Psyllid ID: psy9822

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380
MSGCRHLYGMSGQVAYTLEPRTVKTDANRTNIKLKTGSSCPLRCDQRTDCQDCLTSSGGEGGWHECRWSSMLNECISPSYEALYCAGGVCGLVLGPHQAPQCPRSCSAYTQCSTCLRHAHCGWCALQRDTTGGMGVCTEGSLNSPSSGPESSTCDILFYQTYPDQVIEVNNNDSFSWNYVKCPPENECLNDHHTCDPQSEQCVDLADGFECVCGRGYNKSEEGGECVPVCSQGCVRGVCSEPDKCQCDFGYVGVNCSIQCQCNGHADCAGPDKLDVCLRCHNHTKGPQCDKCEPLYVGDPRDNGECVPCSEYCNGHTGLCINASLASLPFSPESGGTSELAAFLDEGPTTRARCMHCGNHTTGPKCEDCVEGKENRQSRN
cccccccccccccEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccccccccccccEEcccccccccccccccccccccccccccccccEEcccccccccccccccccccccccccc
cccccEEccEccEEEEEEEccEEEEccccccccccccccccccccccccHHHHHcccccccccccccEcccccccccccccccccccccccccccccccccccccccccccHHHHcccccccccccccccccccEEEEccccccccccccccccccccccccccccccccccccccEEEEccccccccccccccccccccHccccccccEcEcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEcccccccccccHcccccccccccccccccccccccccccccccccccccccccccccccHHcccccccccccccEEEEcccccccccHHHcccccccccccc
msgcrhlygmsgqvaytleprtvktdanrtniklktgsscplrcdqrtdcqdcltssggeggwhecrwssmlnecispsyeALYCAggvcglvlgphqapqcprscsaytqcstclrhahcgwcalqrdttggmgvctegslnspssgpesstcdilfyqtypdqvievnnndsfswnyvkcppeneclndhhtcdpqseqcvdladgfecvcgrgynkseeggecvpvcsqgcvrgvcsepdkcqcdfgyvgvncsiqcqcnghadcagpdkldvclrchnhtkgpqcdkceplyvgdprdngecvpcseycnghtglcinaslaslpfspesggtselaafldegpttrarcmhcgnhttgpkcedcvegkenrqsrn
msgcrhlygmsgqvaytleprtvktdanrtniklktgsscplrcdqRTDCQDCLTSSGGEGGWHECRWSSMLNECISPSYEALYCAGGVCGLVLGPHQAPQCPRSCSAYTQCSTCLRHAHCGWCALQRDTTGGMGVCTEGSLNSPSSGPESSTCDILFYQTYPDQVIEVNNNDSFSWNYVKCPPENECLNDHHTCDPQSEQCVDLADGFECVCGRGYnkseeggecvPVCSQGCVRGVCSEPDKCQCDFGYVGVNCSIQCQCNGHADCAGPDKLDVCLRCHNhtkgpqcdkcePLYVGDPRDNGECVPCSEYCNGHTGLCINASLASLPFSPESGGTSELAAFLDEGPTTRARCMHCGNhttgpkcedcvegkenrqsrn
MSGCRHLYGMSGQVAYTLEPRTVKTDANRTNIKLKTGSSCPLRCDQRTDCQDCLTSSGGEGGWHECRWSSMLNECISPSYEALYCAGGVCGLVLGPHQAPQCPRSCSAYTQCSTCLRHAHCGWCALQRDTTGGMGVCTegslnspssgpessTCDILFYQTYPDQVIEVNNNDSFSWNYVKCPPENECLNDHHTCDPQSEQCVDLADGFECVCGRGYNKSEEGGECVPVCSQGCVRGVCSEPDKCQCDFGYVGVNCSIQCQCNGHADCAGPDKLDVCLRCHNHTKGPQCDKCEPLYVGDPRDNGECVPCSEYCNGHTGLCINASLASLPFSPESGGTSELAAFLDEGPTTRARCMHCGNHTTGPKCEDCVEGKENRQSRN
*****HLYGMSGQVAYTLEPRTVKT***RTNIKLKTGSSCPLRCDQRTDCQDCLTSSGGEGGWHECRWSSMLNECISPSYEALYCAGGVCGLVLGPHQAPQCPRSCSAYTQCSTCLRHAHCGWCALQRDTTGGMGVCT**************TCDILFYQTYPDQVIEVNNNDSFSWNYVKCPPENECLNDHHTCDPQSEQCVDLADGFECVCGRGYNKSEEGGECVPVCSQGCVRGVCSEPDKCQCDFGYVGVNCSIQCQCNGHADCAGPDKLDVCLRCHNHTKGPQCDKCEPLYVGDPRDNGECVPCSEYCNGHTGLCINASLASLP*************FL*******ARCMHCGN*********************
**GCRHLYGMSGQVAYTLEPRTVKT*************SCPLRCDQRTDCQDCLTSSGGEGGWHECRWSSMLNECISPSYEALYCAGGVCGLVLGPHQAPQCPRSCSAYTQCSTCLRHAHCGWCALQRDTTGGMGVCTEGSLNSPSSGPESSTCDILFYQTYPDQVIEVNNNDSFSWNYVKCPPENECLNDHHTCDPQSEQCVDLADGFECVCGRGYNKSEEGGECVPVCSQGCVRGVCSEPDKCQCDFGYVGVNCSIQCQCNGHADCAGPDKLDVCLRCHNHTKGPQCDKCEPLYVGDPRDNGECVPCSEYCNGHTGLCINASLASLPFSPESGGTSELAAFLDEGPTTRARCMHCGNHTTGPKCEDCVEG*EN*****
MSGCRHLYGMSGQVAYTLEPRTVKTDANRTNIKLKTGSSCPLRCDQRTDCQDCLTSSGGEGGWHECRWSSMLNECISPSYEALYCAGGVCGLVLGPHQAPQCPRSCSAYTQCSTCLRHAHCGWCALQRDTTGGMGVCTE************STCDILFYQTYPDQVIEVNNNDSFSWNYVKCPPENECLNDHHTCDPQSEQCVDLADGFECVCGRGYNKSEEGGECVPVCSQGCVRGVCSEPDKCQCDFGYVGVNCSIQCQCNGHADCAGPDKLDVCLRCHNHTKGPQCDKCEPLYVGDPRDNGECVPCSEYCNGHTGLCINASLASLPFSPESGGTSELAAFLDEGPTTRARCMHCGNHTTGPKCE*************
*SGCRHLYGMSGQVAYTLEPRTVKTDA********TGSSCPLRCDQRTDCQDCLTSSGGEGGWHECRWSSMLNECISPSYEALYCAGGVCGLVLGPHQAPQCPRSCSAYTQCSTCLRHAHCGWCALQRDTTGGMGVCTEGSLNSPSSGPESSTCDILFYQTYPDQVIEVNNNDSFSWNYVKCPPENECLNDHHTCDPQSEQCVDLADGFECVCGRGYNKSEEGGECVPVCSQGCVRGVCSEPDKCQCDFGYVGVNCSIQCQCNGHADCAGPDKLDVCLRCHNHTKGPQCDKCEPLYVGDPRDNGECVPCSEYCNGHTGLCINASLASLPFSPESGGTSELAAFLDEGPTTRARCMHCGNHTTGPKCEDCVEGKEN*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
SSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSGCRHLYGMSGQVAYTLEPRTVKTDANRTNIKLKTGSSCPLRCDQRTDCQDCLTSSGGEGGWHECRWSSMLNECISPSYEALYCAGGVCGLVLGPHQAPQCPRSCSAYTQCSTCLRHAHCGWCALQRDTTGGMGVCTEGSLNSPSSGPESSTCDILFYQTYPDQVIEVNNNDSFSWNYVKCPPENECLNDHHTCDPQSEQCVDLADGFECVCGRGYNKSEEGGECVPVCSQGCVRGVCSEPDKCQCDFGYVGVNCSIQCQCNGHADCAGPDKLDVCLRCHNHTKGPQCDKCEPLYVGDPRDNGECVPCSEYCNGHTGLCINASLASLPFSPESGGTSELAAFLDEGPTTRARCMHCGNHTTGPKCEDCVEGKENRQSRN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query380 2.2.26 [Sep-21-2011]
Q9QYP0 2788 Multiple epidermal growth yes N/A 0.810 0.110 0.423 3e-63
Q7Z7M0 2845 Multiple epidermal growth yes N/A 0.810 0.108 0.423 7e-63
P60882 2789 Multiple epidermal growth yes N/A 0.810 0.110 0.420 1e-62
Q9WU60 1428 Attractin OS=Mus musculus no N/A 0.463 0.123 0.308 1e-09
Q99J86 1432 Attractin OS=Rattus norve no N/A 0.463 0.122 0.308 2e-09
O75882 1429 Attractin OS=Homo sapiens no N/A 0.463 0.123 0.303 2e-08
Q19981 1329 Putative protein tag-53 O yes N/A 0.605 0.173 0.246 3e-07
Q5VV63 1379 Attractin-like protein 1 no N/A 0.523 0.144 0.287 7e-07
Q6A051 1378 Attractin-like protein 1 no N/A 0.528 0.145 0.282 9e-07
Q2QI47 5193 Usherin OS=Mus musculus G no N/A 0.257 0.018 0.346 2e-06
>sp|Q9QYP0|MEGF8_RAT Multiple epidermal growth factor-like domains protein 8 OS=Rattus norvegicus GN=Megf8 PE=2 SV=2 Back     alignment and function desciption
 Score =  242 bits (618), Expect = 3e-63,   Method: Compositional matrix adjust.
 Identities = 143/338 (42%), Positives = 185/338 (54%), Gaps = 30/338 (8%)

Query: 40   CPLRCDQRTDCQDCLTSSGGEGGWHECRWSSMLNECISPSYEALYCAGGVCGLVL-GPHQ 98
            CP  C    +C  CL S G +GGW  C WSS L +C+SPSY  L C  G CG +L GP  
Sbjct: 2000 CPTPCHLLPNCTSCLASKGADGGWQHCVWSSSLQQCLSPSYLPLRCMAGGCGRLLRGPES 2059

Query: 99   APQCPRSCSAYTQCSTCLRHAHCGWCALQRDTTGGMGVCTEGSLNSPSSGPESSTCDILF 158
               C   C+  TQC+ CLR  HCGWCA      GG   C EG L+ P  G    TC    
Sbjct: 2060 ---CSLGCAQATQCALCLRRPHCGWCAWGGQDGGGH--CMEGGLSGPRDG---LTC---- 2107

Query: 159  YQTYPDQVIEVNNNDSFSWNYVKCPPENECLNDHHTCDPQSEQCVDLADGFECVCGRGYN 218
                             SW ++ CPPE+EC N HH C+ +++ C D   G+EC C  GY 
Sbjct: 2108 ------------GRPGASWAFLSCPPEDECANGHHDCN-ETQNCHDQPHGYECSCKTGYT 2154

Query: 219  KSEEGGECVPVCSQGCVRGVCSEPDKCQCDFGYVGVNCSIQCQCNGHADCAGPDKLDVCL 278
                 G C PVC+QGCV G C EPD C+C FG+VG NCS +C+CN H++CAG    D CL
Sbjct: 2155 MDNVTGVCRPVCAQGCVNGSCVEPDHCRCHFGFVGRNCSTECRCNRHSECAGVGARDHCL 2214

Query: 279  RCHNHTKGPQCDKCEPLYVGDPRDNGECVPCSEYCNGHTGLCIN-ASLASLPFSPE--SG 335
             C NHTKG  C++C PL+VG     G C PC  +C G++ +C++   L      PE  S 
Sbjct: 2215 LCRNHTKGSHCEQCLPLFVGSALGGGTCRPCHAFCRGNSHVCVSRKELEMARREPEKYSL 2274

Query: 336  GTSELAAFLDEGPTT-RARCMHCGNHTTGPKCEDCVEG 372
               E+ A++ EGP+   A C++C N++ G +CE C+ G
Sbjct: 2275 DPEEIEAWVAEGPSEDEAVCVNCQNNSYGDRCESCLHG 2312

Rattus norvegicus (taxid: 10116)
>sp|Q7Z7M0|MEGF8_HUMAN Multiple epidermal growth factor-like domains protein 8 OS=Homo sapiens GN=MEGF8 PE=1 SV=2 Back     alignment and function description
>sp|P60882|MEGF8_MOUSE Multiple epidermal growth factor-like domains protein 8 OS=Mus musculus GN=Megf8 PE=2 SV=2 Back     alignment and function description
>sp|Q9WU60|ATRN_MOUSE Attractin OS=Mus musculus GN=Atrn PE=2 SV=3 Back     alignment and function description
>sp|Q99J86|ATRN_RAT Attractin OS=Rattus norvegicus GN=Atrn PE=2 SV=1 Back     alignment and function description
>sp|O75882|ATRN_HUMAN Attractin OS=Homo sapiens GN=ATRN PE=1 SV=2 Back     alignment and function description
>sp|Q19981|TAG53_CAEEL Putative protein tag-53 OS=Caenorhabditis elegans GN=tag-53 PE=1 SV=3 Back     alignment and function description
>sp|Q5VV63|ATRN1_HUMAN Attractin-like protein 1 OS=Homo sapiens GN=ATRNL1 PE=2 SV=2 Back     alignment and function description
>sp|Q6A051|ATRN1_MOUSE Attractin-like protein 1 OS=Mus musculus GN=Atrnl1 PE=1 SV=2 Back     alignment and function description
>sp|Q2QI47|USH2A_MOUSE Usherin OS=Mus musculus GN=Ush2A PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query380
380013693 3035 PREDICTED: multiple epidermal growth fac 0.892 0.111 0.561 1e-113
383864510 3039 PREDICTED: LOW QUALITY PROTEIN: multiple 0.902 0.112 0.550 1e-112
345483939 3046 PREDICTED: multiple epidermal growth fac 0.905 0.112 0.547 1e-112
350401390 3022 PREDICTED: multiple epidermal growth fac 0.902 0.113 0.558 1e-112
340729098 3028 PREDICTED: multiple epidermal growth fac 0.902 0.113 0.549 1e-111
322792677 2797 hypothetical protein SINV_14129 [Solenop 0.902 0.122 0.533 1e-110
307200226 3025 Multiple epidermal growth factor-like do 0.902 0.113 0.552 1e-109
170046046 2862 laminin subunit gamma-3 [Culex quinquefa 0.881 0.117 0.562 1e-108
157104723 2895 hypothetical protein AaeL_AAEL014347 [Ae 0.878 0.115 0.553 1e-108
307181027 3047 Multiple epidermal growth factor-like do 0.9 0.112 0.515 1e-106
>gi|380013693|ref|XP_003690884.1| PREDICTED: multiple epidermal growth factor-like domains protein 8 [Apis florea] Back     alignment and taxonomy information
 Score =  414 bits (1064), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 204/363 (56%), Positives = 252/363 (69%), Gaps = 24/363 (6%)

Query: 34   LKTGSS-CPLRCDQRTDCQDCLTSSGGEGGWHECRWSSMLNECISPSYEALYCAGGVCGL 92
            +K GS+ C  RC    DC++CL  +G EGGW ECRWS+ LNECISPSY+ LYCAGGVCGL
Sbjct: 2227 IKMGSTQCEKRCGDHKDCKNCLKGTGAEGGWRECRWSTQLNECISPSYQPLYCAGGVCGL 2286

Query: 93   VLGPHQAPQCPRSCSAYTQCSTCLRHAHCGWCALQRDTTGGMGVCTEGSLNSPSSGPESS 152
            VL       CP  CS + QCSTCL+H+HCGWC+L      G G+CTEGSL +P+  P   
Sbjct: 2287 VLRSSDMDHCPEPCSVFKQCSTCLKHSHCGWCSLDSANITGQGICTEGSLEAPADHPAGG 2346

Query: 153  TCDILFYQTYPD----QVIEVNNNDS-----------FSWNYVKCPPENECLNDHHTCDP 197
            TC++L+YQ  P     + +E+++N +           FSW+YV+CPPENEC N HHTC  
Sbjct: 2347 TCEMLYYQQLPTVELLKFLEISDNVTMLIPNVISKPIFSWHYVRCPPENECTNGHHTCST 2406

Query: 198  QSEQCVDLADGFECVCGRGYNKS-----EEGGE--CVPVCSQGCVRGVCSEPDKCQCDFG 250
            +SE+C DL +GFEC+CG GY         E G   CVP+C+QGCVRG C EP+ C+CDFG
Sbjct: 2407 KSEKCFDLEEGFECMCGDGYKTETPSSFNEFGRKICVPMCTQGCVRGTCIEPNICRCDFG 2466

Query: 251  YVGVNCSIQCQCNGHADCAGPDKLDVCLRCHNHTKGPQCDKCEPLYVGDPRDNGECVPCS 310
            YVG NCSIQCQCNGH++CAGPDKLDVCL CHN+T GPQCDKC PL+VG+P DNG+CVPC 
Sbjct: 2467 YVGANCSIQCQCNGHSNCAGPDKLDVCLECHNNTMGPQCDKCRPLFVGNPADNGQCVPCL 2526

Query: 311  EYCNGHTGLCINASLASL-PFSPESGGTSELAAFLDEGPTTRARCMHCGNHTTGPKCEDC 369
            EYCNGHT +CIN S+    P S E      L   L EGP  +A+C++CGN+T G KC +C
Sbjct: 2527 EYCNGHTRICINESMTVPDPNSIEKMSIELLEKQLVEGPVAKAKCVNCGNNTRGDKCGEC 2586

Query: 370  VEG 372
            + G
Sbjct: 2587 MTG 2589

Source: Apis florea

Species: Apis florea

Genus: Apis

Family: Apidae

Order: Hymenoptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|383864510|ref|XP_003707721.1| PREDICTED: LOW QUALITY PROTEIN: multiple epidermal growth factor-like domains protein 8-like [Megachile rotundata] Back     alignment and taxonomy information
>gi|345483939|ref|XP_001604319.2| PREDICTED: multiple epidermal growth factor-like domains protein 8-like [Nasonia vitripennis] Back     alignment and taxonomy information
>gi|350401390|ref|XP_003486136.1| PREDICTED: multiple epidermal growth factor-like domains protein 8-like [Bombus impatiens] Back     alignment and taxonomy information
>gi|340729098|ref|XP_003402845.1| PREDICTED: multiple epidermal growth factor-like domains protein 8-like [Bombus terrestris] Back     alignment and taxonomy information
>gi|322792677|gb|EFZ16551.1| hypothetical protein SINV_14129 [Solenopsis invicta] Back     alignment and taxonomy information
>gi|307200226|gb|EFN80520.1| Multiple epidermal growth factor-like domains 8 [Harpegnathos saltator] Back     alignment and taxonomy information
>gi|170046046|ref|XP_001850596.1| laminin subunit gamma-3 [Culex quinquefasciatus] gi|167868958|gb|EDS32341.1| laminin subunit gamma-3 [Culex quinquefasciatus] Back     alignment and taxonomy information
>gi|157104723|ref|XP_001648539.1| hypothetical protein AaeL_AAEL014347 [Aedes aegypti] gi|108869145|gb|EAT33370.1| AAEL014347-PA [Aedes aegypti] Back     alignment and taxonomy information
>gi|307181027|gb|EFN68801.1| Multiple epidermal growth factor-like domains 8 [Camponotus floridanus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query380
FB|FBgn0031981 2898 CG7466 [Drosophila melanogaste 0.852 0.111 0.5 4.7e-100
RGD|621190 2788 Megf8 "multiple EGF-like-domai 0.515 0.070 0.447 9.5e-64
UNIPROTKB|F1RGK2 2789 MEGF8 "Uncharacterized protein 0.515 0.070 0.447 1.5e-63
UNIPROTKB|Q7Z7M0 2845 MEGF8 "Multiple epidermal grow 0.515 0.068 0.447 1.6e-63
MGI|MGI:2446294 2789 Megf8 "multiple EGF-like-domai 0.515 0.070 0.442 2e-63
UNIPROTKB|E2RM39 2787 MEGF8 "Uncharacterized protein 0.515 0.070 0.442 5.2e-63
ZFIN|ZDB-GENE-090730-1 2774 megf8 "multiple EGF-like-domai 0.515 0.070 0.437 5.2e-55
UNIPROTKB|E1BPS6 2772 MEGF8 "Uncharacterized protein 0.515 0.070 0.457 5.1e-53
ZFIN|ZDB-GENE-090312-21 1383 atrn "attractin" [Danio rerio 0.565 0.155 0.272 2e-12
UNIPROTKB|Q8MJ16 1415 ATRN "Uncharacterized protein" 0.544 0.146 0.279 2.3e-14
FB|FBgn0031981 CG7466 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 990 (353.6 bits), Expect = 4.7e-100, Sum P(2) = 4.7e-100
 Identities = 168/336 (50%), Positives = 218/336 (64%)

Query:    39 SCPLRCDQRTDCQDCLTSSGGEGGWHECRWSSMLNECISPSYEALYCAGGVCGLVLGPHQ 98
             SCPL C    +C  CL+ +  +    EC+WS+MLN C++PS + L CAGGVCGLVL   +
Sbjct:  2089 SCPLPCHTYENCSLCLSQTPTQDH-QECKWSTMLNLCLTPSSQPLLCAGGVCGLVLEASE 2147

Query:    99 APQCPRSCSAYTQCSTCLRHAHCGWCALQRDTTGGMGVCTXXXXXXXXXXXXXXTCDILF 158
               +CP  C  YTQCS+CL HAHCGWCA  R+   G G+CT              TCD+++
Sbjct:  2148 LQRCPEPCHVYTQCSSCLEHAHCGWCA--REGFNGDGICTEGALEHKQEHPSGSTCDLIY 2205

Query:   159 YQTYPDQVIEVNNNDSFSWNYVKCPPENECLNDHHTCDPQSEQCVDL--ADGFECVCGRG 216
                  D   ++ + D  SW+YV+CP ENEC+N HH CD  SEQC+DL  A G++CVC +G
Sbjct:  2206 ASWRNDS--QLTHADVVSWHYVQCPAENECINGHHNCDTVSEQCIDLDTAVGYKCVCAQG 2263

Query:   217 YNKSEEGGECVPVCSQGCVRGVCSEPDKCQCDFGYVGVNCSIQCQCNGHADCAGPDKLDV 276
             Y   EE G C+PVCSQGCVRG C  PD+CQCDFGYVG NCSIQC CNGH++C    +LD+
Sbjct:  2264 YR--EEQGACLPVCSQGCVRGNCVSPDQCQCDFGYVGANCSIQCLCNGHSNCESSSRLDI 2321

Query:   277 CLRCHNHTKGPQCDKCEPLYVGDPRDNGECVPCSEYCNGHTGLCINASLASLPFSPESGG 336
             CL+CHN+T G QC+KC+PL+VG+PR+   C PC +YC+GH+ +C+        F+     
Sbjct:  2322 CLKCHNNTMGEQCEKCQPLFVGNPREGHACQPCLDYCHGHSDVCVAYDADPAVFNMTR-- 2379

Query:   337 TSELAAFLDEGPTTRARCMHCGNHTTGPKCEDCVEG 372
              SEL   L EGP   A C+ CGNHT G +C+ C+ G
Sbjct:  2380 -SELERILQEGPAYNATCLRCGNHTAGDRCDSCLTG 2414
GO:0016020 "membrane" evidence=IEA
GO:0005509 "calcium ion binding" evidence=IEA
RGD|621190 Megf8 "multiple EGF-like-domains 8" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1RGK2 MEGF8 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q7Z7M0 MEGF8 "Multiple epidermal growth factor-like domains protein 8" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
MGI|MGI:2446294 Megf8 "multiple EGF-like-domains 8" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|E2RM39 MEGF8 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-090730-1 megf8 "multiple EGF-like-domains 8" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|E1BPS6 MEGF8 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-090312-21 atrn "attractin" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|Q8MJ16 ATRN "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

No hit with e-value below 0.005

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 380
KOG0994|consensus 1758 99.69
KOG0994|consensus 1758 99.64
KOG1388|consensus217 99.31
KOG3512|consensus 592 99.16
KOG1836|consensus 1705 99.06
KOG3512|consensus 592 99.01
KOG1836|consensus 1705 98.84
KOG1225|consensus 525 98.63
KOG1225|consensus525 98.59
KOG1214|consensus 1289 98.18
KOG4289|consensus 2531 98.08
cd0005550 EGF_Lam Laminin-type epidermal growth factor-like 97.92
KOG1219|consensus 4289 97.91
PF0764542 EGF_CA: Calcium-binding EGF domain; InterPro: IPR0 97.9
PF0005349 Laminin_EGF: Laminin EGF-like (Domains III and V); 97.87
KOG4289|consensus 2531 97.72
KOG1219|consensus 4289 97.72
KOG1214|consensus 1289 97.57
smart0018046 EGF_Lam Laminin-type epidermal growth factor-like 97.55
KOG1226|consensus 783 97.48
cd0005550 EGF_Lam Laminin-type epidermal growth factor-like 97.03
KOG1226|consensus783 96.96
PF1294736 EGF_3: EGF domain; InterPro: IPR024731 This entry 96.91
KOG3509|consensus 964 96.84
KOG1217|consensus 487 96.78
smart0017939 EGF_CA Calcium-binding EGF-like domain. 96.71
PF0005349 Laminin_EGF: Laminin EGF-like (Domains III and V); 96.59
smart0018046 EGF_Lam Laminin-type epidermal growth factor-like 95.94
cd0005438 EGF_CA Calcium-binding EGF-like domain, present in 95.77
PF0143751 PSI: Plexin repeat; InterPro: IPR002165 This is a 95.73
PF0000832 EGF: EGF-like domain This is a sub-family of the P 95.45
KOG4260|consensus350 95.19
smart0005163 DSL delta serrate ligand. 94.7
PF0797432 EGF_2: EGF-like domain; InterPro: IPR013111 A sequ 94.51
smart0042346 PSI domain found in Plexins, Semaphorins and Integ 94.15
KOG4260|consensus 350 94.11
cd0005336 EGF Epidermal growth factor domain, found in epide 94.09
KOG1217|consensus487 94.04
smart0005163 DSL delta serrate ligand. 93.71
PF0143751 PSI: Plexin repeat; InterPro: IPR002165 This is a 93.66
PF1266113 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E 93.48
smart0018135 EGF Epidermal growth factor-like domain. 93.05
KOG3509|consensus 964 92.92
PF1467036 FXa_inhibition: Coagulation Factor Xa inhibitory s 89.61
PF1266224 cEGF: Complement Clr-like EGF-like 89.04
PF0797432 EGF_2: EGF-like domain; InterPro: IPR013111 A sequ 88.83
cd01475224 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, 84.46
KOG1218|consensus316 83.85
smart0017939 EGF_CA Calcium-binding EGF-like domain. 83.58
KOG1388|consensus217 83.42
PF0000832 EGF: EGF-like domain This is a sub-family of the P 83.38
PF06247197 Plasmod_Pvs28: Plasmodium ookinete surface protein 81.53
>KOG0994|consensus Back     alignment and domain information 
Probab=99.69  E-value=4.7e-17  Score=173.20  Aligned_cols=173  Identities=32%  Similarity=0.795  Sum_probs=137.0

Q ss_pred             CCCccCCCCCCCccccCCCC-CCCCCCCeeec---CCCCccc-ccCCCceecCC---CCCcccc-CCCCCcC-----Ccc
Q psy9822         174 SFSWNYVKCPPENECLNDHH-TCDPQSEQCVD---LADGFEC-VCGRGYNKSEE---GGECVPV-CSQGCVR-----GVC  239 (380)
Q Consensus       174 ~~~w~~~~C~d~deC~~g~~-~C~~~~g~C~n---~~~g~~C-~C~~Gy~G~~~---~~~C~~~-C~~~C~~-----G~C  239 (380)
                      ...|+|+.|... .| |+|. .|++..|.|++   ...|+.| +|..||+|+..   ...|.|. |+.+-..     -.|
T Consensus       848 pG~WgFPeCr~C-qC-NgHA~~Cd~~tGaCi~CqD~T~G~~CdrCl~GyyGdP~lg~g~~CrPCpCP~gp~Sg~~~A~sC  925 (1758)
T KOG0994|consen  848 PGYWGFPECRPC-QC-NGHADTCDPITGACIDCQDSTTGHSCDRCLDGYYGDPRLGSGIGCRPCPCPDGPASGRQHADSC  925 (1758)
T ss_pred             CCccCCCcCccc-cc-cCcccccCccccccccccccccccchhhhhccccCCcccCCCCCCCCCCCCCCCccchhccccc
Confidence            356999999763 67 7776 89999998876   6689999 99999999976   5678888 8766322     245


Q ss_pred             cC-----CCccccCCCcccccccc----------------cCCCCCCC------cccCCCCCcccccCCCCCCCCCCCCC
Q psy9822         240 SE-----PDKCQCDFGYVGVNCSI----------------QCQCNGHA------DCAGPDKLDVCLRCHNHTKGPQCDKC  292 (380)
Q Consensus       240 ~~-----~~~C~C~~G~~G~~C~~----------------~c~C~~~~------~C~~~~~~g~C~~C~~~~~G~~C~~C  292 (380)
                      ..     .-.|.|..||+|.+|++                .|+|+++.      .|.  ..++.|++|...++|.||+.|
T Consensus       926 ~~d~~t~~ivC~C~~GY~G~RCe~CA~~~fGnP~~GGtCq~CeC~~NiD~~d~~aCD--~~TG~CLkCL~hTeG~hCe~C 1003 (1758)
T KOG0994|consen  926 YLDTRTQQIVCHCQEGYSGSRCEICADNHFGNPSEGGTCQKCECSNNIDLYDPGACD--VATGACLKCLYHTEGDHCEHC 1003 (1758)
T ss_pred             cccccccceeeecccCccccchhhhcccccCCcccCCccccccccCCcCccCCCccc--hhhchhhhhhhcccccchhhc
Confidence            54     23899999999999975                35565542      243  368999999999999999999


Q ss_pred             CCCccCCCCCCCCCcCCCCccCCCCCc--ccccccCCCCCCCCCCCcccccccccCCCCCCcccccCCCCCCCCCCCcCC
Q psy9822         293 EPLYVGDPRDNGECVPCSEYCNGHTGL--CINASLASLPFSPESGGTSELAAFLDEGPTTRARCMHCGNHTTGPKCEDCV  370 (380)
Q Consensus       293 ~~g~~G~~~~~~~C~~C~~~Cng~~~~--C~~~~~~~~p~~~~~~~~~~~~~~~~~g~~~~g~C~~C~~g~~G~~Ce~C~  370 (380)
                      ++||||++.. ..|+.|.  ||-.++.  |+     +|                    ..+|+|. |.+|..|.+|++|+
T Consensus      1004 k~Gf~GdA~~-q~CqrC~--Cn~LGTn~~~~-----CD--------------------r~tGQCp-ClpNv~G~~CDqCA 1054 (1758)
T KOG0994|consen 1004 KDGFYGDALR-QNCQRCV--CNFLGTNSTCH-----CD--------------------RFTGQCP-CLPNVQGVRCDQCA 1054 (1758)
T ss_pred             cccchhHHHH-hhhhhhe--ccccccCCccc-----cc--------------------cccCcCC-CCcccccccccccc
Confidence            9999999864 5699998  9855432  21     12                    2679999 99999999999999


Q ss_pred             CCCCCCCCC
Q psy9822         371 EGKENRQSR  379 (380)
Q Consensus       371 ~Gy~g~~~~  379 (380)
                      +-+|.+.|+
T Consensus      1055 ~N~w~laSG 1063 (1758)
T KOG0994|consen 1055 ENHWNLASG 1063 (1758)
T ss_pred             cchhccccC
Confidence            999998875

>KOG0994|consensus Back     alignment and domain information
>KOG1388|consensus Back     alignment and domain information
>KOG3512|consensus Back     alignment and domain information
>KOG1836|consensus Back     alignment and domain information
>KOG3512|consensus Back     alignment and domain information
>KOG1836|consensus Back     alignment and domain information
>KOG1225|consensus Back     alignment and domain information
>KOG1225|consensus Back     alignment and domain information
>KOG1214|consensus Back     alignment and domain information
>KOG4289|consensus Back     alignment and domain information
>cd00055 EGF_Lam Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>PF07645 EGF_CA: Calcium-binding EGF domain; InterPro: IPR001881 A sequence of about forty amino-acid residues found in epidermal growth factor (EGF) has been shown [, , , , , ] to be present in a large number of membrane-bound and extracellular, mostly animal, proteins Back     alignment and domain information
>PF00053 Laminin_EGF: Laminin EGF-like (Domains III and V); InterPro: IPR002049 Laminins [] are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation Back     alignment and domain information
>KOG4289|consensus Back     alignment and domain information
>KOG1219|consensus Back     alignment and domain information
>KOG1214|consensus Back     alignment and domain information
>smart00180 EGF_Lam Laminin-type epidermal growth factor-like domai Back     alignment and domain information
>KOG1226|consensus Back     alignment and domain information
>cd00055 EGF_Lam Laminin-type epidermal growth factor-like domain; laminins are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation; the laminin-type epidermal growth factor-like module occurs in tandem arrays; the domain contains 4 disulfide bonds (loops a-d) the first three resemble epidermal growth factor (EGF); the number of copies of this domain in the different forms of laminins is highly variable ranging from 3 up to 22 copies Back     alignment and domain information
>KOG1226|consensus Back     alignment and domain information
>PF12947 EGF_3: EGF domain; InterPro: IPR024731 This entry represents an EGF domain found in the the C terminus of malarial parasite merozoite surface protein 1 [], as well as other proteins Back     alignment and domain information
>KOG3509|consensus Back     alignment and domain information
>KOG1217|consensus Back     alignment and domain information
>smart00179 EGF_CA Calcium-binding EGF-like domain Back     alignment and domain information
>PF00053 Laminin_EGF: Laminin EGF-like (Domains III and V); InterPro: IPR002049 Laminins [] are the major noncollagenous components of basement membranes that mediate cell adhesion, growth migration, and differentiation Back     alignment and domain information
>smart00180 EGF_Lam Laminin-type epidermal growth factor-like domai Back     alignment and domain information
>cd00054 EGF_CA Calcium-binding EGF-like domain, present in a large number of membrane-bound and extracellular (mostly animal) proteins Back     alignment and domain information
>PF01437 PSI: Plexin repeat; InterPro: IPR002165 This is a cysteine rich repeat found in several different extracellular receptors Back     alignment and domain information
>PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>KOG4260|consensus Back     alignment and domain information
>smart00051 DSL delta serrate ligand Back     alignment and domain information
>PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>smart00423 PSI domain found in Plexins, Semaphorins and Integrins Back     alignment and domain information
>KOG4260|consensus Back     alignment and domain information
>cd00053 EGF Epidermal growth factor domain, found in epidermal growth factor (EGF) presents in a large number of proteins, mostly animal; the list of proteins currently known to contain one or more copies of an EGF-like pattern is large and varied; the functional significance of EGF-like domains in what appear to be unrelated proteins is not yet clear; a common feature is that these repeats are found in the extracellular domain of membrane-bound proteins or in proteins known to be secreted (exception: prostaglandin G/H synthase); the domain includes six cysteine residues which have been shown to be involved in disulfide bonds; the main structure is a two-stranded beta-sheet followed by a loop to a C-terminal short two-stranded sheet; Subdomains between the conserved cysteines vary in length; the region between the 5th and 6th cysteine contains two conserved glycines of which at least one is present in most EGF-like domains; a subset of these bind calcium Back     alignment and domain information
>KOG1217|consensus Back     alignment and domain information
>smart00051 DSL delta serrate ligand Back     alignment and domain information
>PF01437 PSI: Plexin repeat; InterPro: IPR002165 This is a cysteine rich repeat found in several different extracellular receptors Back     alignment and domain information
>PF12661 hEGF: Human growth factor-like EGF; PDB: 2YGQ_A 2E26_A 3A7Q_A 2YGP_A 2YGO_A 1HRE_A 1HAE_A 1HAF_A 1HRF_A Back     alignment and domain information
>smart00181 EGF Epidermal growth factor-like domain Back     alignment and domain information
>KOG3509|consensus Back     alignment and domain information
>PF14670 FXa_inhibition: Coagulation Factor Xa inhibitory site; PDB: 3Q3K_B 1NFY_B 1LQD_A 1G2L_B 1IQF_L 2UWP_B 2VH6_B 3KQC_L 2P93_L 2BQW_A Back     alignment and domain information
>PF12662 cEGF: Complement Clr-like EGF-like Back     alignment and domain information
>PF07974 EGF_2: EGF-like domain; InterPro: IPR013111 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>cd01475 vWA_Matrilin VWA_Matrilin: In cartilaginous plate, extracellular matrix molecules mediate cell-matrix and matrix-matrix interactions thereby providing tissue integrity Back     alignment and domain information
>KOG1218|consensus Back     alignment and domain information
>smart00179 EGF_CA Calcium-binding EGF-like domain Back     alignment and domain information
>KOG1388|consensus Back     alignment and domain information
>PF00008 EGF: EGF-like domain This is a sub-family of the Pfam entry This is a sub-family of the Pfam entry; InterPro: IPR006209 A sequence of about thirty to forty amino-acid residues long found in the sequence of epidermal growth factor (EGF) has been shown [, , , , ] to be present, in a more or less conserved form, in a large number of other, mostly animal proteins Back     alignment and domain information
>PF06247 Plasmod_Pvs28: Plasmodium ookinete surface protein Pvs28; InterPro: IPR010423 This family consists of several ookinete surface protein (Pvs28) from several species of Plasmodium Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query380
4aqt_A375 Laminin subunit gamma-1; cell adhesion; HET: NAG B 8e-12
4aqt_A375 Laminin subunit gamma-1; cell adhesion; HET: NAG B 3e-04
2y38_A403 Laminin subunit alpha-5; structural protein, cell 1e-10
3tbd_A338 Netrin-G2, laminet-2; laminin N-terminal domain, d 4e-08
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 8e-07
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 3e-06
2dtg_E 897 Insulin receptor; IR ectodomain, X-RAY crystallogr 1e-04
1gl4_A285 Nidogen-1, entactin; immunoglobulin-like domain, e 1e-04
4aqs_A 525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 3e-04
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 5e-04
3v65_B 386 Low-density lipoprotein receptor-related protein; 3e-04
3k6s_B 687 Integrin beta-2; cell receptor, adhesion molecule, 4e-04
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 6e-04
>4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Length = 375 Back     alignment and structure
 Score = 65.2 bits (158), Expect = 8e-12
 Identities = 37/149 (24%), Positives = 54/149 (36%), Gaps = 24/149 (16%)

Query: 230 CSQGCVRGVCSEPDKCQCDFGYVG-VNCSIQCQCNGHADCAGPDKLD-VCLRCHNHTKGP 287
                   V +EP   +  +  +       +C+CNGHA     ++ D +   C ++T G 
Sbjct: 224 RLNTFGDEVFNEPKVLKSYYYAISDFAVGGRCKCNGHASECVKNEFDKLMCNCKHNTYGV 283

Query: 288 QCDKCEPLYVGDPRDNGECVPCSE----YCNGHTGLCINASLASLPFSPESGGTSELAAF 343
            C+KC P +   P         SE     CNG +  C         F PE          
Sbjct: 284 DCEKCLPFFNDRPWRRATAESASECLPCDCNGRSQECY--------FDPE---------- 325

Query: 344 LDEGPTTRARCMHCGNHTTGPKCEDCVEG 372
           L         C +C ++T G KCE C E 
Sbjct: 326 LYRSTGHGGHCTNCRDNTDGAKCERCREN 354
>4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Length = 375 Back     alignment and structure
>2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} Length = 403 Back     alignment and structure
>3tbd_A Netrin-G2, laminet-2; laminin N-terminal domain, domain VI, LE-domain, N neuronal cell adhesion molecule, netrin G ligand 2, nervous system; HET: NAG; 1.80A {Homo sapiens} PDB: 3zyg_A* 3zyi_B* Length = 338 Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Length = 162 Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 426 Back     alignment and structure
>2dtg_E Insulin receptor; IR ectodomain, X-RAY crystallography, hormone receptor/immune system complex; 3.80A {Homo sapiens} SCOP: b.1.2.1 b.1.2.1 b.1.2.1 c.10.2.5 c.10.2.5 g.3.9.1 PDB: 3loh_E Length = 897 Back     alignment and structure
>1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A Length = 285 Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525 Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Length = 525 Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Length = 386 Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Length = 687 Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Length = 463 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query380
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 99.65
2y38_A403 Laminin subunit alpha-5; structural protein, cell 99.39
1klo_A162 Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: 99.33
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 99.32
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 99.31
2gy5_A423 Angiopoietin-1 receptor; ligand-binding domain, tr 99.26
4aqt_A375 Laminin subunit gamma-1; cell adhesion; HET: NAG B 99.17
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 99.06
2ygq_A324 WIF-1, WNT inhibitory factor 1; signaling protein, 98.98
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 98.92
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 98.92
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 98.89
2vj2_A169 Jagged-1; signalling, polymorphism, glycoprotein, 98.87
1z1y_A186 Ookinete surface protein PVS25; four EGF-like doma 98.82
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 98.81
2gy5_A 423 Angiopoietin-1 receptor; ligand-binding domain, tr 98.73
3fcs_B690 Integrin beta-3; beta propeller, rossmann fold, EG 98.72
4aqs_A525 Laminin subunit beta-1; cell adhesion; HET: NAG BM 98.68
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 98.66
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 98.63
3k6s_B687 Integrin beta-2; cell receptor, adhesion molecule, 98.62
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 98.58
2vj3_A135 Neurogenic locus notch homolog protein 1; transcri 98.55
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 98.52
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 98.39
4d90_A143 EGF-like repeat and discoidin I-like domain-conta 98.37
2bou_A143 EGF-like module containing mucin-like hormone rece 98.33
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 98.32
2bou_A143 EGF-like module containing mucin-like hormone rece 98.29
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 98.29
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 98.2
4fbr_A267 Lectin, myxobacterial hemagglutinin; beta-barrel, 98.19
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 98.18
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 98.18
1aut_L114 Activated protein C; serine proteinase, plasma cal 98.07
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 97.99
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 97.97
4fbr_A267 Lectin, myxobacterial hemagglutinin; beta-barrel, 97.88
1yo8_A 634 Thrombospondin-2; EGF, Ca(2+)-binding domains, lec 97.87
2y38_A403 Laminin subunit alpha-5; structural protein, cell 97.87
4aqt_A375 Laminin subunit gamma-1; cell adhesion; HET: NAG B 97.82
1tpg_A91 T-plasminogen activator F1-G; plasminogen activati 97.73
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 97.72
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 97.7
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 97.67
2vh0_B134 Activated factor XA light chain; serine protease, 97.65
2p28_B217 Integrin beta-2; hybrid domain, PSI domain, I-EGF 97.63
2p28_B217 Integrin beta-2; hybrid domain, PSI domain, I-EGF 97.53
1emn_A82 Fibrillin; extracellular matrix, calcium-binding, 97.39
3h5c_B 317 Vitamin K-dependent protein Z; protein Z-protein Z 97.24
2wg3_C463 Hedgehog-interacting protein; lipoprotein, develop 97.16
1lmj_A86 Fibrillin 1; EGF, calcium, microfibril, neonatal, 97.12
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 97.07
2kl7_A71 Fibulin-4; secreted, calcium, disease mutation, di 96.87
2w86_A147 Fibrillin-1, fibrillin1; phosphoprotein, EGF-like 96.83
3u7u_G55 Neuregulin 1; signaling protein, transferase-trans 96.82
3v65_B 386 Low-density lipoprotein receptor-related protein; 96.78
1apq_A53 Complement protease C1R; EGF, calcium binding, ser 96.76
1aut_L114 Activated protein C; serine proteinase, plasma cal 96.73
1gl4_A285 Nidogen-1, entactin; immunoglobulin-like domain, e 96.65
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 96.59
2k2s_B61 Micronemal protein 6; microneme protein complex, c 96.5
1z6c_A87 Vitamin K-dependent protein S; EGF module, blood c 96.47
1uzk_A162 Fibrillin-1; glycoprotein, extra-cellular matrix, 96.38
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 96.37
1x7a_L146 Coagulation factor IX, light chain; inhibition, bl 96.29
3zyj_B426 Netrin-G1; cell adhesion, synapse; HET: NAG BMA MA 96.29
3h5c_B317 Vitamin K-dependent protein Z; protein Z-protein Z 96.14
2w2n_E107 LDL receptor, low-density lipoprotein receptor; hy 96.08
3tbd_A338 Netrin-G2, laminet-2; laminin N-terminal domain, d 96.01
1dx5_I118 Thrombomodulin; serine proteinase, EGF-like domain 95.82
2jkh_L55 Factor X light chain; plasma, calcium, zymogen, se 95.62
1a3p_A45 Epidermal growth factor; disulfide connectivities, 95.58
3p5b_L 400 Low density lipoprotein receptor variant; B-propel 95.45
1k36_A46 Epiregulin; EGF-like fold, hormone/growth factor c 95.36
2vh0_B134 Activated factor XA light chain; serine protease, 95.17
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 95.13
1nfu_B195 Coagulation factor XA, light chain; hydrolase; HET 95.0
2ygo_A188 WIF-1, WNT inhibitory factor 1; signaling protein, 94.96
3tbd_A338 Netrin-G2, laminet-2; laminin N-terminal domain, d 94.86
1nql_B53 Epidermal growth factor; cell surface receptor, ty 94.14
1kli_L69 Factor VIIA; extrinsic coagulation pathway, serine 94.1
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 93.87
3u7u_G55 Neuregulin 1; signaling protein, transferase-trans 93.54
3ca7_A52 Protein spitz; argos, EGF, developmental protein, 93.5
1hae_A63 Heregulin-alpha; growth factor; NMR {Homo sapiens} 93.0
1k36_A46 Epiregulin; EGF-like fold, hormone/growth factor c 92.96
1n7d_A 699 LDL receptor, low-density lipoprotein receptor; fa 92.34
3v65_B 386 Low-density lipoprotein receptor-related protein; 92.3
2c4f_L142 Coagulation factor VII precursor; blood coagulatio 92.28
1kig_L51 Factor XA; glycoprotein, serine protease, plasma, 91.68
1edm_B39 Factor IX; epidermal growth factor, EGF, calcium- 91.55
3m0c_C 791 LDL receptor, low-density lipoprotein receptor; pr 90.77
2fd6_A122 Urokinase-type plasminogen activator; UPAR, ATF, A 90.43
3ca7_A52 Protein spitz; argos, EGF, developmental protein, 90.34
1egf_A53 Epidermal growth factor; NMR {Mus musculus} SCOP: 90.17
1a3p_A45 Epidermal growth factor; disulfide connectivities, 89.34
2wph_E59 Coagulation factor IXA light chain; serine proteas 88.65
1szb_A170 Mannose binding lectin-associated serine protease- 88.1
2e26_A725 Reelin, reeler protein; signaling protein; HET: NA 87.9
3e50_C50 Protransforming growth factor alpha; IDE, TGF-alph 87.07
1g1s_A162 P-selectin; selectin, lectin, EGF, sulphated, SLEX 86.87
3ltf_D58 Protein spitz; receptor-ligand complex ectodomain 85.45
2rnl_A50 Amphiregulin; AR, colorectum cell-derived growth f 85.23
2bz6_L53 Blood coagulation factor VIIA; serine protease, en 85.07
1ob1_C99 Major merozoite surface protein; immune system, im 82.65
1xdt_R79 Hbegf, heparin-binding epidermal growth factor; co 82.48
1hae_A63 Heregulin-alpha; growth factor; NMR {Homo sapiens} 82.43
1iox_A50 Betacellulin; EGF-like fold, hormone/growth factor 81.97
1nql_B53 Epidermal growth factor; cell surface receptor, ty 81.32
1n1i_A105 Merozoite surface protein-1; MSP1, malaria, surfac 81.31
2e26_A725 Reelin, reeler protein; signaling protein; HET: NA 81.15
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Back     alignment and structure
Probab=99.65  E-value=8.8e-17  Score=141.98  Aligned_cols=128  Identities=31%  Similarity=0.721  Sum_probs=100.2

Q ss_pred             CCCeeecCC--CCccc-ccCCCceecCCCCCccccCCCCCcCCcccCCCccccCCCccccccc--------ccCCCCCC-
Q psy9822         198 QSEQCVDLA--DGFEC-VCGRGYNKSEEGGECVPVCSQGCVRGVCSEPDKCQCDFGYVGVNCS--------IQCQCNGH-  265 (380)
Q Consensus       198 ~~g~C~n~~--~g~~C-~C~~Gy~G~~~~~~C~~~C~~~C~~G~C~~~~~C~C~~G~~G~~C~--------~~c~C~~~-  265 (380)
                      +.++|+..+  +.++| .|++||+|..    |+                  .|.+||+|..+.        ++|+|+++ 
T Consensus         5 ~~g~C~~~~~~g~~~C~~C~~g~~G~~----Ce------------------~C~~g~~g~~~~~~~~~~~C~~C~C~~~~   62 (162)
T 1klo_A            5 GGSSCAIVPKTKEVVCTHCPTGTAGKR----CE------------------LCDDGYFGDPLGSNGPVRLCRPCQCNDNI   62 (162)
T ss_dssp             TTCCEEECSSSCCEEECSCCTTEESTT----SC------------------EECTTEEEETTCTTSSCEEEEECCSTTCB
T ss_pred             CcCcccccCCCCCEEeCCCCCCCcCCC----Cc------------------CCCCCCcCCcccccCCCCCCeeCcCCCCC
Confidence            567787655  57899 7999999976    33                  367778775443        25788877 


Q ss_pred             -----CcccCCCCCcccccCCCCCCCCCCCCCCCCccCCCCC---CCCCcCCCCccCCCCC-----cccccccCCCCCCC
Q psy9822         266 -----ADCAGPDKLDVCLRCHNHTKGPQCDKCEPLYVGDPRD---NGECVPCSEYCNGHTG-----LCINASLASLPFSP  332 (380)
Q Consensus       266 -----~~C~~~~~~g~C~~C~~~~~G~~C~~C~~g~~G~~~~---~~~C~~C~~~Cng~~~-----~C~~~~~~~~p~~~  332 (380)
                           +.|..  .+++|++|+++|+|.+|++|++||||++..   ...|++|.  |+.++.     .|+           
T Consensus        63 ~~~~~~~C~~--~tG~C~~C~~g~~G~~Ce~C~~Gy~g~~~~~~~~~~C~~C~--C~~~Gs~~~~~~Cd-----------  127 (162)
T 1klo_A           63 DPNAVGNCNR--LTGECLKCIYNTAGFYCDRCKEGFFGNPLAPNPADKCKACA--CNPYGTVQQQSSCN-----------  127 (162)
T ss_dssp             CTTCSCCBCT--TTCCBCCBCTTEETTTTCEECTTEEECTTCSSGGGSEEECC--CCTTTBGGGCCCCC-----------
T ss_pred             CcccCCcccC--CCCcccCCCCCCcCCCcCcCchhhcCCccccCCCCCCeecc--CCCCCccCCCCCCC-----------
Confidence                 35753  578996699999999999999999999865   35699999  987652     232           


Q ss_pred             CCCCcccccccccCCCCCCcccccCCCCCCCCCCCcCCCCCCCCCCC
Q psy9822         333 ESGGTSELAAFLDEGPTTRARCMHCGNHTTGPKCEDCVEGKENRQSR  379 (380)
Q Consensus       333 ~~~~~~~~~~~~~~g~~~~g~C~~C~~g~~G~~Ce~C~~Gy~g~~~~  379 (380)
                                      ..+++|+ |+++|+|++|++|++|||++.+.
T Consensus       128 ----------------~~tG~C~-C~~g~~G~~Cd~C~~g~~g~~~~  157 (162)
T 1klo_A          128 ----------------PVTGQCQ-CLPHVSGRDCGTCDPGYYNLQSG  157 (162)
T ss_dssp             ----------------TTTCCCC-BCTTEESTTCCEECTTCBCGGGS
T ss_pred             ----------------CCCCEeE-CCCCCcCCCCCCCCCCcccCCCC
Confidence                            1568999 99999999999999999998764
>2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} Back     alignment and structure
>1klo_A Laminin; glycoprotein; 2.10A {Mus musculus} SCOP: g.3.11.2 g.3.11.2 g.3.11.2 PDB: 1npe_B 1tle_A Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Back     alignment and structure
>4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Back     alignment and structure
>2ygq_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: PCF NAG FUC SCR; 3.95A {Homo sapiens} Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
>2vj2_A Jagged-1; signalling, polymorphism, glycoprotein, extracellular, developmental protein, notch signaling pathway, EGF, DSL, notch, calcium, membrane; 2.50A {Homo sapiens} PDB: 2kb9_A Back     alignment and structure
>1z1y_A Ookinete surface protein PVS25; four EGF-like domains, cell adhesion; HET: MLY; 2.00A {Plasmodium vivax} PDB: 1z27_A 1z3g_A Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>2gy5_A Angiopoietin-1 receptor; ligand-binding domain, transferase; HET: NAG NDG; 2.90A {Homo sapiens} PDB: 2gy7_B* Back     alignment and structure
>3fcs_B Integrin beta-3; beta propeller, rossmann fold, EGF domain, cell adhesion, DI mutation, glycoprotein, HOST-virus interaction, M phosphoprotein; HET: NAG MAN; 2.55A {Homo sapiens} PDB: 4g1e_B* 3ije_B* 4g1m_B* 1jv2_B* 1l5g_B* 1m1x_B* 1u8c_B* Back     alignment and structure
>4aqs_A Laminin subunit beta-1; cell adhesion; HET: NAG BMA MAN FUL; 3.11A {Mus musculus} Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Back     alignment and structure
>3k6s_B Integrin beta-2; cell receptor, adhesion molecule, cell adhesion, pyrrolidone carboxylic acid; HET: NAG MAN; 3.50A {Homo sapiens} PDB: 3k71_B* 3k72_B* Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Back     alignment and structure
>2vj3_A Neurogenic locus notch homolog protein 1; transcription, metal-binding, transmembrane, developmental protein, notch signaling pathway; 2.60A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 1toz_A 2rqz_A* 2rr0_A 2rr2_A* Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>4d90_A EGF-like repeat and discoidin I-like domain-conta protein 3; RGD finger, cell adhesion, innate immunity, extracellular MA protein; HET: NGA NAG FUC; 2.60A {Homo sapiens} Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Back     alignment and structure
>2bou_A EGF-like module containing mucin-like hormone receptor-like 2 precursor; CD97, CD55, 7TM, calcium-binding, cell adhesion, EGF-LI domain; 1.90A {Homo sapiens} PDB: 2bo2_A 2box_A Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Back     alignment and structure
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Back     alignment and structure
>4fbr_A Lectin, myxobacterial hemagglutinin; beta-barrel, HIV-inactivating, carbohydrate binding protein; 1.60A {Myxococcus xanthus} PDB: 4fbv_A* Back     alignment and structure
>1yo8_A Thrombospondin-2; EGF, Ca(2+)-binding domains, lectin domain, disulfide, cell; HET: NAG MAN; 2.60A {Homo sapiens} PDB: 2rhp_A* Back     alignment and structure
>2y38_A Laminin subunit alpha-5; structural protein, cell adhesion, basement membrane; HET: NAG; 2.90A {Mus musculus} Back     alignment and structure
>4aqt_A Laminin subunit gamma-1; cell adhesion; HET: NAG BMA; 3.20A {Mus musculus} Back     alignment and structure
>1tpg_A T-plasminogen activator F1-G; plasminogen activation; NMR {Homo sapiens} SCOP: g.3.11.1 g.27.1.1 PDB: 1tpm_A 1tpn_A Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Back     alignment and structure
>2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A Back     alignment and structure
>2p28_B Integrin beta-2; hybrid domain, PSI domain, I-EGF DOM cell adhesion; HET: NAG; 2.20A {Homo sapiens} PDB: 1l3y_A Back     alignment and structure
>1emn_A Fibrillin; extracellular matrix, calcium-binding, glycoprotein, repeat, signal, multigene family, disease mutation, matrix protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 1emo_A Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>2wg3_C Hedgehog-interacting protein; lipoprotein, development, membrane, secreted, protease, PALM hydrolase, developmental protein, autocatalytic cleavage; HET: NAG; 2.60A {Homo sapiens} PDB: 2wg4_B 2wfx_B 2wft_A 3ho3_A 3ho4_A 3ho5_A Back     alignment and structure
>1lmj_A Fibrillin 1; EGF, calcium, microfibril, neonatal, marfan syndrome, connective tissue, extracellular matrix, structural protein; NMR {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Back     alignment and structure
>2kl7_A Fibulin-4; secreted, calcium, disease mutation, disulfide bond, EGF- like domain, glycoprotein, polymorphism, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>2w86_A Fibrillin-1, fibrillin1; phosphoprotein, EGF-like domain, disease mutation, craniosynostosis, extracellular matrix, fibrillin calcium cbegf hybrid; 1.80A {Homo sapiens} Back     alignment and structure
>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>1apq_A Complement protease C1R; EGF, calcium binding, serine protease; NMR {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>1aut_L Activated protein C; serine proteinase, plasma calcium binding, glycoprotein, HYD hydrolase inhibitor complex, blood clotting; HET: 0G6; 2.80A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 PDB: 3f6u_L* Back     alignment and structure
>1gl4_A Nidogen-1, entactin; immunoglobulin-like domain, extracellular matrix; HET: EPE; 2.0A {Mus musculus} SCOP: d.22.1.2 g.3.11.5 PDB: 1h4u_A Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>2k2s_B Micronemal protein 6; microneme protein complex, cell adhesion, cytoplasmic vesicl lectin, virulence, EGF-like domain, membrane; NMR {Toxoplasma gondii} PDB: 2k2t_A Back     alignment and structure
>1z6c_A Vitamin K-dependent protein S; EGF module, blood clotting; NMR {Homo sapiens} Back     alignment and structure
>1uzk_A Fibrillin-1; glycoprotein, extra-cellular matrix, calcium, TB domain, disease mutation, extracellular matrix, polymorphism, cbegf domain; 1.35A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.23.1.1 PDB: 1uzj_A 1uzp_A 1uzq_A Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Back     alignment and structure
>1x7a_L Coagulation factor IX, light chain; inhibition, blood clotting,hydrolase; HET: 187; 2.90A {Sus scrofa} SCOP: g.3.11.1 g.3.11.1 PDB: 1pfx_L* Back     alignment and structure
>3zyj_B Netrin-G1; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>3h5c_B Vitamin K-dependent protein Z; protein Z-protein Z inhibitor complex, blood coagulation, CL PAIR of basic residues, disulfide bond, EGF-like domain; HET: NAG BGC; 3.26A {Homo sapiens} Back     alignment and structure
>2w2n_E LDL receptor, low-density lipoprotein receptor; hydrolase-receptor complex, PCSK9, proprotein converta low-density lipoprotein receptor, EGF; 2.30A {Homo sapiens} PDB: 2w2q_E 2w2o_E 2w2p_E 2w2m_E 3gcw_E 3bps_E 3gcx_E 1hz8_A 1i0u_A 1hj7_A Back     alignment and structure
>3tbd_A Netrin-G2, laminet-2; laminin N-terminal domain, domain VI, LE-domain, N neuronal cell adhesion molecule, netrin G ligand 2, nervous system; HET: NAG; 1.80A {Homo sapiens} PDB: 3zyg_A* 3zyi_B* Back     alignment and structure
>1dx5_I Thrombomodulin; serine proteinase, EGF-like domains, anticoagulant complex, antifibrinolytic complex, hydrolase-hydrolase inhibitor COM; HET: AR7 NDG; 2.30A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.3.11.1 PDB: 3gis_X 1dqb_A* 1zaq_A 1adx_A 2adx_A Back     alignment and structure
>2jkh_L Factor X light chain; plasma, calcium, zymogen, secreted, protease, hydrolase, polymorphism, glycoprotein, gamma-carboxyglutamic acid; HET: BI7; 1.25A {Homo sapiens} PDB: 2bok_L* 2vvc_K* 2vvu_L* 2vvv_L* 2vwl_L* 2vwm_K* 2vwn_L* 2vwo_L* 2xbv_L* 2xbw_L* 2xbx_L* 2xby_L* 2xc0_L* 2xc4_L* 2xc5_L* 2gd4_L* 3kl6_B* 2y5f_L* 2y5g_L* 2y5h_L* ... Back     alignment and structure
>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 Back     alignment and structure
>3p5b_L Low density lipoprotein receptor variant; B-propellor, convertase, hydrolase-lipid binding P complex; 3.30A {Homo sapiens} PDB: 3p5c_L Back     alignment and structure
>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A Back     alignment and structure
>2vh0_B Activated factor XA light chain; serine protease, EGF-like domain, blood coagulation, polymorphism, glycoprotein, hydroxylation; HET: GSI; 1.7A {Homo sapiens} PDB: 1ezq_B* 1f0s_B* 1ksn_B* 1f0r_B* 1lpk_A* 1lpz_A* 1lqd_A* 1nfw_B* 1nfx_B* 1nfy_B* 2boh_A* 2cji_B* 1lpg_A* 2j34_B* 2j38_B* 2j2u_B* 2j94_B* 2j95_B* 2uwl_B* 2j4i_B* ... Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>1nfu_B Coagulation factor XA, light chain; hydrolase; HET: RRP; 2.05A {Homo sapiens} SCOP: g.3.11.1 PDB: 2h9e_L* Back     alignment and structure
>2ygo_A WIF-1, WNT inhibitory factor 1; signaling protein, WNT signaling pathway, WNT antagonist, MO cancer, glycosaminoglycan; HET: MLY PCF NAG; 1.85A {Homo sapiens} PDB: 2ygp_A* Back     alignment and structure
>3tbd_A Netrin-G2, laminet-2; laminin N-terminal domain, domain VI, LE-domain, N neuronal cell adhesion molecule, netrin G ligand 2, nervous system; HET: NAG; 1.80A {Homo sapiens} PDB: 3zyg_A* 3zyi_B* Back     alignment and structure
>1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* Back     alignment and structure
>1kli_L Factor VIIA; extrinsic coagulation pathway, serine protease activation, R drug design, substrate-assisted catalysis, hydrolase; 1.69A {Homo sapiens} SCOP: g.3.11.1 PDB: 1klj_L 1jbu_L 1ygc_L* Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>3u7u_G Neuregulin 1; signaling protein, transferase-transferase regulator complex glycosylation; HET: NAG; 3.03A {Homo sapiens} Back     alignment and structure
>3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D Back     alignment and structure
>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A Back     alignment and structure
>1k36_A Epiregulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1k37_A Back     alignment and structure
>1n7d_A LDL receptor, low-density lipoprotein receptor; familial hypercholesterolemia, cholestero metabolism, lipid transport; HET: NAG BMA MAN KEG; 3.70A {Homo sapiens} SCOP: b.68.5.1 g.3.11.1 g.3.11.1 g.3.11.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 g.12.1.1 PDB: 2lgp_A 1xfe_A 1f5y_A 1ldl_A 1ldr_A 1d2j_A 1f8z_A Back     alignment and structure
>3v65_B Low-density lipoprotein receptor-related protein; laminin-G, beta-propeller, protein binding; 3.30A {Rattus norvegicus} Back     alignment and structure
>2c4f_L Coagulation factor VII precursor; blood coagulation, serine protease, EGF, EGF-like domain, GLA, receptor enzyme, glycoprotein, hydrolase, protease; HET: CGU GLC FUC NAG GIL; 1.72A {Homo sapiens} SCOP: g.3.11.1 g.3.11.1 g.32.1.1 PDB: 1w2k_L* 1w0y_L* 1z6j_L* 2b8o_L* 2aer_L* 2ec9_L* 2fir_L* 2a2q_L* 1fak_L* 1o5d_L* 1wqv_L* 1wss_L* 1wtg_L* 1wun_L* 1wv7_L* 1dan_L* 2aei_L* 2b7d_L* 2f9b_L* 2flb_L* ... Back     alignment and structure
>1kig_L Factor XA; glycoprotein, serine protease, plasma, blood coagulation, complex (protease/inhibitor); 3.00A {Bos taurus} SCOP: g.3.11.1 Back     alignment and structure
>1edm_B Factor IX; epidermal growth factor, EGF, calcium- binding, EGF-like domain, structure and function, coagulation factor; 1.50A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ixa_A Back     alignment and structure
>3m0c_C LDL receptor, low-density lipoprotein receptor; protein complex, beta propeller, cholesterol clearance, PCSK autocatalytic cleavage; 7.01A {Homo sapiens} Back     alignment and structure
>2fd6_A Urokinase-type plasminogen activator; UPAR, ATF, ATN-615 antibody, FAB, ternary complex, immune SY hydrolase; HET: PGE NAG FUC NDG PG4; 1.90A {Homo sapiens} SCOP: g.3.11.1 g.14.1.1 PDB: 3bt2_A* 3bt1_A* 3u73_A* 1urk_A* 3laq_A* 1kdu_A Back     alignment and structure
>3ca7_A Protein spitz; argos, EGF, developmental protein, differentiation, EGF-like domain, endoplasmic reticulum, glycoprotein, golgi apparatus; 1.50A {Drosophila melanogaster} PDB: 3c9a_C 3ltg_D Back     alignment and structure
>1egf_A Epidermal growth factor; NMR {Mus musculus} SCOP: g.3.11.1 PDB: 1epg_A 1eph_A 1epi_A 1epj_A 3egf_A 1gk5_A Back     alignment and structure
>1a3p_A Epidermal growth factor; disulfide connectivities, EGF-like domain, repeat; HET: ABA; NMR {Mus musculus} SCOP: g.3.11.1 Back     alignment and structure
>2wph_E Coagulation factor IXA light chain; serine protease, zymogen, hydrolase, glycoprotein, hydroxylation, phosphoprotein, sulfation, hemostasis; HET: DPN 1PE; 1.50A {Homo sapiens} PDB: 2wpi_E* 2wpj_E* 2wpk_E* 2wpl_E* 2wpm_E 3kcg_L* 3lc3_B* 1rfn_B* 3lc5_B* Back     alignment and structure
>1szb_A Mannose binding lectin-associated serine protease-2 related protein, MAP19 (19KDA)...; calcium, complement, innate immunity, CUB, EGF; 2.50A {Homo sapiens} SCOP: b.23.1.1 g.3.11.1 Back     alignment and structure
>2e26_A Reelin, reeler protein; signaling protein; HET: NAG BMA; 2.00A {Mus musculus} PDB: 3a7q_A* Back     alignment and structure
>3e50_C Protransforming growth factor alpha; IDE, TGF-alpha, cytoplasm, hydrolase, metal-binding, metalloprotease, polymorphism, protease, zinc; 2.30A {Homo sapiens} SCOP: g.3.11.1 PDB: 1yuf_A 1yug_A 2tgf_A 1mox_C 3tgf_A 4tgf_A Back     alignment and structure
>1g1s_A P-selectin; selectin, lectin, EGF, sulphated, SLEX, immune system, membr protein; HET: TYS SIA GAL NAG FUC NGA; 1.90A {Homo sapiens} SCOP: d.169.1.1 g.3.11.1 PDB: 1g1r_A* 1g1q_A* 1fsb_A Back     alignment and structure
>3ltf_D Protein spitz; receptor-ligand complex ectodomain cysteine rich domain EGF ATP-binding, kinase, nucleotide-binding, receptor; HET: NAG MAN; 3.20A {Drosophila melanogaster} Back     alignment and structure
>2rnl_A Amphiregulin; AR, colorectum cell-derived growth factor, EGF-like domain, CRDGF, cytokine, glycoprotein, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>2bz6_L Blood coagulation factor VIIA; serine protease, enzyme complex, hydrolase; HET: 346; 1.6A {Homo sapiens} SCOP: g.3.11.1 PDB: 1w8b_L* 1w7x_L* 1cvw_L* Back     alignment and structure
>1ob1_C Major merozoite surface protein; immune system, immunoglobulin/complex, immunoglobulin, antib fragment, MSP1-19, EGF-like domain; 2.90A {Plasmodium falciparum} SCOP: g.3.11.4 g.3.11.4 PDB: 1cej_A 2flg_A Back     alignment and structure
>1xdt_R Hbegf, heparin-binding epidermal growth factor; complex (toxin-growth factor), diphtheria toxin, receptor, H binding epidermal growth factor; 2.65A {Homo sapiens} SCOP: g.3.11.1 Back     alignment and structure
>1hae_A Heregulin-alpha; growth factor; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1haf_A 1hre_A 1hrf_A Back     alignment and structure
>1iox_A Betacellulin; EGF-like fold, hormone/growth factor complex; NMR {Homo sapiens} SCOP: g.3.11.1 PDB: 1ip0_A Back     alignment and structure
>1nql_B Epidermal growth factor; cell surface receptor, tyrosine kinase, glycoprotein, endoso growth factor, auto-inhibition; HET: NAG BMA; 2.80A {Homo sapiens} SCOP: g.3.11.1 PDB: 1ivo_C* 2kv4_A 1jl9_A 1p9j_A 3njp_C* Back     alignment and structure
>1n1i_A Merozoite surface protein-1; MSP1, malaria, surface antigen, glycoprotein, EGF domain, cell adhesion; HET: HIS; 2.40A {Plasmodium knowlesi strain H} SCOP: g.3.11.4 g.3.11.4 Back     alignment and structure
>2e26_A Reelin, reeler protein; signaling protein; HET: NAG BMA; 2.00A {Mus musculus} PDB: 3a7q_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 380
d1kloa256 g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (M 3e-06
d1kloa155 g.3.11.2 (A:11-65) Laminin gamma1 chain {Mouse (Mu 2e-04
>d1kloa2 g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 56 Back     information, alignment and structure

class: Small proteins
fold: Knottins (small inhibitors, toxins, lectins)
superfamily: EGF/Laminin
family: Laminin-type module
domain: Laminin gamma1 chain
species: Mouse (Mus musculus) [TaxId: 10090]

 Score = 42.2 bits (99), Expect = 3e-06
 Identities = 16/54 (29%), Positives = 24/54 (44%), Gaps = 4/54 (7%)

Query: 260 CQCNGHADCAGPDKLD----VCLRCHNHTKGPQCDKCEPLYVGDPRDNGECVPC 309
           CQCN + D       +     CL+C  +T G  CD+C+  + G+P        C
Sbjct: 1   CQCNDNIDPNAVGNCNRLTGECLKCIYNTAGFYCDRCKEGFFGNPLAPNPADKC 54
>d1kloa1 g.3.11.2 (A:11-65) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Length = 55 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query380
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 98.28
d1kloa256 Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 98.21
d1kloa256 Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 98.19
d1emoa143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 98.04
d1kloa155 Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 98.04
d1lmja144 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.91
d1kloa155 Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 97.86
d1lmja242 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.79
d1uzka243 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.75
d1gl4a240 EGF-like domain of nidogen-1 {Mouse (Mus musculus) 97.71
d1uzka143 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 97.69
d1apqa_53 Complement protease C1R {Human (Homo sapiens) [Tax 97.69
d1kloa351 Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 97.53
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 97.44
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 97.42
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 97.38
d1szba245 Mannose-binding protein associated serine protease 97.34
d1nt0a345 Mannose-binding protein associated serine protease 97.23
d1dx5i340 Thrombomodulin, different EGF-like domains {Human 97.18
d1i0ua241 Low density lipoprotein (LDL) receptor, different 97.15
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 97.02
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 97.01
d1autl148 Activated protein c (autoprothrombin IIa) {Human ( 96.37
d1nzia242 Complement C1S component {Human (Homo sapiens) [Ta 96.07
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 96.04
d1g1sa240 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 95.99
d3bpse140 Low density lipoprotein (LDL) receptor, different 95.91
d1kloa351 Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 95.63
d1xkba139 Factor X, N-terminal module {Human (Homo sapiens) 95.63
d1autl148 Activated protein c (autoprothrombin IIa) {Human ( 95.45
d1q4ga242 Prostaglandin H2 synthase-1, EGF-like module {Shee 94.98
d2vj3a142 Neurogenic locus notch homolog protein 1, Notch1 { 94.79
d2vj3a335 Neurogenic locus notch homolog protein 1, Notch1 { 94.71
d2vj3a239 Neurogenic locus notch homolog protein 1, Notch1 { 94.59
d1emoa239 Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} 94.59
d1edmb_39 Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606 94.54
d1tpga141 Plasminogen activator (tissue-type), t-PA {Human ( 94.1
d1g1sa240 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 93.93
d2c4fl137 Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} 93.85
d1cvua241 Prostaglandin H2 synthase-1, EGF-like module {Mous 93.39
d1tpga141 Plasminogen activator (tissue-type), t-PA {Human ( 92.85
d1olza356 Semaphorin 4d {Human (Homo sapiens) [TaxId: 9606]} 92.66
d1shyb249 Hepatocyte growth factor receptor {Human (Homo sap 92.59
d1g1ta239 E-selectin, EGF-domain {Human (Homo sapiens) [TaxI 92.47
d1haea_63 Heregulin-alpha, EGF-like domain {Human (Homo sapi 92.25
d3egfa_53 Epidermal growth factor, EGF {Mouse (Mus musculus) 91.97
d1shyb249 Hepatocyte growth factor receptor {Human (Homo sap 91.36
d3egfa_53 Epidermal growth factor, EGF {Mouse (Mus musculus) 91.27
d1q4ga242 Prostaglandin H2 synthase-1, EGF-like module {Shee 90.39
d1nqlb_48 Epidermal growth factor, EGF {Human (Homo sapiens) 90.08
d1cvua241 Prostaglandin H2 synthase-1, EGF-like module {Mous 89.7
d1autl250 Activated protein c (autoprothrombin IIa) {Human ( 88.56
d1kigl_51 Factor X, N-terminal module {Cow (Bos taurus) [Tax 88.4
d1ioxa_50 Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606] 87.96
d1xdtr_41 Heparin-binding epidermal growth factor, HBEGF {Hu 87.63
d1nqlb_48 Epidermal growth factor, EGF {Human (Homo sapiens) 86.41
d2p3ua151 Factor X, N-terminal module {Human (Homo sapiens) 85.33
d1k36a_46 Epiregulin, EGF-domain {Human (Homo sapiens) [TaxI 84.72
d1haea_63 Heregulin-alpha, EGF-like domain {Human (Homo sapi 84.35
d1olza356 Semaphorin 4d {Human (Homo sapiens) [TaxId: 9606]} 83.65
d1jv2b543 Integrin beta EGF-like domains {Human (Homo sapien 83.13
d1l3ya_41 Integrin beta EGF-like domains {Human (Homo sapien 83.0
d1jv2b431 Integrin beta EGF-like domains {Human (Homo sapien 82.34
d1moxc_49 Transforming growth factor alpha {Human (Homo sapi 81.39
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: Knottins (small inhibitors, toxins, lectins)
superfamily: EGF/Laminin
family: EGF-type module
domain: Neurogenic locus notch homolog protein 1, Notch1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=98.28  E-value=2.3e-07  Score=61.44  Aligned_cols=38  Identities=26%  Similarity=0.753  Sum_probs=34.6

Q ss_pred             CCCccccCCCCCCCCCCCeeecCCCCcccccCCCceecC
Q psy9822         183 PPENECLNDHHTCDPQSEQCVDLADGFECVCGRGYNKSE  221 (380)
Q Consensus       183 ~d~deC~~g~~~C~~~~g~C~n~~~g~~C~C~~Gy~G~~  221 (380)
                      +|+|||....++|. ++++|+|++++|+|.|++||+|..
T Consensus         1 qDideC~~~~~pC~-n~g~C~n~~g~y~C~C~~G~~G~~   38 (42)
T d2vj3a1           1 QDVDECSLGANPCE-HAGKCINTLGSFECQCLQGYTGPR   38 (42)
T ss_dssp             CCCCTTTSSSCSSS-TTCEEEECSSSEEEECCTTEESTT
T ss_pred             CCCccccCCCCCCC-CCcEeECCCCCEEeECCCCCcCCC
Confidence            47899987778998 899999999999999999999876
>d1kloa2 g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1kloa2 g.3.11.2 (A:66-121) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1emoa1 g.3.11.1 (A:2124-2166) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kloa1 g.3.11.2 (A:11-65) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lmja1 g.3.11.1 (A:3-46) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kloa1 g.3.11.2 (A:11-65) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1lmja2 g.3.11.1 (A:47-88) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uzka2 g.3.11.1 (A:1605-1647) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gl4a2 g.3.11.5 (A:359-398) EGF-like domain of nidogen-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1uzka1 g.3.11.1 (A:1486-1528) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1apqa_ g.3.11.1 (A:) Complement protease C1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kloa3 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1szba2 g.3.11.1 (A:124-168) Mannose-binding protein associated serine protease 2, MASP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nt0a3 g.3.11.1 (A:120-164) Mannose-binding protein associated serine protease 2, MASP2 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1dx5i3 g.3.11.1 (I:423-462) Thrombomodulin, different EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i0ua2 g.3.11.1 (A:42-82) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nzia2 g.3.11.1 (A:118-159) Complement C1S component {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3bpse1 g.3.11.1 (E:293-332) Low density lipoprotein (LDL) receptor, different EGF domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kloa3 g.3.11.2 (A:122-172) Laminin gamma1 chain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1xkba1 g.3.11.1 (A:48-86) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1autl1 g.3.11.1 (L:49-96) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d2vj3a1 g.3.11.1 (A:411-452) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a3 g.3.11.1 (A:492-526) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2vj3a2 g.3.11.1 (A:453-491) Neurogenic locus notch homolog protein 1, Notch1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1emoa2 g.3.11.1 (A:2167-2205) Fibrillin-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1edmb_ g.3.11.1 (B:) Factor IX (IXa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1sa2 g.3.11.1 (A:119-158) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2c4fl1 g.3.11.1 (L:46-82) Factor IX (IXa) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1tpga1 g.3.11.1 (A:51-91) Plasminogen activator (tissue-type), t-PA {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1olza3 g.16.2.1 (A:481-536) Semaphorin 4d {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1shyb2 g.16.2.1 (B:516-564) Hepatocyte growth factor receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g1ta2 g.3.11.1 (A:119-157) E-selectin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1shyb2 g.16.2.1 (B:516-564) Hepatocyte growth factor receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3egfa_ g.3.11.1 (A:) Epidermal growth factor, EGF {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1q4ga2 g.3.11.1 (A:32-73) Prostaglandin H2 synthase-1, EGF-like module {Sheep (Ovis aries) [TaxId: 9940]} Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvua2 g.3.11.1 (A:33-73) Prostaglandin H2 synthase-1, EGF-like module {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1autl2 g.3.11.1 (L:97-146) Activated protein c (autoprothrombin IIa) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kigl_ g.3.11.1 (L:) Factor X, N-terminal module {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ioxa_ g.3.11.1 (A:) Betacellulin-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xdtr_ g.3.11.1 (R:) Heparin-binding epidermal growth factor, HBEGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nqlb_ g.3.11.1 (B:) Epidermal growth factor, EGF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2p3ua1 g.3.11.1 (A:87-137) Factor X, N-terminal module {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k36a_ g.3.11.1 (A:) Epiregulin, EGF-domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1haea_ g.3.11.1 (A:) Heregulin-alpha, EGF-like domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1olza3 g.16.2.1 (A:481-536) Semaphorin 4d {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jv2b5 g.3.11.6 (B:563-605) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ya_ g.3.11.6 (A:) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jv2b4 g.3.11.6 (B:532-562) Integrin beta EGF-like domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1moxc_ g.3.11.1 (C:) Transforming growth factor alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure