Psyllid ID: psy9817

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-
MSKITSENRRTSDLIAAKCYFYHSRVHELTNNLDKVRSFLNARLRIATLRNDFEGQAVLINCLLRNYLHYNLYDQADKLVKKSAFPENASNNEWARFHFYLGRIKAVRLEYSTAHKNLVQALRKAPQTAAVGFRQTTQKLAVVVELLLGDIPDRQIFRQAVLRRALSPYFQLTQAVRMGELQKFNEVLTTYGNQFRTDYTFKLILRLRHNVIKTAIRSIGASYSRITPAKI
cccccccHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHcccHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHcccHHHHHHHHHHccHHHHHHHHHHHccHHHHccHHHHHHHHHHHHHHHHHHHHHHHHcccccccc
cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHcccccHHHHccHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHEEEEEcEccHccc
mskitsenrrtsDLIAAKCYFYHSRVHELTNNLDKVRSFLNARLRIATLRNDFEGQAVLINCLLRNYLHYNLYDQADKLvkksafpenasnneWARFHFYLGRIKAVRLEYSTAHKNLVQALRKApqtaavgfrQTTQKLAVVVELLlgdipdrqIFRQAVLRRALSPYFQLTQAVRMGELQKFNEVLTTYgnqfrtdyTFKLILRLRHNVIKTAIRSigasysritpaki
mskitsenrrtsdliAAKCYFYHSRVHELTNNLDKVRSFLNARLRIATLRNDFEGQAVLINCLLRNYLHYNLYDQADKLVKKSAFPENASNNEWARFHFYLGRIKAVRLEYSTAHKNLVQALRKAPQTAAVGFRQTTQKLAVVVELLLGDIPDRQIFRQAVLRRALSPYFQLTQAVRMGELQKFNEVLTTYGNQFRTDYTFKLILRLRHNVIKTairsigasysritpaki
MSKITSENRRTSDLIAAKCYFYHSRVHELTNNLDKVRSFLNARLRIATLRNDFEGQAVLINCLLRNYLHYNLYDQADKLVKKSAFPENASNNEWARFHFYLGRIKAVRLEYSTAHKNLVQALRKAPQTAAVGFRQTTQKLAVVVELLLGDIPDRQIFRQAVLRRALSPYFQLTQAVRMGELQKFNEVLTTYGNQFRTDYTFKLILRLRHNVIKTAIRSIGASYSRITPAKI
************DLIAAKCYFYHSRVHELTNNLDKVRSFLNARLRIATLRNDFEGQAVLINCLLRNYLHYNLYDQADKLVKKSAFPENASNNEWARFHFYLGRIKAVRLEYSTAHKNLVQALRKAPQTAAVGFRQTTQKLAVVVELLLGDIPDRQIFRQAVLRRALSPYFQLTQAVRMGELQKFNEVLTTYGNQFRTDYTFKLILRLRHNVIKTAIRSIGASY********
**K***ENRRTSDLIAAKCYFYHSRVHELTNNLDKVRSFLNARLRIATLRNDFEGQAVLINCLLRNYLHYNLYDQADKLVKKSAFPENASNNEWARFHFYLGRIKAVRLEYSTAHKNLVQALRKAPQTAAVGFRQTTQKLAVVVELLLGDIPDRQIFRQAVLRRALSPYFQLTQAVRMGELQKFNEVLTTYGNQFRTDYTFKLILRLRHNVIKTAIRSIGASYSRITPA**
*********RTSDLIAAKCYFYHSRVHELTNNLDKVRSFLNARLRIATLRNDFEGQAVLINCLLRNYLHYNLYDQADKLVKKSAFPENASNNEWARFHFYLGRIKAVRLEYSTAHKNLVQALRKAPQTAAVGFRQTTQKLAVVVELLLGDIPDRQIFRQAVLRRALSPYFQLTQAVRMGELQKFNEVLTTYGNQFRTDYTFKLILRLRHNVIKTAIRSIGASYSRITPAKI
MSKITSENRRTSDLIAAKCYFYHSRVHELTNNLDKVRSFLNARLRIATLRNDFEGQAVLINCLLRNYLHYNLYDQADKLVKKSAFPENASNNEWARFHFYLGRIKAVRLEYSTAHKNLVQALRKAPQTAAVGFRQTTQKLAVVVELLLGDIPDRQIFRQAVLRRALSPYFQLTQAVRMGELQKFNEVLTTYGNQFRTDYTFKLILRLRHNVIKTAIRSIGASYSRITP***
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSKITSENRRTSDLIAAKCYFYHSRVHELTNNLDKVRSFLNARLRIATLRNDFEGQAVLINCLLRNYLHYNLYDQADKLVKKSAFPENASNNEWARFHFYLGRIKAVRLEYSTAHKNLVQALRKAPQTAAVGFRQTTQKLAVVVELLLGDIPDRQIFRQAVLRRALSPYFQLTQAVRMGELQKFNEVLTTYGNQFRTDYTFKLILRLRHNVIKTAIRSIGASYSRITPAKI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query231 2.2.26 [Sep-21-2011]
Q9U5Z8 500 Probable 26S proteasome n N/A N/A 1.0 0.462 0.774 1e-105
O61470 496 Probable 26S proteasome n yes N/A 1.0 0.465 0.766 1e-104
P25161 494 Probable 26S proteasome n yes N/A 1.0 0.467 0.735 8e-99
P14685 530 26S proteasome non-ATPase yes N/A 1.0 0.435 0.653 1e-80
O43242 534 26S proteasome non-ATPase yes N/A 1.0 0.432 0.649 6e-80
Q2KJ46 534 26S proteasome non-ATPase yes N/A 1.0 0.432 0.649 6e-80
Q1ZXD3 504 26S proteasome non-ATPase yes N/A 0.982 0.450 0.511 1e-62
O42897 497 Probable 26S proteasome r yes N/A 0.982 0.456 0.504 2e-58
P93768 488 Probable 26S proteasome n N/A N/A 0.978 0.463 0.515 8e-56
Q04908 504 26S proteasome non-ATPase yes N/A 0.978 0.448 0.495 2e-54
>sp|Q9U5Z8|PSMD3_ANOST Probable 26S proteasome non-ATPase regulatory subunit 3 OS=Anopheles stephensi GN=DOXA2 PE=3 SV=1 Back     alignment and function desciption
 Score =  381 bits (978), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 179/231 (77%), Positives = 201/231 (87%)

Query: 1   MSKITSENRRTSDLIAAKCYFYHSRVHELTNNLDKVRSFLNARLRIATLRNDFEGQAVLI 60
           M+KI  +NRR+ DLIAAKCYFYHSRV EL N+L+ +RSFL++RLR ATLRNDFEGQAVLI
Sbjct: 159 MAKIVGQNRRSLDLIAAKCYFYHSRVSELNNDLESIRSFLHSRLRTATLRNDFEGQAVLI 218

Query: 61  NCLLRNYLHYNLYDQADKLVKKSAFPENASNNEWARFHFYLGRIKAVRLEYSTAHKNLVQ 120
           NCLLRNYLHY+LYDQADKLV KS FPE ASNNE ARF +YLGRIKA +LEYS AHK LVQ
Sbjct: 219 NCLLRNYLHYSLYDQADKLVNKSVFPETASNNECARFLYYLGRIKAAKLEYSVAHKQLVQ 278

Query: 121 ALRKAPQTAAVGFRQTTQKLAVVVELLLGDIPDRQIFRQAVLRRALSPYFQLTQAVRMGE 180
           ALRKAPQ AAVGFRQT QKL +VVELLLGDIP+R++FRQA LRR+L PYFQLTQAVRMG 
Sbjct: 279 ALRKAPQQAAVGFRQTVQKLVIVVELLLGDIPERKVFRQAALRRSLGPYFQLTQAVRMGN 338

Query: 181 LQKFNEVLTTYGNQFRTDYTFKLILRLRHNVIKTAIRSIGASYSRITPAKI 231
           LQ+F EVL  +G QFR D+TF LI+RLRHNVIKTAIRSIG +YSRI+P  I
Sbjct: 339 LQRFGEVLENFGEQFRQDHTFTLIIRLRHNVIKTAIRSIGLAYSRISPQDI 389
Acts as a regulatory subunit of the 26 proteasome which is involved in the ATP-dependent degradation of ubiquitinated proteins.
Anopheles stephensi (taxid: 30069)
>sp|O61470|PSMD3_ANOGA Probable 26S proteasome non-ATPase regulatory subunit 3 OS=Anopheles gambiae GN=Dox-A2 PE=3 SV=2 Back     alignment and function description
>sp|P25161|PSMD3_DROME Probable 26S proteasome non-ATPase regulatory subunit 3 OS=Drosophila melanogaster GN=Rpn3 PE=2 SV=1 Back     alignment and function description
>sp|P14685|PSMD3_MOUSE 26S proteasome non-ATPase regulatory subunit 3 OS=Mus musculus GN=Psmd3 PE=1 SV=3 Back     alignment and function description
>sp|O43242|PSMD3_HUMAN 26S proteasome non-ATPase regulatory subunit 3 OS=Homo sapiens GN=PSMD3 PE=1 SV=2 Back     alignment and function description
>sp|Q2KJ46|PSMD3_BOVIN 26S proteasome non-ATPase regulatory subunit 3 OS=Bos taurus GN=PSMD3 PE=2 SV=1 Back     alignment and function description
>sp|Q1ZXD3|PSMD3_DICDI 26S proteasome non-ATPase regulatory subunit 3 OS=Dictyostelium discoideum GN=psmD3 PE=1 SV=1 Back     alignment and function description
>sp|O42897|RPN3_SCHPO Probable 26S proteasome regulatory subunit rpn3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpn3 PE=3 SV=2 Back     alignment and function description
>sp|P93768|PSMD3_TOBAC Probable 26S proteasome non-ATPase regulatory subunit 3 OS=Nicotiana tabacum GN=21D7 PE=2 SV=1 Back     alignment and function description
>sp|Q04908|PSMD3_CAEEL 26S proteasome non-ATPase regulatory subunit 3 OS=Caenorhabditis elegans GN=rpn-3 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query231
307203008 501 Probable 26S proteasome non-ATPase regul 1.0 0.461 0.813 1e-107
307179423 505 Probable 26S proteasome non-ATPase regul 1.0 0.457 0.809 1e-107
389609323 495 regulatory particle non-ATPase 3, Dox-A2 1.0 0.466 0.805 1e-107
156542793 497 PREDICTED: probable 26S proteasome non-A 1.0 0.464 0.805 1e-106
332024014 491 Putative 26S proteasome non-ATPase regul 1.0 0.470 0.805 1e-106
322800341 501 hypothetical protein SINV_02611 [Solenop 1.0 0.461 0.805 1e-106
170037281 493 26S proteasome non-ATPase regulatory sub 1.0 0.468 0.779 1e-104
66546020 495 PREDICTED: probable 26S proteasome non-A 1.0 0.466 0.787 1e-103
12229938 500 RecName: Full=Probable 26S proteasome no 1.0 0.462 0.774 1e-103
380011417 495 PREDICTED: probable 26S proteasome non-A 1.0 0.466 0.787 1e-103
>gi|307203008|gb|EFN82224.1| Probable 26S proteasome non-ATPase regulatory subunit 3 [Harpegnathos saltator] Back     alignment and taxonomy information
 Score =  394 bits (1012), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 188/231 (81%), Positives = 205/231 (88%)

Query: 1   MSKITSENRRTSDLIAAKCYFYHSRVHELTNNLDKVRSFLNARLRIATLRNDFEGQAVLI 60
           + KI ++NRRT DLIAAKCYFYHSR +ELTN LDK+R FL+ RLR ATLRNDFEGQAVLI
Sbjct: 159 VQKIATQNRRTIDLIAAKCYFYHSRAYELTNQLDKIRGFLHLRLRTATLRNDFEGQAVLI 218

Query: 61  NCLLRNYLHYNLYDQADKLVKKSAFPENASNNEWARFHFYLGRIKAVRLEYSTAHKNLVQ 120
           NCLLRNYLHYNLYDQADKLV KS FPE+ASNNEWARF +YLGRIKA RLEYS AHK LVQ
Sbjct: 219 NCLLRNYLHYNLYDQADKLVLKSTFPESASNNEWARFLYYLGRIKAARLEYSAAHKYLVQ 278

Query: 121 ALRKAPQTAAVGFRQTTQKLAVVVELLLGDIPDRQIFRQAVLRRALSPYFQLTQAVRMGE 180
           A+RKAPQT AVGFRQT QKLAV VELLLGDIP+RQIFRQA LRRAL+PYFQLTQAVR+G 
Sbjct: 279 AMRKAPQTTAVGFRQTVQKLAVAVELLLGDIPERQIFRQAALRRALAPYFQLTQAVRLGN 338

Query: 181 LQKFNEVLTTYGNQFRTDYTFKLILRLRHNVIKTAIRSIGASYSRITPAKI 231
           LQ+F EVL  +G QFR+D+TF LILRLRHNVIKTAIRSIG SYSRI+PA I
Sbjct: 339 LQRFGEVLENFGPQFRSDHTFTLILRLRHNVIKTAIRSIGLSYSRISPADI 389

Source: Harpegnathos saltator

Species: Harpegnathos saltator

Genus: Harpegnathos

Family: Formicidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|307179423|gb|EFN67747.1| Probable 26S proteasome non-ATPase regulatory subunit 3 [Camponotus floridanus] Back     alignment and taxonomy information
>gi|389609323|dbj|BAM18273.1| regulatory particle non-ATPase 3, Dox-A2 [Papilio xuthus] Back     alignment and taxonomy information
>gi|156542793|ref|XP_001605959.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 3-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|332024014|gb|EGI64232.1| Putative 26S proteasome non-ATPase regulatory subunit 3 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|322800341|gb|EFZ21345.1| hypothetical protein SINV_02611 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|170037281|ref|XP_001846487.1| 26S proteasome non-ATPase regulatory subunit 3 [Culex quinquefasciatus] gi|167880396|gb|EDS43779.1| 26S proteasome non-ATPase regulatory subunit 3 [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|66546020|ref|XP_623947.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 3 [Apis mellifera] Back     alignment and taxonomy information
>gi|12229938|sp|Q9U5Z8.1|PSMD3_ANOST RecName: Full=Probable 26S proteasome non-ATPase regulatory subunit 3; Short=26S proteasome subunit S3; AltName: Full=26S proteasome regulatory subunit RPN3; AltName: Full=Diphenol oxidase A2 component; Short=DOX-A2 gi|6448514|emb|CAB61220.1| 26S proteasome regulatory subunit [Anopheles stephensi] Back     alignment and taxonomy information
>gi|380011417|ref|XP_003689802.1| PREDICTED: probable 26S proteasome non-ATPase regulatory subunit 3-like [Apis florea] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query231
FB|FBgn0261396 494 Rpn3 "Regulatory particle non- 1.0 0.467 0.735 1.4e-87
MGI|MGI:98858 530 Psmd3 "proteasome (prosome, ma 1.0 0.435 0.653 3e-78
RGD|1311470 530 Psmd3 "proteasome (prosome, ma 1.0 0.435 0.653 3e-78
ZFIN|ZDB-GENE-040426-1444 503 psmd3 "proteasome (prosome, ma 1.0 0.459 0.662 6.2e-78
UNIPROTKB|Q2KJ46 534 PSMD3 "26S proteasome non-ATPa 1.0 0.432 0.649 1e-77
UNIPROTKB|E2QUY7 534 PSMD3 "Uncharacterized protein 1.0 0.432 0.649 1e-77
UNIPROTKB|B4DT72356 PSMD3 "26S proteasome non-ATPa 1.0 0.648 0.649 1e-77
UNIPROTKB|O43242 534 PSMD3 "26S proteasome non-ATPa 1.0 0.432 0.649 1e-77
UNIPROTKB|F1RXA7 536 LOC100512253 "Uncharacterized 1.0 0.430 0.648 4.3e-77
UNIPROTKB|I3LL55505 I3LL55 "Uncharacterized protei 0.917 0.419 0.628 1.1e-69
FB|FBgn0261396 Rpn3 "Regulatory particle non-ATPase 3" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 875 (313.1 bits), Expect = 1.4e-87, P = 1.4e-87
 Identities = 170/231 (73%), Positives = 201/231 (87%)

Query:     1 MSKITSENRRTSDLIAAKCYFYHSRVHELTNNLDKVRSFLNARLRIATLRNDFEGQAVLI 60
             M+KI+ +NRRT DLI AK YFY SRV EL N+L+ +RSFL+ARLR ATLRNDFEGQAVLI
Sbjct:   153 MAKISIQNRRTLDLIGAKSYFYFSRVAELKNSLEGIRSFLHARLRTATLRNDFEGQAVLI 212

Query:    61 NCLLRNYLHYNLYDQADKLVKKSAFPENASNNEWARFHFYLGRIKAVRLEYSTAHKNLVQ 120
             NCLLRNYLHY LYDQADKLVKKS +PE+ASNNEWARF +YLGRIKA +LEYS AHK+LVQ
Sbjct:   213 NCLLRNYLHYALYDQADKLVKKSVYPESASNNEWARFLYYLGRIKAAKLEYSDAHKHLVQ 272

Query:   121 ALRKAPQTAAVGFRQTTQKLAVVVELLLGDIPDRQIFRQAVLRRALSPYFQLTQAVRMGE 180
             ALRK+PQ AA+GFRQT QKL +VVELLLG+IP+R +FRQA LR++L  YFQLTQAVR+G 
Sbjct:   273 ALRKSPQHAAIGFRQTVQKLIIVVELLLGNIPERVVFRQAGLRQSLGAYFQLTQAVRLGN 332

Query:   181 LQKFNEVLTTYGNQFRTDYTFKLILRLRHNVIKTAIRSIGASYSRITPAKI 231
             L++F +V++ YG +F+ D+TF LI+RLRHNVIKTAIRSIG SYSRI+P  I
Sbjct:   333 LKRFGDVVSQYGPKFQLDHTFTLIIRLRHNVIKTAIRSIGLSYSRISPQDI 383
GO:0004175 "endopeptidase activity" evidence=ISS;IDA
GO:0000502 "proteasome complex" evidence=ISS
GO:0006508 "proteolysis" evidence=ISS;IDA
GO:0008541 "proteasome regulatory particle, lid subcomplex" evidence=ISS
GO:0005838 "proteasome regulatory particle" evidence=ISS;IDA
GO:0030234 "enzyme regulator activity" evidence=IEA
GO:0042176 "regulation of protein catabolic process" evidence=IEA
MGI|MGI:98858 Psmd3 "proteasome (prosome, macropain) 26S subunit, non-ATPase, 3" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
RGD|1311470 Psmd3 "proteasome (prosome, macropain) 26S subunit, non-ATPase, 3" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040426-1444 psmd3 "proteasome (prosome, macropain) 26S subunit, non-ATPase, 3" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q2KJ46 PSMD3 "26S proteasome non-ATPase regulatory subunit 3" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2QUY7 PSMD3 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|B4DT72 PSMD3 "26S proteasome non-ATPase regulatory subunit 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|O43242 PSMD3 "26S proteasome non-ATPase regulatory subunit 3" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F1RXA7 LOC100512253 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|I3LL55 I3LL55 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9LQR8PSD32_ARATHNo assigned EC number0.51540.97830.4640yesN/A
P14685PSMD3_MOUSENo assigned EC number0.65361.00.4358yesN/A
O42897RPN3_SCHPONo assigned EC number0.50430.98260.4567yesN/A
Q1ZXD3PSMD3_DICDINo assigned EC number0.51100.98260.4503yesN/A
Q2KJ46PSMD3_BOVINNo assigned EC number0.64931.00.4325yesN/A
O61470PSMD3_ANOGANo assigned EC number0.76621.00.4657yesN/A
O43242PSMD3_HUMANNo assigned EC number0.64931.00.4325yesN/A
P25161PSMD3_DROMENo assigned EC number0.73591.00.4676yesN/A

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query231
pfam01399100 pfam01399, PCI, PCI domain 1e-07
>gnl|CDD|216479 pfam01399, PCI, PCI domain Back     alignment and domain information 
 Score = 48.4 bits (116), Expect = 1e-07
 Identities = 16/63 (25%), Positives = 30/63 (47%)

Query: 169 YFQLTQAVRMGELQKFNEVLTTYGNQFRTDYTFKLILRLRHNVIKTAIRSIGASYSRITP 228
           Y  L +A   G+L  F E+L    ++   D   +L+  LR  + +  +R +   YS I+ 
Sbjct: 1   YRDLLRAFYSGDLSDFEEILADNEDELLDDGLAELLEDLRRKIRELNLRRLAKPYSSISL 60

Query: 229 AKI 231
           + +
Sbjct: 61  SDL 63

This domain has also been called the PINT motif (Proteasome, Int-6, Nip-1 and TRIP-15). Length = 100

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 231
KOG2581|consensus 493 100.0
KOG2688|consensus394 99.97
COG5600413 Transcription-associated recombination protein [DN 99.96
KOG2582|consensus422 99.61
PF01399105 PCI: PCI domain; InterPro: IPR000717 A homology do 98.55
KOG1464|consensus440 97.79
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 97.27
KOG1463|consensus411 97.15
PF0771934 TPR_2: Tetratricopeptide repeat; InterPro: IPR0131 96.96
PF1337173 TPR_9: Tetratricopeptide repeat 96.85
PF1343265 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL 96.77
PF10255404 Paf67: RNA polymerase I-associated factor PAF67; I 96.65
TIGR02552135 LcrH_SycD type III secretion low calcium response 96.26
PRK15359144 type III secretion system chaperone protein SscB; 96.23
PF0051534 TPR_1: Tetratricopeptide repeat; InterPro: IPR0014 95.97
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 95.78
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 95.62
cd00189100 TPR Tetratricopeptide repeat domain; typically con 95.53
PF1289584 Apc3: Anaphase-promoting complex, cyclosome, subun 95.33
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 95.16
KOG2908|consensus380 95.12
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 94.53
PF1318134 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_ 94.5
PF04733290 Coatomer_E: Coatomer epsilon subunit; InterPro: IP 94.47
PF09976145 TPR_21: Tetratricopeptide repeat; InterPro: IPR018 94.34
PRK10370198 formate-dependent nitrite reductase complex subuni 94.17
PRK02603172 photosystem I assembly protein Ycf3; Provisional 94.16
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 94.0
COG5159421 RPN6 26S proteasome regulatory complex component [ 93.52
PRK11189296 lipoprotein NlpI; Provisional 93.45
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 93.34
TIGR03302235 OM_YfiO outer membrane assembly lipoprotein YfiO. 93.26
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 93.23
PF1341469 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A 92.96
PRK11788389 tetratricopeptide repeat protein; Provisional 92.93
KOG4162|consensus799 92.74
TIGR02917 899 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat 92.45
cd00189100 TPR Tetratricopeptide repeat domain; typically con 92.41
KOG1497|consensus399 92.27
PF1317433 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_ 92.22
PF14938282 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1 91.91
PF1485353 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repe 91.77
TIGR02521234 type_IV_pilW type IV pilus biogenesis/stability pr 91.6
CHL00033168 ycf3 photosystem I assembly protein Ycf3 91.4
PF1342478 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15 91.4
KOG1076|consensus 843 90.83
CHL00033168 ycf3 photosystem I assembly protein Ycf3 90.77
PRK15174 656 Vi polysaccharide export protein VexE; Provisional 90.75
PF03399204 SAC3_GANP: SAC3/GANP/Nin1/mts3/eIF-3 p25 family; I 90.51
PF1342844 TPR_14: Tetratricopeptide repeat 90.31
TIGR00990615 3a0801s09 mitochondrial precursor proteins import 90.08
PF1455968 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN 89.86
PRK11906458 transcriptional regulator; Provisional 89.06
smart0002834 TPR Tetratricopeptide repeats. Repeats present in 88.83
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 88.72
PRK11788389 tetratricopeptide repeat protein; Provisional 88.37
PRK15363157 pathogenicity island 2 chaperone protein SscA; Pro 88.17
KOG1498|consensus439 87.93
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 87.47
PLN03088 356 SGT1, suppressor of G2 allele of SKP1; Provisional 87.18
TIGR02552135 LcrH_SycD type III secretion low calcium response 87.09
PRK12370553 invasion protein regulator; Provisional 87.04
PRK12370553 invasion protein regulator; Provisional 86.95
PRK02603172 photosystem I assembly protein Ycf3; Provisional 86.63
PRK11189296 lipoprotein NlpI; Provisional 85.98
PF10075143 PCI_Csn8: COP9 signalosome, subunit CSN8; InterPro 85.46
PRK15359144 type III secretion system chaperone protein SscB; 84.89
PRK10049 765 pgaA outer membrane protein PgaA; Provisional 83.68
PF1317636 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_ 83.37
PF07729125 FCD: FCD domain; InterPro: IPR011711 Many bacteria 83.14
cd05804355 StaR_like StaR_like; a well-conserved protein foun 82.61
TIGR02795119 tol_pal_ybgF tol-pal system protein YbgF. Members 82.45
PF02064121 MAS20: MAS20 protein import receptor; InterPro: IP 82.42
PF13429280 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2 81.74
KOG2076|consensus 895 81.55
PRK11447 1157 cellulose synthase subunit BcsC; Provisional 80.41
KOG2300|consensus629 80.08
PF09295395 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); Inter 80.03
>KOG2581|consensus Back     alignment and domain information 
Probab=100.00  E-value=3.6e-66  Score=466.28  Aligned_cols=230  Identities=63%  Similarity=0.979  Sum_probs=226.6

Q ss_pred             ccccccccchhhhHHHHHHHHHHHHHhhcccHHHHHHHHHHHHHHHhhcCCcchhHHHHHHHHHHHHhcCChhhHHhhhh
Q psy9817           2 SKITSENRRTSDLIAAKCYFYHSRVHELTNNLDKVRSFLNARLRIATLRNDFEGQAVLINCLLRNYLHYNLYDQADKLVK   81 (231)
Q Consensus         2 ~~~~~~~~r~~d~~~ak~~~y~~~~~e~~~~l~~i~~~l~~~~r~~~lr~d~~~~~~l~N~Llr~Yf~~~~~~~a~~l~~   81 (231)
                      ..+...|||++|.++||+|||++++||..+++..+|+.|++.+|||++|||++||++++|||+|+|++.+.|++|+++++
T Consensus       154 ~~i~~~nrRtlD~i~ak~~fy~~l~~E~~~~l~~~rs~l~~~lrtAtLrhd~e~qavLiN~LLr~yL~n~lydqa~~lvs  233 (493)
T KOG2581|consen  154 ASISIQNRRTLDLIAAKLYFYLYLSYELEGRLADIRSFLHALLRTATLRHDEEGQAVLINLLLRNYLHNKLYDQADKLVS  233 (493)
T ss_pred             HHHHhcchhhHHHHHHHHHHHHHHHHHhhcchHHHHHHHHHHHHHhhhcCcchhHHHHHHHHHHHHhhhHHHHHHHHHhh
Confidence            45678899999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccCCCCCCCchhhHHHHhhHHHHHHHhhcHHHHHHHHHHHHHhCChhhhhhHHHHHHHHHHHHHHhcCCCCCHHHhhHHH
Q psy9817          82 KSAFPENASNNEWARFHFYLGRIKAVRLEYSTAHKNLVQALRKAPQTAAVGFRQTTQKLAVVVELLLGDIPDRQIFRQAV  161 (231)
Q Consensus        82 ~~~~p~~~~~~~~v~Y~YY~Gri~~~~~~y~~A~~~L~~A~~~~p~~~~~~~~~~ilk~lI~v~LllG~iP~~~ll~~~~  161 (231)
                      |+.+|+.++++++++|+||+|||.++|++|++|.+++.+|.+++|++.+.||++.+.|+.|+|+|++|+||++++|.||.
T Consensus       234 K~~~pe~~snne~ARY~yY~GrIkaiqldYssA~~~~~qa~rkapq~~alGf~q~v~k~~ivv~ll~geiPers~F~Qp~  313 (493)
T KOG2581|consen  234 KSVYPEAASNNEWARYLYYLGRIKAIQLDYSSALEYFLQALRKAPQHAALGFRQQVNKLMIVVELLLGEIPERSVFRQPG  313 (493)
T ss_pred             cccCccccccHHHHHHHHHHhhHHHhhcchhHHHHHHHHHHHhCcchhhhhHHHHHHHHHHHHHHHcCCCcchhhhcCcc
Confidence            99999999999999999999999999999999999999999999998889999999999999999999999999999999


Q ss_pred             HhhcccchHHHHHHHHcCCHHHHHHHHHHcchhhhhcchHHHHHHHHHHHHHHHHHHHHHHhccccCCCC
Q psy9817         162 LRRALSPYFQLTQAVRMGELQKFNEVLTTYGNQFRTDYTFKLILRLRHNVIKTAIRSIGASYSRITPAKI  231 (231)
Q Consensus       162 ~~~~L~~Y~~L~~AVr~Gdl~~F~~~l~~~~~~f~~dg~y~Lv~rlr~~v~R~liRki~l~YsrIsl~di  231 (231)
                      |+++|.||+.|++|||.||+++|+++++++.+.|.+||||.|+.||||||||+|||+|+++|||||+.||
T Consensus       314 ~~ksL~~Yf~Lt~AVr~gdlkkF~~~leq~k~~f~~D~ty~LivRLR~NVIkTgIR~ISlsYSRISl~DI  383 (493)
T KOG2581|consen  314 MRKSLRPYFKLTQAVRLGDLKKFNETLEQFKDKFQADGTYTLIVRLRHNVIKTGIRKISLSYSRISLQDI  383 (493)
T ss_pred             HHHHHHHHHHHHHHHHHhhHHHHHHHHHHHHHHHhhCCcchHHHHHHHHHHHHhhhheeeeeeeccHHHH
Confidence            9999999999999999999999999999999999999999999999999999999999999999999997

>KOG2688|consensus Back     alignment and domain information
>COG5600 Transcription-associated recombination protein [DNA replication, recombination, and repair] Back     alignment and domain information
>KOG2582|consensus Back     alignment and domain information
>PF01399 PCI: PCI domain; InterPro: IPR000717 A homology domain of unclear function, occurs in the C-terminal region of several regulatory components of the 26S proteasome as well as in other proteins Back     alignment and domain information
>KOG1464|consensus Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>KOG1463|consensus Back     alignment and domain information
>PF07719 TPR_2: Tetratricopeptide repeat; InterPro: IPR013105 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF13371 TPR_9: Tetratricopeptide repeat Back     alignment and domain information
>PF13432 TPR_16: Tetratricopeptide repeat; PDB: 3CVP_A 3CVL_A 3CVQ_A 3CV0_A 2GW1_B 3CVN_A 3QKY_A 2PL2_B Back     alignment and domain information
>PF10255 Paf67: RNA polymerase I-associated factor PAF67; InterPro: IPR019382 RNA polymerase I is a multi-subunit enzyme and its transcription competence is dependent on the presence of PAF67 [] Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PF00515 TPR_1: Tetratricopeptide repeat; InterPro: IPR001440 The tetratrico peptide repeat (TPR) is a structural motif present in a wide range of proteins [, , ] Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>PF12895 Apc3: Anaphase-promoting complex, cyclosome, subunit 3; PDB: 3KAE_D 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2XPI_A 3ULQ_A Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>KOG2908|consensus Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>PF13181 TPR_8: Tetratricopeptide repeat; PDB: 3GW4_B 3MA5_C 2KCV_A 2KCL_A 3FP3_A 3LCA_A 3FP4_A 3FP2_A 1W3B_B 1ELW_A Back     alignment and domain information
>PF04733 Coatomer_E: Coatomer epsilon subunit; InterPro: IPR006822 Proteins synthesised on the ribosome and processed in the endoplasmic reticulum are transported from the Golgi apparatus to the trans-Golgi network (TGN), and from there via small carrier vesicles to their final destination compartment Back     alignment and domain information
>PF09976 TPR_21: Tetratricopeptide repeat; InterPro: IPR018704 This domain, found in various hypothetical prokaryotic proteins, has no known function Back     alignment and domain information
>PRK10370 formate-dependent nitrite reductase complex subunit NrfG; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>COG5159 RPN6 26S proteasome regulatory complex component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>TIGR03302 OM_YfiO outer membrane assembly lipoprotein YfiO Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>PF13414 TPR_11: TPR repeat; PDB: 2HO1_B 2FI7_B 2DBA_A 3Q4A_B 2C2L_D 3Q47_B 3Q49_B 2PL2_B 3IEG_B 2FBN_A Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>KOG4162|consensus Back     alignment and domain information
>TIGR02917 PEP_TPR_lipo putative PEP-CTERM system TPR-repeat lipoprotein Back     alignment and domain information
>cd00189 TPR Tetratricopeptide repeat domain; typically contains 34 amino acids [WLF]-X(2)-[LIM]-[GAS]-X(2)-[YLF]-X(8)-[ASE]-X(3)-[FYL]-X(2)-[ASL]-X(4)-[PKE] is the consensus sequence; found in a variety of organisms including bacteria, cyanobacteria, yeast, fungi, plants, and humans in various subcellular locations; involved in a variety of functions including protein-protein interactions, but common features in the interaction partners have not been defined; involved in chaperone, cell-cycle, transciption, and protein transport complexes; the number of TPR motifs varies among proteins (1,3-11,13 15,16,19); 5-6 tandem repeats generate a right-handed helical structure with an amphipathic channel that is thought to accomodate an alpha-helix of a target protein; it has been proposed that TPR proteins preferably interact with WD-40 repeat proteins, but in many instances several TPR-proteins seem to aggregate to multi-protein complexes; examples of TPR-proteins include, Cdc16p, Cdc23p and C Back     alignment and domain information
>KOG1497|consensus Back     alignment and domain information
>PF13174 TPR_6: Tetratricopeptide repeat; PDB: 3QKY_A 2XEV_A 3URZ_B 2Q7F_A Back     alignment and domain information
>PF14938 SNAP: Soluble NSF attachment protein, SNAP; PDB: 1QQE_A 2IFU_A Back     alignment and domain information
>PF14853 Fis1_TPR_C: Fis1 C-terminal tetratricopeptide repeat; PDB: 1IYG_A 1PC2_A 1NZN_A 3UUX_C 1Y8M_A 2PQR_A 2PQN_A 3O48_A Back     alignment and domain information
>TIGR02521 type_IV_pilW type IV pilus biogenesis/stability protein PilW Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PF13424 TPR_12: Tetratricopeptide repeat; PDB: 3RO2_A 3Q15_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 4A1S_B 3CEQ_B 3EDT_H Back     alignment and domain information
>KOG1076|consensus Back     alignment and domain information
>CHL00033 ycf3 photosystem I assembly protein Ycf3 Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>PF03399 SAC3_GANP: SAC3/GANP/Nin1/mts3/eIF-3 p25 family; InterPro: IPR005062 This large family includes diverse proteins involved in large complexes [, , ] Back     alignment and domain information
>PF13428 TPR_14: Tetratricopeptide repeat Back     alignment and domain information
>TIGR00990 3a0801s09 mitochondrial precursor proteins import receptor (72 kDa mitochondrial outermembrane protein) (mitochondrial import receptor for the ADP/ATP carrier) (translocase of outermembrane tom70) Back     alignment and domain information
>PF14559 TPR_19: Tetratricopeptide repeat; PDB: 2R5S_A 3QDN_B 3QOU_A 3ASG_A 3ASD_A 3AS5_A 3AS4_A 3ASH_B 3FP3_A 3LCA_A Back     alignment and domain information
>PRK11906 transcriptional regulator; Provisional Back     alignment and domain information
>smart00028 TPR Tetratricopeptide repeats Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PRK11788 tetratricopeptide repeat protein; Provisional Back     alignment and domain information
>PRK15363 pathogenicity island 2 chaperone protein SscA; Provisional Back     alignment and domain information
>KOG1498|consensus Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>TIGR02552 LcrH_SycD type III secretion low calcium response chaperone LcrH/SycD Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PRK12370 invasion protein regulator; Provisional Back     alignment and domain information
>PRK02603 photosystem I assembly protein Ycf3; Provisional Back     alignment and domain information
>PRK11189 lipoprotein NlpI; Provisional Back     alignment and domain information
>PF10075 PCI_Csn8: COP9 signalosome, subunit CSN8; InterPro: IPR019280 The photomorphogenic 9 (COP9) signalosome or CSN complex is composed of eight subunits: Cops1/GPS1, Cops2, Cops3, Cops4, Cops5, Cop6, Cops7 (Cops7A or Cops7B) and Cops8 Back     alignment and domain information
>PRK15359 type III secretion system chaperone protein SscB; Provisional Back     alignment and domain information
>PRK10049 pgaA outer membrane protein PgaA; Provisional Back     alignment and domain information
>PF13176 TPR_7: Tetratricopeptide repeat; PDB: 3SF4_C 3RO3_A 3RO2_A Back     alignment and domain information
>PF07729 FCD: FCD domain; InterPro: IPR011711 Many bacterial transcription regulation proteins bind DNA through a helix-turn-helix (HTH) motif, which can be classified into subfamilies on the basis of sequence similarities Back     alignment and domain information
>cd05804 StaR_like StaR_like; a well-conserved protein found in bacteria, plants, and animals Back     alignment and domain information
>TIGR02795 tol_pal_ybgF tol-pal system protein YbgF Back     alignment and domain information
>PF02064 MAS20: MAS20 protein import receptor; InterPro: IPR002056 Virtually all mitochondrial precursors are imported via the same mechanism []: precursors first bind to receptors on the mitochondrial surface, then insert into the translocation channel in the outer membrane Back     alignment and domain information
>PF13429 TPR_15: Tetratricopeptide repeat; PDB: 2VQ2_A 2PL2_B Back     alignment and domain information
>KOG2076|consensus Back     alignment and domain information
>PRK11447 cellulose synthase subunit BcsC; Provisional Back     alignment and domain information
>KOG2300|consensus Back     alignment and domain information
>PF09295 ChAPs: ChAPs (Chs5p-Arf1p-binding proteins); InterPro: IPR015374 ChAPs (Chs5p-Arf1p-binding proteins) are required for the export of specialised cargo from the Golgi Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query231
4b4t_S 523 Near-Atomic Resolution Structural Model Of The Yeas 5e-42
>pdb|4B4T|S Chain S, Near-Atomic Resolution Structural Model Of The Yeast 26s Proteasome Length = 523 Back     alignment and structure 
Iteration: 1

 Score =  167 bits (423), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 90/232 (38%), Positives = 149/232 (64%), Gaps = 12/232 (5%)
Query: 8   NRRTSDLIAAKCYFYHSRVHEL---------TNNLDKV-RSFLNARLRIATLRNDFEGQA 57
           N R+ +LI AK +FY    HE          ++N + + RS +   L+IA+L++D E +A
Sbjct: 172 NLRSLNLINAKLWFYIYLSHETLARSSEEINSDNQNIILRSTMMKFLKIASLKHDNETKA 231
Query: 58  VLINCLLRNYLHYNLYDQADKLVKKSAFPE-NASNNEWARFHFYLGRIKAVRLEYSTAHK 116
           +LIN +LR++L+    D A   + K  +P  + S++  AR+ FYL +I A++L+YSTA++
Sbjct: 232 MLINLILRDFLNNGEVDSASDFISKLEYPHTDVSSSLEARYFFYLSKINAIQLDYSTANE 291
Query: 117 NLVQALRKAPQTA-AVGFRQTTQKLAVVVELLLGDIPDRQIFRQAVLRRALSPYFQLTQA 175
            ++ A+RKAP  + ++GF Q + KL   ++LL+GDIP+   F Q+ ++++L PY+ LT+A
Sbjct: 292 YIIAAIRKAPHNSKSLGFLQQSNKLHCCIQLLMGDIPELSFFHQSNMQKSLLPYYHLTKA 351
Query: 176 VRMGELQKFNEVLTTYGNQFRTDYTFKLILRLRHNVIKTAIRSIGASYSRIT 227
           V++G+L+KF   +T Y      D T++L +RLR NVIKT IR I  +Y +I+
Sbjct: 352 VKLGDLKKFTSTITKYKQLLLKDDTYQLCVRLRSNVIKTGIRIISLTYKKIS 403

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query231
3t5x_A203 PCI domain-containing protein 2; PCI, mRNA nuclear 7e-36
3t5v_B455 Nuclear mRNA export protein THP1; PCI, mRNA nuclea 1e-34
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 6e-05
>3t5x_A PCI domain-containing protein 2; PCI, mRNA nuclear export, transcription; 2.12A {Homo sapiens} Length = 203 Back     alignment and structure
 Score =  125 bits (314), Expect = 7e-36
 Identities = 24/151 (15%), Positives = 62/151 (41%), Gaps = 7/151 (4%)

Query: 83  SAFPENASNNEWARFHFYLGRIKAVRLEYSTAHKNLVQALRKAPQTAAVGFRQTTQKLAV 142
           S   ++ S  +   + +Y+GR      ++  A + L  A     ++ +   ++      +
Sbjct: 2   SHMKDDYSTAQRVTYKYYVGRKAMFDSDFKQAEEYLSFAFEHCHRS-SQKNKRMILIYLL 60

Query: 143 VVELLLGDIPDRQIFRQAVLRRALSPYFQLTQAVRMGELQKFNEVLTTYGNQFRTDYTFK 202
            V++LLG +P  ++ ++      L  + ++T+AV  G L   +E L  +   F     F 
Sbjct: 61  PVKMLLGHMPTVELLKK----YHLMQFAEVTRAVSEGNLLLLHEALAKHEAFFIRCGIFL 116

Query: 203 LILRLRHNVIKTAIRSIGASY--SRITPAKI 231
           ++ +L+    +   + +       +++    
Sbjct: 117 ILEKLKIITYRNLFKKVYLLLKTHQLSLDAF 147
>3t5v_B Nuclear mRNA export protein THP1; PCI, mRNA nuclear export, mRNA, nuclear, transcription; 2.90A {Saccharomyces cerevisiae} Length = 455 Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Length = 394 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query231
4b4t_S 523 RPN3, 26S proteasome regulatory subunit RPN3; hydr 100.0
3t5v_B455 Nuclear mRNA export protein THP1; PCI, mRNA nuclea 100.0
3t5x_A203 PCI domain-containing protein 2; PCI, mRNA nuclear 100.0
3txn_A394 26S proteasome regulatory complex subunit P42B; PC 99.44
4b0z_A229 RPN12, 26S proteasome regulatory subunit RPN12; pr 99.42
4b4t_P445 26S proteasome regulatory subunit RPN5; hydrolase, 99.41
4b4t_Q434 26S proteasome regulatory subunit RPN6; hydrolase, 99.12
4b4t_O393 26S proteasome regulatory subunit RPN9; hydrolase, 98.45
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 98.12
4b4t_R429 RPN7, 26S proteasome regulatory subunit RPN7; hydr 98.09
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 98.02
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 97.79
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 97.65
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 97.63
3q15_A378 PSP28, response regulator aspartate phosphatase H; 97.55
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 97.53
3ro3_A164 PINS homolog, G-protein-signaling modulator 2; asy 97.53
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 97.52
3gw4_A203 Uncharacterized protein; structural genomics, PSI- 97.42
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 97.41
3ro2_A338 PINS homolog, G-protein-signaling modulator 2; TPR 97.4
3ulq_A383 Response regulator aspartate phosphatase F; tetrat 97.38
3sf4_A406 G-protein-signaling modulator 2; tetratricopeptide 97.38
4a1s_A411 PINS, partner of inscuteable; cell cycle, LGN, mit 97.34
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 97.21
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 97.17
3q15_A378 PSP28, response regulator aspartate phosphatase H; 97.15
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 97.12
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 97.1
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 97.0
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 96.95
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 96.93
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 96.92
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 96.89
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 96.88
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 96.83
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 96.81
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 96.79
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 96.73
3u3w_A293 Transcriptional activator PLCR protein; ternary co 96.73
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 96.69
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 96.68
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 96.64
3nf1_A311 KLC 1, kinesin light chain 1; TPR, structural geno 96.63
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 96.62
3u3w_A293 Transcriptional activator PLCR protein; ternary co 96.6
3q49_B137 STIP1 homology and U box-containing protein 1; E3 96.58
1qqe_A292 Vesicular transport protein SEC17; helix-turn-heli 96.57
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 96.51
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 96.51
2qfc_A293 PLCR protein; TPR, HTH, transcription regulation; 96.5
3edt_B283 KLC 2, kinesin light chain 2; superhelical, struct 96.45
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 96.42
4b4t_Q 434 26S proteasome regulatory subunit RPN6; hydrolase, 96.42
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 96.32
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 96.29
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 96.28
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 96.23
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 96.23
2ifu_A307 Gamma-SNAP; membrane fusion, snare complex disasse 96.21
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 96.21
3uq3_A258 Heat shock protein STI1; HSP90, peptide binding, c 96.21
1ihg_A370 Cyclophilin 40; ppiase immunophilin tetratricopept 96.21
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 96.19
4i17_A228 Hypothetical protein; TPR repeats protein, structu 96.19
3k9i_A117 BH0479 protein; putative protein binding protein, 96.16
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 96.16
3vtx_A184 MAMA; tetratricopeptide repeats (TPR) containing p 96.16
4i17_A228 Hypothetical protein; TPR repeats protein, structu 96.14
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 96.13
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 96.12
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 96.08
2fo7_A136 Synthetic consensus TPR protein; tetratricopeptide 96.07
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 96.01
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 95.99
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 95.95
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 95.93
2vq2_A225 PILW, putative fimbrial biogenesis and twitching m 95.9
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 95.9
2gw1_A514 Mitochondrial precursor proteins import receptor; 95.88
4eqf_A365 PEX5-related protein; accessory protein, tetratric 95.87
2ho1_A252 Type 4 fimbrial biogenesis protein PILF; type IV p 95.87
1hh8_A213 P67PHOX, NCF-2, neutrophil cytosol factor 2; cell 95.78
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 95.78
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 95.77
2l6j_A111 TPR repeat-containing protein associated with HSP; 95.72
3as5_A186 MAMA; tetratricopeptide repeats (TPR) containing p 95.69
2kc7_A99 BFR218_protein; tetratricopeptide repeat, all-alph 95.68
3qky_A261 Outer membrane assembly lipoprotein YFIO; membrane 95.63
2kat_A115 Uncharacterized protein; NESG, structure, structur 95.63
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 95.63
3u4t_A272 TPR repeat-containing protein; structural genomics 95.6
3cv0_A327 Peroxisome targeting signal 1 receptor PEX5; TPR m 95.57
4eqf_A365 PEX5-related protein; accessory protein, tetratric 95.56
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 95.55
2q7f_A243 YRRB protein; TPR, protein binding; 2.49A {Bacillu 95.52
1kt0_A457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 95.5
3hym_B330 Cell division cycle protein 16 homolog; APC, anaph 95.44
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 95.4
2c2l_A281 CHIP, carboxy terminus of HSP70-interacting protei 95.32
1hz4_A373 MALT regulatory protein; two-helix bundles, helix 95.31
4abn_A474 Tetratricopeptide repeat protein 5; P53 cofactor, 95.28
4ga2_A150 E3 SUMO-protein ligase ranbp2; TPR motif, nuclear 95.17
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 95.13
1fch_A368 Peroxisomal targeting signal 1 receptor; protein-p 95.1
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 95.08
3u4t_A272 TPR repeat-containing protein; structural genomics 95.05
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 95.01
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 95.01
2pl2_A217 Hypothetical conserved protein TTC0263; TPR, prote 94.94
2y4t_A450 DNAJ homolog subfamily C member 3; chaperone, endo 94.91
2xev_A129 YBGF; tetratricopeptide, alpha-helical, metal bind 94.64
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 94.64
4gcn_A127 Protein STI-1; structural genomics, PSI-biology, m 94.42
2v5f_A104 Prolyl 4-hydroxylase subunit alpha-1; endoplasmic 94.34
4gco_A126 Protein STI-1; structural genomics, PSI-biology, m 94.33
3sz7_A164 HSC70 cochaperone (SGT); TPR domain, GET4, GET5, G 94.33
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 94.28
3ieg_A359 DNAJ homolog subfamily C member 3; TPR motif, chap 94.21
2xpi_A597 Anaphase-promoting complex subunit CUT9; cell cycl 94.15
3mv2_B310 Coatomer subunit epsilon; vesicular membrane coat 94.04
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 94.02
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 94.01
3fp2_A537 TPR repeat-containing protein YHR117W; TOM71, mito 94.01
2y4t_A 450 DNAJ homolog subfamily C member 3; chaperone, endo 93.98
1elr_A131 TPR2A-domain of HOP; HOP, TPR-domain, peptide-comp 93.96
4gyw_A 723 UDP-N-acetylglucosamine--peptide N- acetylglucosam 93.86
1w3b_A388 UDP-N-acetylglucosamine--peptide N-acetylglucosami 93.86
3gyz_A151 Chaperone protein IPGC; asymmetric homodimer, tetr 93.83
1hxi_A121 PEX5, peroxisome targeting signal 1 receptor PEX5; 93.71
3q49_B137 STIP1 homology and U box-containing protein 1; E3 93.62
1xnf_A275 Lipoprotein NLPI; TPR, tetratricopeptide, structur 93.59
2gw1_A514 Mitochondrial precursor proteins import receptor; 93.59
2xcb_A142 PCRH, regulatory protein PCRH; protein transport, 93.55
3urz_A208 Uncharacterized protein; tetratricopeptide repeats 93.51
1elw_A118 TPR1-domain of HOP; HOP, TPR-domain, peptide-compl 93.47
4abn_A 474 Tetratricopeptide repeat protein 5; P53 cofactor, 93.37
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 93.36
2kck_A112 TPR repeat; tetratricopeptide repeat, structural g 93.26
1na0_A125 Designed protein CTPR3; de novo protein; HET: IPT; 93.24
2vgx_A148 Chaperone SYCD; alternative dimer assembly, tetrat 93.24
3upv_A126 Heat shock protein STI1; TPR-fold, adaptor protein 93.22
1wao_1 477 Serine/threonine protein phosphatase 5; hydrolase, 93.07
2vyi_A131 SGTA protein; chaperone, TPR repeat, phosphoprotei 92.84
3cv0_A 327 Peroxisome targeting signal 1 receptor PEX5; TPR m 92.64
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 92.44
2lni_A133 Stress-induced-phosphoprotein 1; structural genomi 92.4
3qww_A433 SET and MYND domain-containing protein 2; methyltr 92.29
2dba_A148 Smooth muscle cell associated protein-1, isoform 2 92.16
2h6f_A382 Protein farnesyltransferase/geranylgeranyltransfer 92.11
2if4_A338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 92.03
2vsy_A 568 XCC0866; transferase, glycosyl transferase, GT-B, 92.02
2fbn_A198 70 kDa peptidylprolyl isomerase, putative; sulfur 91.25
1a17_A166 Serine/threonine protein phosphatase 5; hydrolase, 91.17
2yhc_A225 BAMD, UPF0169 lipoprotein YFIO; essential BAM comp 90.8
1pc2_A152 Mitochondria fission protein; unknown function; NM 90.53
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 89.97
3n71_A490 Histone lysine methyltransferase SMYD1; heart deve 89.78
4g1t_A472 Interferon-induced protein with tetratricopeptide 89.78
3k9i_A117 BH0479 protein; putative protein binding protein, 89.73
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 89.61
2pzi_A681 Probable serine/threonine-protein kinase PKNG; ATP 89.29
2ooe_A530 Cleavage stimulation factor 77 kDa subunit; HAT do 89.27
3rkv_A162 Putative peptidylprolyl isomerase; structural geno 88.9
4g1t_A 472 Interferon-induced protein with tetratricopeptide 88.75
2l6j_A111 TPR repeat-containing protein associated with HSP; 88.25
3ma5_A100 Tetratricopeptide repeat domain protein; NESG, str 87.61
3qwp_A429 SET and MYND domain-containing protein 3; SMYD3,SE 87.53
3mkr_A291 Coatomer subunit epsilon; tetratricopeptide repeat 86.95
1ouv_A273 Conserved hypothetical secreted protein; TPR repea 85.55
2hr2_A159 Hypothetical protein; alpha-alpha superhelix fold, 84.74
1na3_A91 Designed protein CTPR2; de novo protein; HET: IPT; 83.97
2c2l_A 281 CHIP, carboxy terminus of HSP70-interacting protei 83.8
1p5q_A336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 82.99
1nzn_A126 CGI-135 protein, fission protein FIS1P; TPR, unkno 82.78
4b4t_T274 26S proteasome regulatory subunit RPN12; hydrolase 80.93
2e2e_A177 Formate-dependent nitrite reductase complex NRFG; 80.76
2ond_A308 Cleavage stimulation factor 77 kDa subunit; HAT do 80.37
3o48_A134 Mitochondria fission 1 protein; tetratricopeptide 80.37
>4b4t_S RPN3, 26S proteasome regulatory subunit RPN3; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
Probab=100.00  E-value=1.4e-64  Score=476.44  Aligned_cols=230  Identities=39%  Similarity=0.664  Sum_probs=191.6

Q ss_pred             ccccccccchhhhHHHHHHHHHHHHHhhcccHH----------HHHHHHHHHHHHHhhcCCcchhHHHHHHHHHHHHhcC
Q psy9817           2 SKITSENRRTSDLIAAKCYFYHSRVHELTNNLD----------KVRSFLNARLRIATLRNDFEGQAVLINCLLRNYLHYN   71 (231)
Q Consensus         2 ~~~~~~~~r~~d~~~ak~~~y~~~~~e~~~~l~----------~i~~~l~~~~r~~~lr~d~~~~~~l~N~Llr~Yf~~~   71 (231)
                      +++++.|||+||.++||+|||||++||+++.+.          +||+.|++++|||++|||++||++++|+|+|+|++.|
T Consensus       166 ~~l~~~nrrtlD~l~ak~~fY~s~~~e~~~~~~~~~~~~~~~~~ir~~Ll~~~rta~lr~D~~~qa~l~nllLRnYL~~~  245 (523)
T 4b4t_S          166 NLLCYYNLRSLNLINAKLWFYIYLSHETLARSSEEINSDNQNIILRSTMMKFLKIASLKHDNETKAMLINLILRDFLNNG  245 (523)
T ss_dssp             -------------------------------------CHHHHHHHHTHHHHHHHHCCSCSSSCHHHHHHHHHHHHHHHSS
T ss_pred             HHHHHHhHHhHHHHHHHHHHHHHHHHHHhcccccccccccchhhHHHHHHHHHHHHhcccCcchhHHHHHHHHHHHHccC
Confidence            578999999999999999999999999988775          4999999999999999999999999999999999999


Q ss_pred             ChhhHHhhhhccCCCCC-CCchhhHHHHhhHHHHHHHhhcHHHHHHHHHHHHHhCChh-hhhhHHHHHHHHHHHHHHhcC
Q psy9817          72 LYDQADKLVKKSAFPEN-ASNNEWARFHFYLGRIKAVRLEYSTAHKNLVQALRKAPQT-AAVGFRQTTQKLAVVVELLLG  149 (231)
Q Consensus        72 ~~~~a~~l~~~~~~p~~-~~~~~~v~Y~YY~Gri~~~~~~y~~A~~~L~~A~~~~p~~-~~~~~~~~ilk~lI~v~LllG  149 (231)
                      .|++|.++++++.||+. ++++|+++|+||+||+++++++|++|+++|++|+++||++ .+.||++.++|++|||+||+|
T Consensus       246 ~y~qA~~lvsk~~fP~~~~sn~q~~rY~YY~GRI~a~q~~Y~eA~~~L~~A~rkap~~~~a~gfr~~a~K~lI~V~LLlG  325 (523)
T 4b4t_S          246 EVDSASDFISKLEYPHTDVSSSLEARYFFYLSKINAIQLDYSTANEYIIAAIRKAPHNSKSLGFLQQSNKLHCCIQLLMG  325 (523)
T ss_dssp             CSTTHHHHHHHHCSCTTTSCHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHTSSCSCSSSCSHHHHHHHHHHHHHHHHHT
T ss_pred             cHHHHHHHHhcCcCCcccCCHHHHHHHHHHHHHHHHHhccHHHHHHHHHHHHHhCCcchhhhhHHHHHHHHHHhHHhhcC
Confidence            99999999999999986 7889999999999999999999999999999999999986 467999999999999999999


Q ss_pred             CCCCHHHhhHHHHhhcccchHHHHHHHHcCCHHHHHHHHHHcchhhhhcchHHHHHHHHHHHHHHHHHHHHHHhccccCC
Q psy9817         150 DIPDRQIFRQAVLRRALSPYFQLTQAVRMGELQKFNEVLTTYGNQFRTDYTFKLILRLRHNVIKTAIRSIGASYSRITPA  229 (231)
Q Consensus       150 ~iP~~~ll~~~~~~~~L~~Y~~L~~AVr~Gdl~~F~~~l~~~~~~f~~dg~y~Lv~rlr~~v~R~liRki~l~YsrIsl~  229 (231)
                      ++|++++|.++.+++.|.||.+|++|||.||+.+|++++++|+.+|.+||||+||+||+++|+|++||+++++|||||++
T Consensus       326 ~iP~r~lf~q~~l~~~L~pY~~Lv~Avr~GdL~~F~~~L~~h~~~F~~Dgty~LI~rLr~~vir~~irkis~~YsrIsL~  405 (523)
T 4b4t_S          326 DIPELSFFHQSNMQKSLLPYYHLTKAVKLGDLKKFTSTITKYKQLLLKDDTYQLCVRLRSNVIKTGIRIISLTYKKISLR  405 (523)
T ss_dssp             CCCCHHHHTTTSCHHHHHHHHHHHHHHHHTCHHHHHHHHHHTHHHHHHTTCTHHHHHHHHHHHHHHHHHSCCCSSEECHH
T ss_pred             CCCChHHhhchhHHHHHHHHHHHHHHHHcCCHHHHHHHHHHhcceeccCChhHHHHHHHHHHHHHHHHHHHHHHhcccHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999998


Q ss_pred             CC
Q psy9817         230 KI  231 (231)
Q Consensus       230 di  231 (231)
                      ||
T Consensus       406 dI  407 (523)
T 4b4t_S          406 DI  407 (523)
T ss_dssp             HH
T ss_pred             HH
Confidence            86
>3t5v_B Nuclear mRNA export protein THP1; PCI, mRNA nuclear export, mRNA, nuclear, transcription; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>3t5x_A PCI domain-containing protein 2; PCI, mRNA nuclear export, transcription; 2.12A {Homo sapiens} Back     alignment and structure
>3txn_A 26S proteasome regulatory complex subunit P42B; PCI domain, alpha solenoid, regulatory PART LID, hydrolase, protein binding; 2.50A {Drosophila melanogaster} PDB: 3txm_A Back     alignment and structure
>4b0z_A RPN12, 26S proteasome regulatory subunit RPN12; protein binding, proteasome ubitquitin; HET: SGM GOL; 1.58A {Schizosaccharomyces pombe} Back     alignment and structure
>4b4t_P 26S proteasome regulatory subunit RPN5; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4b4t_O 26S proteasome regulatory subunit RPN9; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>4b4t_R RPN7, 26S proteasome regulatory subunit RPN7; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>3ro3_A PINS homolog, G-protein-signaling modulator 2; asymmetric cell division, protein binding; 1.10A {Mus musculus} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3gw4_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, no structural genomics consortium, NESG, DRR162B; 2.49A {Deinococcus radiodurans R1} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>3ro2_A PINS homolog, G-protein-signaling modulator 2; TPR repeat, protein-protein interaction, protein-binding, PR binding; 2.30A {Mus musculus} Back     alignment and structure
>3ulq_A Response regulator aspartate phosphatase F; tetratricopeptide repeat, response regulator helix-turn-HELX binding, 3-helix bundle; 2.30A {Bacillus subtilis} Back     alignment and structure
>3sf4_A G-protein-signaling modulator 2; tetratricopeptide repeat, TPR, cell polarity, asymmetric CEL division, mitotic spindle orientation; 2.60A {Homo sapiens} Back     alignment and structure
>4a1s_A PINS, partner of inscuteable; cell cycle, LGN, mitotic spindle orientation, asymmetric CEL divisions; 2.10A {Drosophila melanogaster} Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>3q15_A PSP28, response regulator aspartate phosphatase H; tetratricopeptide repeat, 3-helix bundle, phosphorelay signa transduction, phosphatase; 2.19A {Bacillus subtilis} Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>3nf1_A KLC 1, kinesin light chain 1; TPR, structural genomics consortium (SGC), motor PR transport protein; 2.80A {Homo sapiens} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3u3w_A Transcriptional activator PLCR protein; ternary complex, PLCR-PAPR7-DNA, HTH DNA-binding domain, QUO sensing; 2.40A {Bacillus thuringiensis} PDB: 2qfc_A Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1qqe_A Vesicular transport protein SEC17; helix-turn-helix TPR-like repeat, protein transport; 2.90A {Saccharomyces cerevisiae} SCOP: a.118.8.1 Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2qfc_A PLCR protein; TPR, HTH, transcription regulation; 2.60A {Bacillus thuringiensis serovar ISRAELE35646} Back     alignment and structure
>3edt_B KLC 2, kinesin light chain 2; superhelical, structural genomics, structural genomics conso SGC, microtubule, motor protein, phosphoprotein; 2.70A {Homo sapiens} PDB: 3ceq_A Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>4b4t_Q 26S proteasome regulatory subunit RPN6; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>2ifu_A Gamma-SNAP; membrane fusion, snare complex disassembly, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; HET: MSE; 2.60A {Danio rerio} Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>3uq3_A Heat shock protein STI1; HSP90, peptide binding, chaperone; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1ihg_A Cyclophilin 40; ppiase immunophilin tetratricopeptide, isomerase; 1.80A {Bos taurus} SCOP: a.118.8.1 b.62.1.1 PDB: 1iip_A Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>3vtx_A MAMA; tetratricopeptide repeats (TPR) containing protein, peptide protein, protein binding; 1.75A {Candidatus magnetobacterium bavaricum} PDB: 3vty_A Back     alignment and structure
>4i17_A Hypothetical protein; TPR repeats protein, structural genomics, joint center for S genomics, JCSG, protein structure initiative; HET: MSE; 1.83A {Bacteroides fragilis} Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2fo7_A Synthetic consensus TPR protein; tetratricopeptide repeat, consensus protein, superhelix, de novo protein; 2.30A {Synthetic} SCOP: k.38.1.1 PDB: 2hyz_A Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2vq2_A PILW, putative fimbrial biogenesis and twitching motility protein; secretin, TPR repeat, type IV pilus, bacterail virulence; 1.54A {Neisseria meningitidis} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>2ho1_A Type 4 fimbrial biogenesis protein PILF; type IV pilus biogenesis, TPR, superhelix, protein binding; HET: MSE; 2.00A {Pseudomonas aeruginosa} PDB: 2fi7_A Back     alignment and structure
>1hh8_A P67PHOX, NCF-2, neutrophil cytosol factor 2; cell cycle, phagocyte oxidase factor, SH3 domain, repeat, TPR repeat cell cycle; HET: FLC; 1.8A {Homo sapiens} SCOP: a.118.8.1 PDB: 1wm5_A 1e96_B* Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3as5_A MAMA; tetratricopeptide repeats (TPR) containing protein, TPR PROT protein-protein interactions, protein binding; 2.00A {Magnetospirillum magnetotacticum} PDB: 3as4_A 3asd_A 3asg_A 3ash_A 3as8_A 3asf_A Back     alignment and structure
>2kc7_A BFR218_protein; tetratricopeptide repeat, all-alpha, GFT-structural genomics, PSI-2, protein structure initiative; NMR {Bacteroides fragilis} Back     alignment and structure
>3qky_A Outer membrane assembly lipoprotein YFIO; membrane protein; 2.15A {Rhodothermus marinus} Back     alignment and structure
>2kat_A Uncharacterized protein; NESG, structure, structural genomics, PSI-2, protein structure initiative; NMR {Bordetella parapertussis} Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>4eqf_A PEX5-related protein; accessory protein, tetratricopeptide repeat, TPR; 3.00A {Mus musculus} Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2q7f_A YRRB protein; TPR, protein binding; 2.49A {Bacillus subtilis} SCOP: k.38.1.1 Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>3hym_B Cell division cycle protein 16 homolog; APC, anaphase promoting complex, cell cycle, mitosis, cyclosome, TPR, ubiquitin, ubiquitin ligase, twinning; 2.80A {Homo sapiens} Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1hz4_A MALT regulatory protein; two-helix bundles, helix repeats, protein superhelix, transc activator; 1.45A {Escherichia coli} SCOP: a.118.8.2 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>4ga2_A E3 SUMO-protein ligase ranbp2; TPR motif, nuclear pore complex component nucleocytoplasmic transport, transport protein; 0.95A {Pan troglodytes} PDB: 4ga0_A 4ga1_A* Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>1fch_A Peroxisomal targeting signal 1 receptor; protein-peptide complex, tetratricopeptide repeat, TPR, helical repeat, signaling protein; 2.20A {Homo sapiens} SCOP: a.118.8.1 PDB: 2j9q_A 3imz_B* 3r9a_B* 2c0m_A 2c0l_A Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>3u4t_A TPR repeat-containing protein; structural genomics, PSI- protein structure initiative, northeast structural genomics consortium, NESG; 2.28A {Cytophaga hutchinsonii} Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>2pl2_A Hypothetical conserved protein TTC0263; TPR, protein binding; 2.50A {Thermus thermophilus} Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>2xev_A YBGF; tetratricopeptide, alpha-helical, metal binding; 1.57A {Xanthomonas campestris} Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4gcn_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; HET: PGE; 1.85A {Caenorhabditis elegans} Back     alignment and structure
>2v5f_A Prolyl 4-hydroxylase subunit alpha-1; endoplasmic reticulum, metal-binding, oxidoreductase; 2.03A {Homo sapiens} PDB: 1tjc_A Back     alignment and structure
>4gco_A Protein STI-1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, tetratricopeptide repeat domain; 1.60A {Caenorhabditis elegans} Back     alignment and structure
>3sz7_A HSC70 cochaperone (SGT); TPR domain, GET4, GET5, GET3, MDY2, SSA1, SSE1, chaperone regulator; 1.72A {Aspergillus fumigatus} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>3ieg_A DNAJ homolog subfamily C member 3; TPR motif, chaperone, endoplasmic reticulum, TPR repeat, UNF protein response; 2.51A {Mus musculus} Back     alignment and structure
>2xpi_A Anaphase-promoting complex subunit CUT9; cell cycle, TPR, ubiquitin ligase; 2.60A {Schizosaccharomyces pombe} Back     alignment and structure
>3mv2_B Coatomer subunit epsilon; vesicular membrane coat COAT protein complex I, protein TRAN; 2.90A {Saccharomyces cerevisiae} PDB: 3mv3_B Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>3fp2_A TPR repeat-containing protein YHR117W; TOM71, mitochondria translocation, allosteric REG phosphoprotein, TPR repeat, ATP-binding; 1.98A {Saccharomyces cerevisiae} PDB: 3fp3_A 3fp4_A 3lca_A Back     alignment and structure
>2y4t_A DNAJ homolog subfamily C member 3; chaperone, endoplasmic reticulum, protein folding, tetratricopeptiderepeat, J domain, unfolded protein respons; 3.00A {Homo sapiens} PDB: 2y4u_A Back     alignment and structure
>1elr_A TPR2A-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, protein binding, chaperone; 1.90A {Homo sapiens} SCOP: a.118.8.1 PDB: 3esk_A 3fwv_A Back     alignment and structure
>4gyw_A UDP-N-acetylglucosamine--peptide N- acetylglucosaminyltransferase 110 kDa subunit...; GT-B, glycosyltransferase, glcnacylation, transferase-peptid; HET: UDP NAG; 1.70A {Homo sapiens} PDB: 3pe3_A* 3pe4_A* 4ay5_A* 4ay6_A* 3tax_A* 4gyy_A* 4gz3_A* 4gz5_A* 4gz6_A* Back     alignment and structure
>1w3b_A UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase 110; OGT, glcnac, nucleoporin, O-linked glycosylation, TPR repeat, protein binding; 2.85A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>3gyz_A Chaperone protein IPGC; asymmetric homodimer, tetratricopeptide repeat, TPR, chapero virulence; 2.15A {Shigella flexneri} PDB: 3gz1_A 3gz2_A 3ks2_A Back     alignment and structure
>1hxi_A PEX5, peroxisome targeting signal 1 receptor PEX5; alpha helical, transport protein; 1.60A {Trypanosoma brucei} SCOP: a.118.8.1 Back     alignment and structure
>3q49_B STIP1 homology and U box-containing protein 1; E3 ubiquitin ligase, ligase-chaperone complex; 1.54A {Mus musculus} PDB: 3q47_B 3q4a_B* Back     alignment and structure
>1xnf_A Lipoprotein NLPI; TPR, tetratricopeptide, structural genomi unknown function; 1.98A {Escherichia coli} SCOP: a.118.8.1 Back     alignment and structure
>2gw1_A Mitochondrial precursor proteins import receptor; TPR, protein transport; 3.00A {Saccharomyces cerevisiae} Back     alignment and structure
>2xcb_A PCRH, regulatory protein PCRH; protein transport, bacterial toxin, type III secretion, protein binding; 1.85A {Pseudomonas aeruginosa} PDB: 2xcc_A Back     alignment and structure
>3urz_A Uncharacterized protein; tetratricopeptide repeats (TPR) containing protein, structur genomics, joint center for structural genomics, JCSG; HET: PG4; 2.19A {Bacteroides ovatus} Back     alignment and structure
>1elw_A TPR1-domain of HOP; HOP, TPR-domain, peptide-complex, helical repeat, HSP70, protein binding, chaperone; 1.60A {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>4abn_A Tetratricopeptide repeat protein 5; P53 cofactor, stress-response, DNA repair, gene regulation; 2.05A {Mus musculus} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2kck_A TPR repeat; tetratricopeptide repeat, structural genomics, unknown function, PSI-2, protein structure initiative; NMR {Methanococcus maripaludis} Back     alignment and structure
>1na0_A Designed protein CTPR3; de novo protein; HET: IPT; 1.60A {Unidentified} SCOP: k.38.1.1 PDB: 2wqh_A 3kd7_A Back     alignment and structure
>2vgx_A Chaperone SYCD; alternative dimer assembly, tetratricopeptide repeat, type III secretion; HET: MLY; 1.95A {Yersinia enterocolitica} SCOP: k.38.1.1 PDB: 2vgx_B* 2vgy_A* Back     alignment and structure
>3upv_A Heat shock protein STI1; TPR-fold, adaptor protein for HSP70 and HSP90, C-terminal PA HSP70, peptide binding protein; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1wao_1 Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, super-helix,; 2.9A {Homo sapiens} SCOP: a.118.8.1 d.159.1.3 Back     alignment and structure
>2vyi_A SGTA protein; chaperone, TPR repeat, phosphoprotein, tetratricopeptide repeat protein, HOST-virus interaction; 2.4A {Homo sapiens} SCOP: k.38.1.1 Back     alignment and structure
>3cv0_A Peroxisome targeting signal 1 receptor PEX5; TPR motifs, TPR protein, peroxin 5, PEX5, PTS1 binding domain, protein-peptide complex, receptor; 2.00A {Trypanosoma brucei} PDB: 3cvl_A 3cvn_A 3cvp_A 3cvq_A Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>2lni_A Stress-induced-phosphoprotein 1; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, chaperone; NMR {Homo sapiens} Back     alignment and structure
>3qww_A SET and MYND domain-containing protein 2; methyltransferase, HSP90, transferase-transferase inhibitor; HET: SFG; 1.80A {Mus musculus} PDB: 3qwv_A* 3s7d_A* 3s7b_A* 3s7f_A* 3s7j_A* 3tg4_A* 3tg5_A* 3rib_A* Back     alignment and structure
>2dba_A Smooth muscle cell associated protein-1, isoform 2; tetratricopeptide repeat, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2h6f_A Protein farnesyltransferase/geranylgeranyltransferase type I alpha subunit; ftase, farnesyltransferase, farnesyl transferase, prenyltransferase, CAAX, RAS, lipid modification, prenylation; HET: SUC FAR; 1.50A {Homo sapiens} SCOP: a.118.6.1 PDB: 1jcq_A* 1ld7_A* 1mzc_A* 1s63_A* 1sa4_A* 1tn6_A* 1ld8_A* 2h6g_A* 2h6h_A* 2h6i_A* 2iej_A* 3e37_A* 2f0y_A* 3ksl_A* 2zir_A* 2zis_A* 1o5m_A* 3ksq_A* 1o1t_A* 1o1s_A* ... Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>2vsy_A XCC0866; transferase, glycosyl transferase, GT-B, OGT, protein O-GLCN; HET: NHE; 2.10A {Xanthomonas campestris PV} PDB: 2jlb_A* 2xgm_A* 2xgo_A* 2xgs_A* 2vsn_A* Back     alignment and structure
>2fbn_A 70 kDa peptidylprolyl isomerase, putative; sulfur SAD, PFL2275C, TPR-containing domain, structural genomics; 1.63A {Plasmodium falciparum} SCOP: a.118.8.1 Back     alignment and structure
>1a17_A Serine/threonine protein phosphatase 5; hydrolase, protein-protein interactions, TPR, S helix; 2.45A {Homo sapiens} SCOP: a.118.8.1 PDB: 2bug_A Back     alignment and structure
>2yhc_A BAMD, UPF0169 lipoprotein YFIO; essential BAM component, membrane protein; 1.80A {Escherichia coli} PDB: 3tgo_A 3q5m_A Back     alignment and structure
>1pc2_A Mitochondria fission protein; unknown function; NMR {Homo sapiens} SCOP: a.118.8.1 Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>3n71_A Histone lysine methyltransferase SMYD1; heart development, transcription; HET: SFG MES; 2.30A {Mus musculus} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>3k9i_A BH0479 protein; putative protein binding protein, structural genomics, joint for structural genomics, JCSG; 2.71A {Bacillus halodurans} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} Back     alignment and structure
>2ooe_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 3.00A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3rkv_A Putative peptidylprolyl isomerase; structural genomics, APC102156, PSI-biology, midwest center structural genomics, MCSG; 2.41A {Caenorhabditis elegans} Back     alignment and structure
>4g1t_A Interferon-induced protein with tetratricopeptide 2; ISG, all alpha helix, antivirus, antiviral protein; 2.80A {Homo sapiens} Back     alignment and structure
>2l6j_A TPR repeat-containing protein associated with HSP; tetratricopeptide repeat (TPR), HSP90 CO-factor, protein BIN; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3ma5_A Tetratricopeptide repeat domain protein; NESG, structural genomics, PSI-2, protein structure initiative; 2.80A {Salinibacter ruber} PDB: 2kcl_A 2kcv_A Back     alignment and structure
>3qwp_A SET and MYND domain-containing protein 3; SMYD3,SET and MYND domain, zinc finger MYND domain-containin 1, structural genomics; HET: SAM; 1.53A {Homo sapiens} PDB: 3mek_A* 3oxg_A* 3oxf_A* 3pdn_A* 3oxl_A* 3ru0_A* Back     alignment and structure
>3mkr_A Coatomer subunit epsilon; tetratricopeptide repeats (TPR), beta-hairpin, alpha-solenoi transport protein; 2.60A {Bos taurus} Back     alignment and structure
>1ouv_A Conserved hypothetical secreted protein; TPR repeat, HCP repeat, cysteine rich protein, loop-helix-TU repeat protein, hydrolase; 2.00A {Helicobacter pylori} SCOP: a.118.18.1 Back     alignment and structure
>2hr2_A Hypothetical protein; alpha-alpha superhelix fold, structural genomics, joint CENT structural genomics, JCSG, protein structure initiative; 2.54A {Chlorobium tepidum} SCOP: a.118.8.8 Back     alignment and structure
>1na3_A Designed protein CTPR2; de novo protein; HET: IPT; 1.55A {Unidentified} SCOP: k.38.1.1 PDB: 2avp_A Back     alignment and structure
>2c2l_A CHIP, carboxy terminus of HSP70-interacting protein; chaperone, E3 ligase, ubiquitinylation, TPR, heat-shock protein complex; 3.3A {Mus musculus} SCOP: a.118.8.1 g.44.1.2 Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1nzn_A CGI-135 protein, fission protein FIS1P; TPR, unknown function; 2.00A {Homo sapiens} SCOP: a.118.8.1 PDB: 1iyg_A Back     alignment and structure
>4b4t_T 26S proteasome regulatory subunit RPN12; hydrolase, AAA-atpases, protein degradation, ubiquitin-prote pathway; 7.40A {Saccharomyces cerevisiae} Back     alignment and structure
>2e2e_A Formate-dependent nitrite reductase complex NRFG; TPR, cytochrome C biogenesis, O157:H7 EDL933, formate- nitrite reductase complex, lyase; 2.05A {Escherichia coli} Back     alignment and structure
>2ond_A Cleavage stimulation factor 77 kDa subunit; HAT domain, structural protein; 2.80A {Mus musculus} SCOP: a.118.8.7 Back     alignment and structure
>3o48_A Mitochondria fission 1 protein; tetratricopeptide repeat fold, TPR, scaffold, peroxisome, membrane fission, protein binding; 1.75A {Saccharomyces cerevisiae} PDB: 2pqr_A 2pqn_A 3uux_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query231
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 98.11
d1qqea_290 Vesicular transport protein sec17 {Baker's yeast ( 96.6
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 96.48
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 96.43
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 96.26
d1hz4a_366 Transcription factor MalT domain III {Escherichia 95.99
d1nzna_122 Mitochondria fission protein Fis1 {Human (Homo sap 95.56
d2fbna1153 Putative 70 kda peptidylprolyl isomerase PFL2275c 95.54
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 95.53
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 95.49
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 95.37
d1hz4a_366 Transcription factor MalT domain III {Escherichia 95.34
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 95.29
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 95.17
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 95.14
d1ihga1169 Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} 94.94
d2hr2a1156 Hypothetical protein CT2138 {Chlorobium tepidum [T 94.87
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 94.45
d1hxia_112 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 94.22
d1a17a_159 Protein phosphatase 5 {Human (Homo sapiens) [TaxId 94.08
d2pqrb1124 Mitochondria fission protein Fis1 {Baker's yeast ( 93.85
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 93.76
d1w3ba_388 O-GlcNAc transferase p110 subunit, OGT {Human (Hom 93.73
d1xnfa_259 Lipoprotein NlpI {Escherichia coli [TaxId: 562]} 93.47
d1hh8a_192 Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {H 93.31
d1elwa_117 Hop {Human (Homo sapiens) [TaxId: 9606]} 93.2
d1fcha_323 Peroxin pex5 (peroxisomal targeting signal 1 (PTS1 92.67
d2c2la1201 STIP1 homology and U box-containing protein 1, STU 92.65
d1tjca_95 Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human 91.34
d1elra_128 Hop {Human (Homo sapiens) [TaxId: 9606]} 90.57
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 89.01
d2h6fa1315 Protein farnesyltransferase alpha-subunit {Human ( 88.01
d2onda1308 Cleavage stimulation factor 77 kDa subunit CSTF3 { 87.46
d1zbpa1264 Hypothetical protein VPA1032 {Vibrio parahaemolyti 87.46
d1p5qa1170 FKBP52 (FKBP4), C-terminal domain {Human (Homo sap 85.98
d1kt1a1168 FKBP51, C-terminal domain {Monkey (Saimiri bolivie 82.8
d1om2a_95 Mitochondrial import receptor subunit Tom20 {Rat ( 82.43
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All alpha proteins
fold: alpha-alpha superhelix
superfamily: TPR-like
family: Tetratricopeptide repeat (TPR)
domain: Vesicular transport protein sec17
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=98.11  E-value=5.2e-05  Score=62.76  Aligned_cols=193  Identities=14%  Similarity=0.088  Sum_probs=128.9

Q ss_pred             HHHHHHHHHHHHhhcccHHHHHHHHHHHHHHHhhcCCcchhHHHHHHHHHHHHh-cCChhhHHhhhhcc--CCCCCCCch
Q psy9817          16 AAKCYFYHSRVHELTNNLDKVRSFLNARLRIATLRNDFEGQAVLINCLLRNYLH-YNLYDQADKLVKKS--AFPENASNN   92 (231)
Q Consensus        16 ~ak~~~y~~~~~e~~~~l~~i~~~l~~~~r~~~lr~d~~~~~~l~N~Llr~Yf~-~~~~~~a~~l~~~~--~~p~~~~~~   92 (231)
                      +|++|.=.+.++...+..+.....+-.++......++..........+-.+|.. .+.++.|.....++  ..+......
T Consensus        76 ~a~~~~~~g~~y~~~~~~~~A~~~~~~a~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~A~~~~~~A~~l~~~~~~~~  155 (290)
T d1qqea_          76 AGNTYVEAYKCFKSGGNSVNAVDSLENAIQIFTHRGQFRRGANFKFELGEILENDLHDYAKAIDCYELAGEWYAQDQSVA  155 (290)
T ss_dssp             HHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHHHHHTTCCHHHHHHHHHHHHHHHHHTTCHH
T ss_pred             HHHHHHHHHHHHHHhCCcHHHHHHHHHhhHHhhhcccchhHHHHHHHHHHhHhhHHHHHHHHHHHHHHHHHHHHhcCchh
Confidence            577788888888888888887777766666555455556666667777777865 69999999888543  123223345


Q ss_pred             hhHHHHhhHHHHHHHhhcHHHHHHHHHHHHHhCChhh-hhhHHHHHHHHHHHHHHhcCCCCCHH-HhhH-----HHHhhc
Q psy9817          93 EWARFHFYLGRIKAVRLEYSTAHKNLVQALRKAPQTA-AVGFRQTTQKLAVVVELLLGDIPDRQ-IFRQ-----AVLRRA  165 (231)
Q Consensus        93 ~~v~Y~YY~Gri~~~~~~y~~A~~~L~~A~~~~p~~~-~~~~~~~ilk~lI~v~LllG~iP~~~-ll~~-----~~~~~~  165 (231)
                      ...+.+.-.|.++.-+++|.+|.+.++.+....|... ........+-..+.+.+..|+..... .+.+     |.+...
T Consensus       156 ~~~~~~~~la~~~~~~g~y~~A~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~d~~~A~~~~~~~~~~~~~~~~s  235 (290)
T d1qqea_         156 LSNKCFIKCADLKALDGQYIEASDIYSKLIKSSMGNRLSQWSLKDYFLKKGLCQLAATDAVAAARTLQEGQSEDPNFADS  235 (290)
T ss_dssp             HHHHHHHHHHHHHHHTTCHHHHHHHHHHHHHTTSSCTTTGGGHHHHHHHHHHHHHHTTCHHHHHHHHHGGGCC-------
T ss_pred             hhhhHHHHHHHHHHHcChHHHHHHHHHHHHHhCccchhhhhhHHHHHHHHHHHHHHhccHHHHHHHHHHHHHhCCCccch
Confidence            6677788899999999999999999999999887642 12223344445555667778765542 2221     111110


Q ss_pred             --ccchHHHHHHHHcCCHHHHHHHHHHcchhhhhcchHH-HHHHHH
Q psy9817         166 --LSPYFQLTQAVRMGELQKFNEVLTTYGNQFRTDYTFK-LILRLR  208 (231)
Q Consensus       166 --L~~Y~~L~~AVr~Gdl~~F~~~l~~~~~~f~~dg~y~-Lv~rlr  208 (231)
                        ..-...|+.|+..||+.+|.+++..+.+...-|.... ++.|++
T Consensus       236 re~~~l~~l~~a~~~~d~e~~~eai~~y~~~~~lD~~~~~~L~~~k  281 (290)
T d1qqea_         236 RESNFLKSLIDAVNEGDSEQLSEHCKEFDNFMRLDKWKITILNKIK  281 (290)
T ss_dssp             --HHHHHHHHHHHHTTCTTTHHHHHHHHTTSSCCCHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHHHhcCHHHHHHHHHHHHHHhhcCHHHHHHHHHHH
Confidence              0113578899999999999999998876444454322 444443
>d1qqea_ a.118.8.1 (A:) Vesicular transport protein sec17 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nzna_ a.118.8.1 (A:) Mitochondria fission protein Fis1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fbna1 a.118.8.1 (A:22-174) Putative 70 kda peptidylprolyl isomerase PFL2275c {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1hz4a_ a.118.8.2 (A:) Transcription factor MalT domain III {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ihga1 a.118.8.1 (A:197-365) Cyclophilin 40 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2hr2a1 a.118.8.8 (A:2-157) Hypothetical protein CT2138 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hxia_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1a17a_ a.118.8.1 (A:) Protein phosphatase 5 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2pqrb1 a.118.8.1 (B:5-128) Mitochondria fission protein Fis1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1w3ba_ a.118.8.1 (A:) O-GlcNAc transferase p110 subunit, OGT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xnfa_ a.118.8.1 (A:) Lipoprotein NlpI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hh8a_ a.118.8.1 (A:) Neutrophil cytosolic factor 2 (NCF-2, p67-phox) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elwa_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fcha_ a.118.8.1 (A:) Peroxin pex5 (peroxisomal targeting signal 1 (PTS1) receptor) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c2la1 a.118.8.1 (A:24-224) STIP1 homology and U box-containing protein 1, STUB1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tjca_ a.118.8.1 (A:) Prolyl 4-hydroxylase alpha-1 subunit, P4HA1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1elra_ a.118.8.1 (A:) Hop {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2h6fa1 a.118.6.1 (A:55-369) Protein farnesyltransferase alpha-subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2onda1 a.118.8.7 (A:242-549) Cleavage stimulation factor 77 kDa subunit CSTF3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zbpa1 e.61.1.1 (A:2-265) Hypothetical protein VPA1032 {Vibrio parahaemolyticus [TaxId: 670]} Back     information, alignment and structure
>d1p5qa1 a.118.8.1 (A:258-427) FKBP52 (FKBP4), C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a1 a.118.8.1 (A:254-421) FKBP51, C-terminal domain {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1om2a_ a.23.4.1 (A:) Mitochondrial import receptor subunit Tom20 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure