Acinetobacter glutaminasificans [TaxId: 474]} | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uoha_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1oy3d_ d.211.1.1 (D:) Transcription factor inhibitor I-kappa-B-beta, IKBB {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1n11a_ d.211.1.1 (A:) Ankyrin-R {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ihba_ d.211.1.1 (A:) p18ink4C(ink6) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1s70b_ d.211.1.1 (B:) Myosin phosphatase targeting subunit 1, MYPT1 {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bd8a_ d.211.1.1 (A:) Cell cycle inhibitor p19ink4D {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2fo1e1 d.211.1.1 (E:1021-1297) Lin-12 {Caenorhabditis elegans [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1awcb_ d.211.1.1 (B:) GA bindinig protein (GABP) beta 1 {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} | Back information, alignment and structure |
|---|
| >d1wdya_ d.211.1.1 (A:) RNase L, 2-5a-dependent ribonuclease {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ixva_ d.211.1.1 (A:) 26S proteasome non-ATPase regulatory subunit 10, gankyrin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1ot8a_ d.211.1.1 (A:) Neurogenic locus notch receptor domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1iknd_ d.211.1.1 (D:) I-kappa-B-alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1k1aa_ d.211.1.1 (A:) bcl-3 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1bi7b_ d.211.1.1 (B:) Cell cycle inhibitor p16ink4A {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1myoa_ d.211.1.1 (A:) Myotrophin {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1ycsb1 d.211.1.1 (B:327-456) 53BP2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d2ajaa1 a.118.24.1 (A:3-348) Hypothetical protein LPG2416 {Legionella pneumophila [TaxId: 446]} | Back information, alignment and structure |
|---|
| >d1dcqa1 d.211.1.1 (A:369-522) Pyk2-associated protein beta {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1sw6a_ d.211.1.1 (A:) Swi6 ankyrin-repeat fragment {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|