Psyllid ID: psy9843

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-----
MNKEKVPPGCDTSAKPNSRSENEEIPFVKPDEDLTKRIIDQVEFYFSDENIVKDAFLLKHVKRNKEGFVSLKLISSFKRVKHLSKDWRVVAFALAKSEKLQINEQGTKIRRVDPLPAYDQTTPSRTIVAINIPPESATIELVAEMFKPCGEIALIRLLRPGKYTKYGNTRHFSFG
cccccccccccccccccccccccccccccccHHHHHHHHHHHHHHcccccccccHHHHHHHcccccccEEHHHHHccHHHHHHcccHHHHHHHHHccccEEEcccccEEEEccccccccccccccEEEEEccccccccHHHHHHHHcccccEEEEEEcccccccccccEEEEEEc
cccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHccccccHHHHHHHHHHccccccEEHHEEEcHHHHHHHHHHHHHHHHHHHcccEEEEcccccEEEEccccccccccccccEEEEEccccccccHHHHHHHHcccccEEEEEEEccccccccccccccccc
mnkekvppgcdtsakpnsrseneeipfvkpdedlTKRIIDQVEfyfsdenivKDAFLLKHVKRNKEGFVSLKLISSFKRVKHLSKDWRVVAFALAKSEKLQIneqgtkirrvdplpaydqttpsrtivainippesaTIELVAEMFKPCGEIALIRllrpgkytkygntrhfsfg
mnkekvppgcdtsakpnsrseneeipfvkpdedlTKRIIDQVEFYFSDENIVKDAFLLKHVKrnkegfvslklissfkrvkhlskDWRVVAFALakseklqineqgtkirrvdplpaydqttpsrtivainiPPESATIELVAEMFKPCGEIALIrllrpgkytkygntrhfsfg
MNKEKVPPGCDTSAKPNSRSENEEIPFVKPDEDLTKRIIDQVEFYFSDENIVKDAFLLKHVKRNKEGFVSLKLISSFKRVKHLSKDWRVVAFALAKSEKLQINEQGTKIRRVDPLPAYDQTTPSRTIVAINIPPESATIELVAEMFKPCGEIALIRLLRPGKYTKYGNTRHFSFG
********************************DLTKRIIDQVEFYFSDENIVKDAFLLKHVKRNKEGFVSLKLISSFKRVKHLSKDWRVVAFALAKSEKLQINEQGTKIRRVDPLPAYDQTTPSRTIVAINIPPESATIELVAEMFKPCGEIALIRLLRPGKYTKYGN*******
************************************RIIDQVEFYFSDENIVKDAFLLKHVKRNKEGFVSLKLISSFKRVKHLSKDWRVVAFALAKSEKLQINEQGTKIRRVDPLPAYDQTTPSRTIVAINIPPESATIELVAEMFKPCGEIALIRLLRPG****YGNTRHFSFG
**********************EEIPFVKPDEDLTKRIIDQVEFYFSDENIVKDAFLLKHVKRNKEGFVSLKLISSFKRVKHLSKDWRVVAFALAKSEKLQINEQGTKIRRVDPLPAYDQTTPSRTIVAINIPPESATIELVAEMFKPCGEIALIRLLRPGKYTKYGNTRHFSFG
***************************VKPDEDLTKRIIDQVEFYFSDENIVKDAFLLKHVKRNKEGFVSLKLISSFKRVKHLSKDWRVVAFALAKSEKLQINEQGTKIRRVDPLPAYDQTTPSRTIVAINIPPESATIELVAEMFKPCGEIALIRLLRPG**************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNKEKVPPGCDTSAKPNSRSENEEIPFVKPDEDLTKRIIDQVEFYFSDENIVKDAFLLKHVKRNKEGFVSLKLISSFKRVKHLSKDWRVVAFALAKSEKLQINEQGTKIRRVDPLPAYDQTTPSRTIVAINIPPESATIELVAEMFKPCGEIALIRLLRPGKYTKYGNTRHFSFG
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query175 2.2.26 [Sep-21-2011]
Q9BRS8 491 La-related protein 6 OS=H yes N/A 0.874 0.311 0.421 9e-32
Q8BN59 492 La-related protein 6 OS=M yes N/A 0.857 0.304 0.422 1e-31
Q7ZWE3 555 La-related protein 7 OS=D no N/A 0.954 0.300 0.293 3e-17
Q05CL8 570 La-related protein 7 OS=M no N/A 0.76 0.233 0.306 3e-16
Q5XI01 571 La-related protein 7 OS=R no N/A 0.76 0.232 0.313 4e-16
Q28G87 593 La-related protein 7 OS=X no N/A 0.76 0.224 0.321 1e-15
Q4R627 581 La-related protein 7 OS=M N/A N/A 0.76 0.228 0.306 2e-15
Q4G0J3 582 La-related protein 7 OS=H no N/A 0.76 0.228 0.306 2e-15
P05455 408 Lupus La protein OS=Homo no N/A 0.708 0.303 0.335 1e-11
P10881 404 Lupus La protein homolog no N/A 0.708 0.306 0.328 4e-11
>sp|Q9BRS8|LARP6_HUMAN La-related protein 6 OS=Homo sapiens GN=LARP6 PE=1 SV=1 Back     alignment and function desciption
 Score =  135 bits (341), Expect = 9e-32,   Method: Compositional matrix adjust.
 Identities = 72/171 (42%), Positives = 110/171 (64%), Gaps = 18/171 (10%)

Query: 9   GCDTSAKPNSRSENEEIPFVKPDEDLTKRIIDQVEFYFSDENIVKDAFLLKHVKRNKEGF 68
           G   S   N R E+ E  +  PDE+L K+++DQ+EFYFSDEN+ KDAFLLKHV+RNK G+
Sbjct: 68  GTTASGGENER-EDLEQEWKPPDEELIKKLVDQIEFYFSDENLEKDAFLLKHVRRNKLGY 126

Query: 69  VSLKLISSFKRVKHLSKDWRVVAFALAKSEKLQINEQGTKIRRVDPLPAY-DQTTPSRTI 127
           VS+KL++SFK+VKHL++DWR  A AL  S  L++NE   K+RR  P+P + ++  PS+ +
Sbjct: 127 VSVKLLTSFKKVKHLTRDWRTTAHALKYSVVLELNEDHRKVRRTTPVPLFPNENLPSKML 186

Query: 128 V-----------AINIPPESATI-----ELVAEMFKPCGEIALIRLLRPGK 162
           +           A+  P ++  +     E + ++F   G I+ +R+L+PG+
Sbjct: 187 LVYDLYLSPKLWALATPQKNGRVQEKVMEHLLKLFGTFGVISSVRILKPGR 237
Regulates the coordinated translation of type I collagen alpha-1 and alpha-2 mRNAs, CO1A1 and CO1A2. Stabilizes mRNAs through high-affinity binding of a stem-loop structure in their 5' UTR. This regulation requires VIM and MYH10 filaments, and the helicase DHX9.
Homo sapiens (taxid: 9606)
>sp|Q8BN59|LARP6_MOUSE La-related protein 6 OS=Mus musculus GN=Larp6 PE=1 SV=1 Back     alignment and function description
>sp|Q7ZWE3|LARP7_DANRE La-related protein 7 OS=Danio rerio GN=larp7 PE=2 SV=1 Back     alignment and function description
>sp|Q05CL8|LARP7_MOUSE La-related protein 7 OS=Mus musculus GN=Larp7 PE=1 SV=2 Back     alignment and function description
>sp|Q5XI01|LARP7_RAT La-related protein 7 OS=Rattus norvegicus GN=Larp7 PE=1 SV=2 Back     alignment and function description
>sp|Q28G87|LARP7_XENTR La-related protein 7 OS=Xenopus tropicalis GN=larp7 PE=2 SV=1 Back     alignment and function description
>sp|Q4R627|LARP7_MACFA La-related protein 7 OS=Macaca fascicularis GN=LARP7 PE=2 SV=1 Back     alignment and function description
>sp|Q4G0J3|LARP7_HUMAN La-related protein 7 OS=Homo sapiens GN=LARP7 PE=1 SV=1 Back     alignment and function description
>sp|P05455|LA_HUMAN Lupus La protein OS=Homo sapiens GN=SSB PE=1 SV=2 Back     alignment and function description
>sp|P10881|LA_BOVIN Lupus La protein homolog OS=Bos taurus GN=SSB PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query175
328713850 641 PREDICTED: hypothetical protein LOC10016 0.874 0.238 0.716 9e-59
383849308 536 PREDICTED: uncharacterized protein LOC10 0.771 0.251 0.770 1e-56
350404355 547 PREDICTED: hypothetical protein LOC10074 0.771 0.246 0.762 1e-55
340716663 547 PREDICTED: hypothetical protein LOC10064 0.771 0.246 0.762 1e-55
91087187 456 PREDICTED: similar to acheron [Tribolium 0.84 0.322 0.692 3e-55
357624099 402 acheron [Danaus plexippus] 0.84 0.365 0.660 4e-54
25990819 395 acheron, partial [Manduca sexta] 0.84 0.372 0.653 2e-53
389614818206 simila to CG17386, partial [Papilio poly 0.84 0.713 0.647 3e-53
332030034 538 La-related protein 6 [Acromyrmex echinat 0.777 0.252 0.705 3e-52
242009604 613 lupus la ribonucleoprotein, putative [Pe 0.742 0.212 0.761 7e-52
>gi|328713850|ref|XP_003245192.1| PREDICTED: hypothetical protein LOC100166574 [Acyrthosiphon pisum] Back     alignment and taxonomy information
 Score =  231 bits (589), Expect = 9e-59,   Method: Compositional matrix adjust.
 Identities = 111/155 (71%), Positives = 131/155 (84%), Gaps = 2/155 (1%)

Query: 19  RSENEEIPFVKPDEDLTKRIIDQVEFYFSDENIVKDAFLLKHVKRNKEGFVSLKLISSFK 78
           +S +E  PFV PDE+ TKRI+DQVEFYFSD NIVKDAFLLKHV+RNKEG+VSLKLISSFK
Sbjct: 146 KSGDESAPFVAPDEETTKRILDQVEFYFSDANIVKDAFLLKHVRRNKEGYVSLKLISSFK 205

Query: 79  RVKHLSKDWRVVAFALAKSEKLQINEQGTKIRRVDPLPAYDQTTPSRTIVAINIPPES-A 137
           RVKHL+KDWR VA+A+ +SEKL++NE GTK+RR +PLPAYDQTTPSRT+VAIN+  E   
Sbjct: 206 RVKHLAKDWRAVAYAITRSEKLEVNESGTKLRRKEPLPAYDQTTPSRTVVAINLAEEKPV 265

Query: 138 TIELVAEMFKPCGEIALIRLLRPGKYTKYGNTRHF 172
           TIE VAE+F+ CGEIALIR+LRPG      + RHF
Sbjct: 266 TIESVAELFRGCGEIALIRVLRPGNPIP-SDVRHF 299

Source: Acyrthosiphon pisum

Species: Acyrthosiphon pisum

Genus: Acyrthosiphon

Family: Aphididae

Order: Hemiptera

Class: Insecta

Phylum: Arthropoda

Superkingdom: Eukaryota
>gi|383849308|ref|XP_003700287.1| PREDICTED: uncharacterized protein LOC100879360 [Megachile rotundata] Back     alignment and taxonomy information
>gi|350404355|ref|XP_003487079.1| PREDICTED: hypothetical protein LOC100741779 [Bombus impatiens] Back     alignment and taxonomy information
>gi|340716663|ref|XP_003396815.1| PREDICTED: hypothetical protein LOC100645376 [Bombus terrestris] Back     alignment and taxonomy information
>gi|91087187|ref|XP_975429.1| PREDICTED: similar to acheron [Tribolium castaneum] gi|270009568|gb|EFA06016.1| hypothetical protein TcasGA2_TC008844 [Tribolium castaneum] Back     alignment and taxonomy information
>gi|357624099|gb|EHJ74998.1| acheron [Danaus plexippus] Back     alignment and taxonomy information
>gi|25990819|gb|AAN76709.1|AF443827_1 acheron, partial [Manduca sexta] Back     alignment and taxonomy information
>gi|389614818|dbj|BAM20426.1| simila to CG17386, partial [Papilio polytes] Back     alignment and taxonomy information
>gi|332030034|gb|EGI69859.1| La-related protein 6 [Acromyrmex echinatior] Back     alignment and taxonomy information
>gi|242009604|ref|XP_002425573.1| lupus la ribonucleoprotein, putative [Pediculus humanus corporis] gi|212509452|gb|EEB12835.1| lupus la ribonucleoprotein, putative [Pediculus humanus corporis] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query175
FB|FBgn0033936 867 CG17386 [Drosophila melanogast 0.908 0.183 0.546 6.2e-44
UNIPROTKB|F1MBD0 425 LARP6 "Uncharacterized protein 0.702 0.289 0.496 2.4e-33
UNIPROTKB|F1PKV9 428 LARP6 "Uncharacterized protein 0.702 0.287 0.48 2.4e-33
UNIPROTKB|F1SIT3 492 LARP6 "Uncharacterized protein 0.702 0.25 0.496 3.4e-33
UNIPROTKB|Q9BRS8 491 LARP6 "La-related protein 6" [ 0.702 0.250 0.488 2.7e-32
RGD|1308414 492 Larp6 "La ribonucleoprotein do 0.685 0.243 0.5 3.1e-32
MGI|MGI:1914807 492 Larp6 "La ribonucleoprotein do 0.685 0.243 0.5 6.9e-32
ZFIN|ZDB-GENE-030131-6403 485 larp6 "La ribonucleoprotein do 0.668 0.241 0.474 3e-30
UNIPROTKB|F1NWE6 444 LARP6 "Uncharacterized protein 0.92 0.362 0.368 1.7e-27
UNIPROTKB|E1BVY8173 LOC420093 "Uncharacterized pro 0.674 0.682 0.495 3.5e-27
FB|FBgn0033936 CG17386 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
 Score = 471 (170.9 bits), Expect = 6.2e-44, P = 6.2e-44
 Identities = 88/161 (54%), Positives = 127/161 (78%)

Query:     3 KEKVPPGCDTSAKPNSRSENEEI-PFVKPDEDLTKRIIDQVEFYFSDENIVKDAFLLKHV 61
             +++VP   +   +P   +E + + P + P E+L   I D VEFYFS+E+I+KDAFLLKHV
Sbjct:   249 EQEVPVHQEQDTEPQGPNEIDTLDPSLIPSEELAAEITDAVEFYFSNESILKDAFLLKHV 308

Query:    62 KRNKEGFVSLKLISSFKRVKHLSKDWRVVAFALA-KSEKLQINEQGTKIRRVDPLPAYDQ 120
             +RNKEGFVSLKL+SSFKRV+ L+++W+VV  A+  KS K+++N+ GTK+RR++PLP++D+
Sbjct:   309 RRNKEGFVSLKLVSSFKRVRQLTREWKVVGDAVRRKSRKIELNDVGTKVRRIEPLPSFDE 368

Query:   121 TTPSRTIVAINIPPESATIELVAEMFKPCGEIALIRLLRPG 161
             T PSRTIVA ++P +  TIE V+++F PCGEIALIR+L+PG
Sbjct:   369 TMPSRTIVACDLPLDKLTIEKVSDLFSPCGEIALIRILKPG 409
GO:0000166 "nucleotide binding" evidence=IEA
UNIPROTKB|F1MBD0 LARP6 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|F1PKV9 LARP6 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1SIT3 LARP6 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
UNIPROTKB|Q9BRS8 LARP6 "La-related protein 6" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
RGD|1308414 Larp6 "La ribonucleoprotein domain family, member 6" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1914807 Larp6 "La ribonucleoprotein domain family, member 6" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-6403 larp6 "La ribonucleoprotein domain family, member 6" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1NWE6 LARP6 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|E1BVY8 LOC420093 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query175
cd0803377 cd08033, LARP_6, La RNA-binding domain of La-relat 3e-40
smart0071580 smart00715, LA, Domain in the RNA-binding Lupus La 1e-30
cd0732375 cd07323, LAM, LA motif RNA-binding domain 1e-25
pfam0538359 pfam05383, La, La domain 5e-21
cd0802976 cd08029, LA_like_fungal, La-motif domain of fungal 5e-17
cd0802882 cd08028, LARP_3, La RNA-binding domain of La-relat 7e-17
cd0803090 cd08030, LA_like_plant, La-motif domain of plant p 2e-16
cd0803282 cd08032, LARP_7, La RNA-binding domain of La-relat 2e-15
cd1228993 cd12289, RRM_LARP6, RNA recognition motif in La-re 7e-15
cd0803473 cd08034, LARP_1_2, La RNA-binding domain proteins 2e-14
cd0803175 cd08031, LARP_4_5_like, La RNA-binding domain of p 4e-11
cd0803873 cd08038, LARP_2, La RNA-binding domain of La-relat 2e-09
cd0803773 cd08037, LARP_1, La RNA-binding domain of La-relat 5e-09
cd0803575 cd08035, LARP_4, La RNA-binding domain of La-relat 5e-06
COG5193438 COG5193, LHP1, La protein, small RNA-binding pol I 2e-04
>gnl|CDD|153402 cd08033, LARP_6, La RNA-binding domain of La-related protein 6 Back     alignment and domain information 
 Score =  130 bits (329), Expect = 3e-40
 Identities = 50/77 (64%), Positives = 67/77 (87%)

Query: 35  TKRIIDQVEFYFSDENIVKDAFLLKHVKRNKEGFVSLKLISSFKRVKHLSKDWRVVAFAL 94
            ++I+ QVE+YFSDEN++KDAFLLKHV+RNKEG+V +KLI+SFK+VK L++DWRVVA AL
Sbjct: 1   IQKIVKQVEYYFSDENLLKDAFLLKHVRRNKEGYVPIKLIASFKKVKALTRDWRVVAAAL 60

Query: 95  AKSEKLQINEQGTKIRR 111
            +S KL ++E G K+RR
Sbjct: 61  RRSSKLVVSEDGKKVRR 77

This domain is found in animal and plant proteins related to the La autoantigen. A variety of La-related proteins (LARPs or La ribonucleoproteins), with differing domain architecture, appear to function as RNA-binding proteins in eukaryotic cellular processes. Length = 77
>gnl|CDD|128955 smart00715, LA, Domain in the RNA-binding Lupus La protein; unknown function Back     alignment and domain information
>gnl|CDD|153396 cd07323, LAM, LA motif RNA-binding domain Back     alignment and domain information
>gnl|CDD|203243 pfam05383, La, La domain Back     alignment and domain information
>gnl|CDD|153398 cd08029, LA_like_fungal, La-motif domain of fungal proteins similar to the La autoantigen Back     alignment and domain information
>gnl|CDD|153397 cd08028, LARP_3, La RNA-binding domain of La-related protein 3 Back     alignment and domain information
>gnl|CDD|153399 cd08030, LA_like_plant, La-motif domain of plant proteins similar to the La autoantigen Back     alignment and domain information
>gnl|CDD|153401 cd08032, LARP_7, La RNA-binding domain of La-related protein 7 Back     alignment and domain information
>gnl|CDD|240735 cd12289, RRM_LARP6, RNA recognition motif in La-related protein 6 (LARP6) and similar proteins Back     alignment and domain information
>gnl|CDD|153403 cd08034, LARP_1_2, La RNA-binding domain proteins similar to La-related proteins 1 and 2 Back     alignment and domain information
>gnl|CDD|153400 cd08031, LARP_4_5_like, La RNA-binding domain of proteins similar to La-related proteins 4 and 5 Back     alignment and domain information
>gnl|CDD|153407 cd08038, LARP_2, La RNA-binding domain of La-related protein 2 Back     alignment and domain information
>gnl|CDD|153406 cd08037, LARP_1, La RNA-binding domain of La-related protein 1 Back     alignment and domain information
>gnl|CDD|153404 cd08035, LARP_4, La RNA-binding domain of La-related protein 4 Back     alignment and domain information
>gnl|CDD|227520 COG5193, LHP1, La protein, small RNA-binding pol III transcript stabilizing protein and related La-motif-containing proteins involved in translation [Posttranslational modification, protein turnover, chaperones / Translation, ribosomal structure and biogenesis] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 175
KOG1855|consensus 484 100.0
cd0803282 LARP_7 La RNA-binding domain of La-related protein 100.0
cd0803377 LARP_6 La RNA-binding domain of La-related protein 100.0
cd0803575 LARP_4 La RNA-binding domain of La-related protein 99.98
smart0071580 LA Domain in the RNA-binding Lupus La protein; unk 99.97
cd0802976 LA_like_fungal La-motif domain of fungal proteins 99.97
cd0803675 LARP_5 La RNA-binding domain of La-related protein 99.97
cd0802882 LARP_3 La RNA-binding domain of La-related protein 99.97
cd0803175 LARP_4_5_like La RNA-binding domain of proteins si 99.97
cd0803090 LA_like_plant La-motif domain of plant proteins si 99.97
cd0803773 LARP_1 La RNA-binding domain of La-related protein 99.97
cd0803873 LARP_2 La RNA-binding domain of La-related protein 99.96
cd0803473 LARP_1_2 La RNA-binding domain proteins similar to 99.96
cd0732375 LAM LA motif RNA-binding domain. This domain is fo 99.96
PF0538361 La: La domain; InterPro: IPR006630 Human Ro ribonu 99.93
KOG4213|consensus205 99.89
KOG2591|consensus 684 99.85
COG5193 438 LHP1 La protein, small RNA-binding pol III transcr 99.57
KOG2590|consensus448 98.95
COG5193438 LHP1 La protein, small RNA-binding pol III transcr 98.91
PF1425970 RRM_6: RNA recognition motif (a.k.a. RRM, RBD, or 97.57
PF0007670 RRM_1: RNA recognition motif. (a.k.a. RRM, RBD, or 97.55
smart0036272 RRM_2 RNA recognition motif. 97.5
TIGR01622 457 SF-CC1 splicing factor, CC1-like family. A homolog 97.33
TIGR01661352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 97.31
PLN03134144 glycine-rich RNA-binding protein 4; Provisional 97.26
TIGR01659 346 sex-lethal sex-lethal family splicing factor. This 97.17
cd0059074 RRM RRM (RNA recognition motif), also known as RBD 96.92
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 96.86
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 96.84
TIGR01659 346 sex-lethal sex-lethal family splicing factor. This 96.74
TIGR01628 562 PABP-1234 polyadenylate binding protein, human typ 96.61
TIGR01661 352 ELAV_HUD_SF ELAV/HuD family splicing factor. These 96.59
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 96.54
COG0724 306 RNA-binding proteins (RRM domain) [General functio 96.49
smart0036071 RRM RNA recognition motif. 96.35
TIGR01642 509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 96.34
TIGR01622 457 SF-CC1 splicing factor, CC1-like family. A homolog 96.3
PF09421 989 FRQ: Frequency clock protein; InterPro: IPR018554 96.11
TIGR01645 612 half-pint poly-U binding splicing factor, half-pin 95.79
TIGR01649 481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 95.78
KOG0113|consensus 335 95.46
KOG0126|consensus 219 95.29
KOG0122|consensus270 95.16
KOG0114|consensus124 94.92
KOG0130|consensus170 94.54
KOG0144|consensus 510 94.46
PF01885186 PTS_2-RNA: RNA 2'-phosphotransferase, Tpt1 / KptA 94.04
PF1460553 Nup35_RRM_2: Nup53/35/40-type RNA recognition moti 93.78
KOG0145|consensus 360 93.67
KOG0117|consensus 506 93.48
KOG0148|consensus 321 93.24
KOG0110|consensus725 93.12
KOG2278|consensus207 93.03
TIGR01649481 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor 93.02
KOG0108|consensus 435 92.33
KOG4207|consensus 256 92.19
TIGR01648 578 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein 92.01
KOG0127|consensus 678 91.89
PLN03213 759 repressor of silencing 3; Provisional 91.79
KOG4206|consensus 221 91.67
KOG0116|consensus419 91.18
TIGR01642 509 U2AF_lg U2 snRNP auxilliary factor, large subunit, 90.07
PRK00819179 RNA 2'-phosphotransferase; Reviewed 89.65
KOG0117|consensus 506 89.5
smart0036170 RRM_1 RNA recognition motif. 89.42
KOG0145|consensus 360 88.87
KOG1548|consensus 382 87.94
KOG0132|consensus 894 86.64
PF1389356 RRM_5: RNA recognition motif. (a.k.a. RRM, RBD, or 86.22
KOG4660|consensus 549 85.2
KOG0144|consensus 510 84.8
KOG0127|consensus 678 84.48
PF08777105 RRM_3: RNA binding motif; InterPro: IPR014886 This 84.26
KOG0123|consensus 369 83.51
KOG0148|consensus 321 83.14
KOG0123|consensus369 82.39
KOG0125|consensus 376 82.06
PTZ00315582 2'-phosphotransferase; Provisional 81.67
KOG0124|consensus 544 80.91
KOG4205|consensus 311 80.58
>KOG1855|consensus Back     alignment and domain information 
Probab=100.00  E-value=1.8e-37  Score=275.46  Aligned_cols=143  Identities=52%  Similarity=0.912  Sum_probs=135.4

Q ss_pred             CCCCHHHHHHHHhhhhhhccCCCCCcchHHHHhhccCCCCceeHHHHhcchhhhhhcCCHHHHHHHHhcCCceEEeecCc
Q psy9843          28 VKPDEDLTKRIIDQVEFYFSDENIVKDAFLLKHVKRNKEGFVSLKLISSFKRVKHLSKDWRVVAFALAKSEKLQINEQGT  107 (175)
Q Consensus        28 ~~~~e~l~~~I~~QvEfYFSd~NL~~D~fL~~~~~~~~~g~Vpl~~i~~F~r~k~lt~d~~~i~~Al~~S~~lev~edg~  107 (175)
                      .++.|++..+|.+||||||||.||.+|.||++.|+++.+|||||++|++|+|||+||.|+.+|+.||+.|..|+|||||+
T Consensus       134 ~~lsedl~~kIv~QVEyyFSDenL~~d~fLlkhvrrnkeGyVpv~~vaSFKKvK~LTrd~~~va~ALr~S~kL~vseDgk  213 (484)
T KOG1855|consen  134 LILSEDLAAKIVDQVEYYFSDENLLKDAFLLKHVRRNKEGYVPVKLVASFKKVKALTRDWKLVADALRKSSKLEVSEDGK  213 (484)
T ss_pred             ccccHHHHHHHHHHhheeeccccccchHHHHHHHhcCCCCceeeehhhhHHHHHHHhhhhHHHHHHHhhcceEEEccCCc
Confidence            45788999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             EEEeCCCCCCCCC-CCCCceEEEecCCCCCCCHHHHHHHhccCCcccEEEeeCCCCCCCCCCCccCC
Q psy9843         108 KIRRVDPLPAYDQ-TTPSRTIVAINIPPESATIELVAEMFKPCGEIALIRLLRPGKYTKYGNTRHFS  173 (175)
Q Consensus       108 ~VRR~~plp~~~~-~~~~rtv~v~~~p~~~~t~e~i~~~F~~~G~V~~Vrl~r~~~~~p~~~~~~~~  173 (175)
                      +|||..|||+.+. +...|||+++++|.+ ...|.|..+|+.+|.|.+||+|+|| .+| .|.|+|.
T Consensus       214 KVrRisPlp~~~~eel~srtivaenLP~D-h~~enl~kiFg~~G~IksIRIckPg-aip-~d~r~~~  277 (484)
T KOG1855|consen  214 KVRRISPLPEFDEEELPSRTIVAENLPLD-HSYENLSKIFGTVGSIKSIRICKPG-AIP-EDVRGFP  277 (484)
T ss_pred             eeeecCCCCCccccccccceEEEecCCcc-hHHHHHHHHhhcccceeeeeecCCC-CCC-cccccCC
Confidence            9999999999875 478899999999986 6789999999999999999999999 999 8888763

>cd08032 LARP_7 La RNA-binding domain of La-related protein 7 Back     alignment and domain information
>cd08033 LARP_6 La RNA-binding domain of La-related protein 6 Back     alignment and domain information
>cd08035 LARP_4 La RNA-binding domain of La-related protein 4 Back     alignment and domain information
>smart00715 LA Domain in the RNA-binding Lupus La protein; unknown function Back     alignment and domain information
>cd08029 LA_like_fungal La-motif domain of fungal proteins similar to the La autoantigen Back     alignment and domain information
>cd08036 LARP_5 La RNA-binding domain of La-related protein 5 Back     alignment and domain information
>cd08028 LARP_3 La RNA-binding domain of La-related protein 3 Back     alignment and domain information
>cd08031 LARP_4_5_like La RNA-binding domain of proteins similar to La-related proteins 4 and 5 Back     alignment and domain information
>cd08030 LA_like_plant La-motif domain of plant proteins similar to the La autoantigen Back     alignment and domain information
>cd08037 LARP_1 La RNA-binding domain of La-related protein 1 Back     alignment and domain information
>cd08038 LARP_2 La RNA-binding domain of La-related protein 2 Back     alignment and domain information
>cd08034 LARP_1_2 La RNA-binding domain proteins similar to La-related proteins 1 and 2 Back     alignment and domain information
>cd07323 LAM LA motif RNA-binding domain Back     alignment and domain information
>PF05383 La: La domain; InterPro: IPR006630 Human Ro ribonucleoproteins (RNPs) are composed of one of the four small Y RNAs and at least two proteins, Ro60 and La Back     alignment and domain information
>KOG4213|consensus Back     alignment and domain information
>KOG2591|consensus Back     alignment and domain information
>COG5193 LHP1 La protein, small RNA-binding pol III transcript stabilizing protein and related La-motif-containing proteins involved in translation [Posttranslational modification, protein turnover, chaperones / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2590|consensus Back     alignment and domain information
>COG5193 LHP1 La protein, small RNA-binding pol III transcript stabilizing protein and related La-motif-containing proteins involved in translation [Posttranslational modification, protein turnover, chaperones / Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF14259 RRM_6: RNA recognition motif (a Back     alignment and domain information
>PF00076 RRM_1: RNA recognition motif Back     alignment and domain information
>smart00362 RRM_2 RNA recognition motif Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>PLN03134 glycine-rich RNA-binding protein 4; Provisional Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>cd00590 RRM RRM (RNA recognition motif), also known as RBD (RNA binding domain) or RNP (ribonucleoprotein domain), is a highly abundant domain in eukaryotes found in proteins involved in post-transcriptional gene expression processes including mRNA and rRNA processing, RNA export, and RNA stability Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>TIGR01659 sex-lethal sex-lethal family splicing factor Back     alignment and domain information
>TIGR01628 PABP-1234 polyadenylate binding protein, human types 1, 2, 3, 4 family Back     alignment and domain information
>TIGR01661 ELAV_HUD_SF ELAV/HuD family splicing factor Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>COG0724 RNA-binding proteins (RRM domain) [General function prediction only] Back     alignment and domain information
>smart00360 RRM RNA recognition motif Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>TIGR01622 SF-CC1 splicing factor, CC1-like family Back     alignment and domain information
>PF09421 FRQ: Frequency clock protein; InterPro: IPR018554 The frequency clock protein, is the central component of the frq-based circadian negative feedback loop, regulates various aspects of the circadian clock in Neurospora crassa [] Back     alignment and domain information
>TIGR01645 half-pint poly-U binding splicing factor, half-pint family Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>KOG0113|consensus Back     alignment and domain information
>KOG0126|consensus Back     alignment and domain information
>KOG0122|consensus Back     alignment and domain information
>KOG0114|consensus Back     alignment and domain information
>KOG0130|consensus Back     alignment and domain information
>KOG0144|consensus Back     alignment and domain information
>PF01885 PTS_2-RNA: RNA 2'-phosphotransferase, Tpt1 / KptA family; InterPro: IPR002745 The final step of tRNA splicing in Saccharomyces cerevisiae (Baker's yeast) requires 2'-phosphotransferase (Tpt1) to transfer the 2'-phosphate from ligated tRNA to NAD, producing mature tRNA and ADP ribose-1' '-2' '-cyclic phosphate Back     alignment and domain information
>PF14605 Nup35_RRM_2: Nup53/35/40-type RNA recognition motif Back     alignment and domain information
>KOG0145|consensus Back     alignment and domain information
>KOG0117|consensus Back     alignment and domain information
>KOG0148|consensus Back     alignment and domain information
>KOG0110|consensus Back     alignment and domain information
>KOG2278|consensus Back     alignment and domain information
>TIGR01649 hnRNP-L_PTB hnRNP-L/PTB/hephaestus splicing factor family Back     alignment and domain information
>KOG0108|consensus Back     alignment and domain information
>KOG4207|consensus Back     alignment and domain information
>TIGR01648 hnRNP-R-Q heterogeneous nuclear ribonucleoprotein R, Q family Back     alignment and domain information
>KOG0127|consensus Back     alignment and domain information
>PLN03213 repressor of silencing 3; Provisional Back     alignment and domain information
>KOG4206|consensus Back     alignment and domain information
>KOG0116|consensus Back     alignment and domain information
>TIGR01642 U2AF_lg U2 snRNP auxilliary factor, large subunit, splicing factor Back     alignment and domain information
>PRK00819 RNA 2'-phosphotransferase; Reviewed Back     alignment and domain information
>KOG0117|consensus Back     alignment and domain information
>smart00361 RRM_1 RNA recognition motif Back     alignment and domain information
>KOG0145|consensus Back     alignment and domain information
>KOG1548|consensus Back     alignment and domain information
>KOG0132|consensus Back     alignment and domain information
>PF13893 RRM_5: RNA recognition motif Back     alignment and domain information
>KOG4660|consensus Back     alignment and domain information
>KOG0144|consensus Back     alignment and domain information
>KOG0127|consensus Back     alignment and domain information
>PF08777 RRM_3: RNA binding motif; InterPro: IPR014886 This domain is found in protein La which functions as an RNA chaperone during RNA polymerase III transcription, and can also stimulate translation initiation Back     alignment and domain information
>KOG0123|consensus Back     alignment and domain information
>KOG0148|consensus Back     alignment and domain information
>KOG0123|consensus Back     alignment and domain information
>KOG0125|consensus Back     alignment and domain information
>PTZ00315 2'-phosphotransferase; Provisional Back     alignment and domain information
>KOG0124|consensus Back     alignment and domain information
>KOG4205|consensus Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query175
1s29_A92 La Autoantigen N-Terminal Domain Length = 92 2e-14
2vod_A193 Crystal Structure Of N-Terminal Domains Of Human La 2e-12
1yty_A194 Structural Basis For Recognition Of Uuuoh 3'-Termin 3e-11
1zh5_A195 Structural Basis For Recognition Of Uuuoh 3'-Termin 3e-11
1s7a_A103 Nmr Structure Of The La Motif Of Human La Protein L 2e-10
2cqk_A101 Solution Structure Of The La Domain Of C-Mpl Bindin 4e-06
>pdb|1S29|A Chain A, La Autoantigen N-Terminal Domain Length = 92 Back     alignment and structure 
Iteration: 1

 Score = 75.1 bits (183), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 38/81 (46%), Positives = 53/81 (65%)
Query: 36  KRIIDQVEFYFSDENIVKDAFLLKHVKRNKEGFVSLKLISSFKRVKHLSKDWRVVAFALA 95
           +++  QVEFYFSD N+ +D FL      N EGFVSL+ + +FKRV  ++ D + V  A+ 
Sbjct: 12  QKLQKQVEFYFSDVNVQRDIFLKGKXAENAEGFVSLETLLTFKRVNSVTTDVKEVVEAIR 71
Query: 96  KSEKLQINEQGTKIRRVDPLP 116
            SEKL ++E G  +RR DPLP
Sbjct: 72  PSEKLVLSEDGLXVRRRDPLP 92
>pdb|2VOD|A Chain A, Crystal Structure Of N-Terminal Domains Of Human La Protein Complexed With Rna Oligomer Auauuuu Length = 193 Back     alignment and structure
>pdb|1YTY|A Chain A, Structural Basis For Recognition Of Uuuoh 3'-Terminii Of Nascent Rna Pol Iii Transcripts By La Autoantigen Length = 194 Back     alignment and structure
>pdb|1ZH5|A Chain A, Structural Basis For Recognition Of Uuuoh 3'-Terminii Of Nascent Rna Pol Iii Transcripts By La Autoantigen Length = 195 Back     alignment and structure
>pdb|1S7A|A Chain A, Nmr Structure Of The La Motif Of Human La Protein Length = 103 Back     alignment and structure
>pdb|2CQK|A Chain A, Solution Structure Of The La Domain Of C-Mpl Binding Protein Length = 101 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query175
1s29_A92 LA protein; winged helix-turn-helix, autoantigen, 2e-37
2cqk_A101 C-MPL binding protein; LA domain, structural genom 2e-29
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 3e-25
>1s29_A LA protein; winged helix-turn-helix, autoantigen, RNA-binding, RNA binding protein; 1.60A {Trypanosoma brucei} SCOP: a.4.5.46 Length = 92 Back     alignment and structure
 Score =  123 bits (310), Expect = 2e-37
 Identities = 38/90 (42%), Positives = 56/90 (62%)

Query: 27  FVKPDEDLTKRIIDQVEFYFSDENIVKDAFLLKHVKRNKEGFVSLKLISSFKRVKHLSKD 86
            +    +  +++  QVEFYFSD N+ +D FL   +  N EGFVSL+ + +FKRV  ++ D
Sbjct: 3   HMPLSSENKQKLQKQVEFYFSDVNVQRDIFLKGKMAENAEGFVSLETLLTFKRVNSVTTD 62

Query: 87  WRVVAFALAKSEKLQINEQGTKIRRVDPLP 116
            + V  A+  SEKL ++E G  +RR DPLP
Sbjct: 63  VKEVVEAIRPSEKLVLSEDGLMVRRRDPLP 92
>2cqk_A C-MPL binding protein; LA domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.5.46 Length = 101 Back     alignment and structure
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Length = 193 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query175
2voo_A193 Lupus LA protein; RNA-binding protein, RNA recogni 100.0
1s29_A92 LA protein; winged helix-turn-helix, autoantigen, 100.0
2cqk_A101 C-MPL binding protein; LA domain, structural genom 100.0
1s79_A103 Lupus LA protein; RRM, alpha/beta, RNA binding pro 98.49
2lxi_A91 RNA-binding protein 10; NMR {Homo sapiens} 98.18
2dnh_A105 Bruno-like 5, RNA binding protein; RRM domain, RBD 98.16
2do4_A100 Squamous cell carcinoma antigen recognized by T- c 98.15
1wf0_A88 TDP-43, TAR DNA-binding protein-43; structural gen 98.15
3s7r_A87 Heterogeneous nuclear ribonucleoprotein A/B; ferre 98.14
2ywk_A95 Putative RNA-binding protein 11; RRM-domain, struc 98.13
2cq3_A103 RNA-binding protein 9; RRM domain, structural geno 98.13
1whw_A99 Hypothetical protein riken cDNA 1200009A02; RNA re 98.11
2rs2_A109 Musashi-1, RNA-binding protein musashi homolog 1; 98.06
3r27_A100 HnRNP L, heterogeneous nuclear ribonucleoprotein L 98.06
4fxv_A99 ELAV-like protein 1; RNA recognition motif, putati 98.06
2lkz_A95 RNA-binding protein 5; RRM; NMR {Homo sapiens} 98.06
3mdf_A85 Peptidyl-prolyl CIS-trans isomerase E; RRM domain, 98.06
2e5h_A94 Zinc finger CCHC-type and RNA-binding motif- conta 98.05
2err_A109 Ataxin-2-binding protein 1; protein-RNA complex, R 98.05
2cpy_A114 RNA-binding protein 12; RRM domain, structural gen 98.05
3ucg_A89 Polyadenylate-binding protein 2; ferredoxin-like, 98.05
2fy1_A116 RNA-binding motif protein, Y chromosome, family 1 98.04
1uaw_A77 Mouse-musashi-1; RNP-type structure, RNA binding p 98.04
1x4e_A85 RNA binding motif, single-stranded interacting pro 98.03
2dgs_A99 DAZ-associated protein 1; RRM domain, structural g 98.03
1h2v_Z156 20 kDa nuclear CAP binding protein; CAP-binding-co 98.02
3bs9_A87 Nucleolysin TIA-1 isoform P40; RNA recognition mot 98.02
2cqi_A103 Nucleolysin TIAR; RNA recognition motif, RRM, RNA 98.02
3d2w_A89 TAR DNA-binding protein 43; DP-43 proteinopathy, T 98.02
2cph_A107 RNA binding motif protein 19; RNA recognition moti 98.02
2cqd_A116 RNA-binding region containing protein 1; RNA recog 98.01
2xs2_A102 Deleted in azoospermia-like; RNA binding protein-R 98.01
1x5u_A105 Splicing factor 3B subunit 4 (spliceosome associat 98.01
1x4a_A109 Splicing factor, arginine/serine-rich 1 (splicing 98.01
3s8s_A110 Histone-lysine N-methyltransferase SETD1A; chromat 98.0
2dnz_A95 Probable RNA-binding protein 23; RNA recognition m 98.0
2cq1_A101 PTB-like protein L; RRM domain, structural genomic 98.0
2cq4_A114 RNA binding motif protein 23; RRM domain, structur 98.0
1x4h_A111 RNA-binding protein 28; structural genomics, RRM d 97.99
2d9p_A103 Polyadenylate-binding protein 3; RRM domain, struc 97.99
1x5t_A96 Splicing factor 3B subunit 4; structure genomics, 97.98
2dgp_A106 Bruno-like 4, RNA binding protein; RRM domain, str 97.98
2x1f_A96 MRNA 3'-END-processing protein RNA15; transcriptio 97.98
1sjq_A105 Polypyrimidine tract-binding protein 1; babbab mot 97.98
2krb_A81 Eukaryotic translation initiation factor 3 subunit 97.98
2do0_A114 HnRNP M, heterogeneous nuclear ribonucleoprotein M 97.97
1p27_B106 RNA-binding protein 8A; nuclear protein, mRNA spli 97.97
3lqv_A115 PRE-mRNA branch site protein P14; cysless mutant, 97.97
2khc_A118 Testis-specific RNP-type RNA binding protein; RRM, 97.97
2dnm_A103 SRP46 splicing factor; RRM domain, RBD, structural 97.97
1x5o_A114 RNA binding motif, single-stranded interacting pro 97.96
2cqb_A102 Peptidyl-prolyl CIS-trans isomerase E; RNA recogni 97.96
1wex_A104 Hypothetical protein (riken cDNA 2810036L13); stru 97.95
3ulh_A107 THO complex subunit 4; nuclear protein, RNA bindin 97.95
2ad9_A119 Polypyrimidine tract-binding protein 1; RBD, RRM, 97.95
1x5s_A102 Cold-inducible RNA-binding protein; structure geno 97.94
2dgo_A115 Cytotoxic granule-associated RNA binding protein 1 97.94
2cqg_A103 TDP-43, TAR DNA-binding protein-43; RNA recognitio 97.94
1wg5_A104 Heterogeneous nuclear ribonucleoprotein H; structu 97.94
3md1_A83 Nuclear and cytoplasmic polyadenylated RNA-bindin 97.94
1oo0_B110 CG8781-PA, drosophila Y14; RNA recognition motif, 97.93
1wi8_A104 EIF-4B, eukaryotic translation initiation factor 4 97.93
3ex7_B126 RNA-binding protein 8A; protein-RNA complex, mRNA 97.93
2cpj_A99 Non-POU domain-containing octamer-binding protein; 97.92
3nmr_A175 Cugbp ELAV-like family member 1; RRM, PRE-mRNA spl 97.91
1x4b_A116 Heterogeneous nuclear ribonucleoproteins A2/B1; st 97.91
2dgv_A92 HnRNP M, heterogeneous nuclear ribonucleoprotein M 97.91
2cqc_A95 Arginine/serine-rich splicing factor 10; RNA recog 97.91
4f25_A115 Polyadenylate-binding protein 1; RRM fold, transla 97.9
1b7f_A168 Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP 97.9
2mss_A75 Protein (musashi1); RNA-binding domain, RNA bindin 97.9
2ku7_A140 MLL1 PHD3-CYP33 RRM chimeric protein; transcriptio 97.9
2cq0_A103 Eukaryotic translation initiation factor 3 subunit 97.89
1iqt_A75 AUF1, heterogeneous nuclear ribonucleoprotein D0; 97.89
3md3_A166 Nuclear and cytoplasmic polyadenylated RNA-bindin 97.89
2cpz_A115 CUG triplet repeat RNA-binding protein 1; RRM doma 97.89
2kxn_B129 Transformer-2 protein homolog beta; SR protein, RR 97.89
2kt5_A124 RNA and export factor-binding protein 2; chaperone 97.89
2ki2_A90 SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA 97.88
2dh8_A105 DAZ-associated protein 1; RRM domain, structural g 97.87
2jrs_A108 RNA-binding protein 39; RNA binding motif of RBM39 97.87
2j76_E100 EIF-4B, EIF4B, eukaryotic translation initiation f 97.86
2cpe_A113 RNA-binding protein EWS; RNA recognition motif, RR 97.86
2la6_A99 RNA-binding protein FUS; structural genomics, nort 97.86
3ns6_A100 Eukaryotic translation initiation factor 3 subuni; 97.85
2dhg_A104 TRNA selenocysteine associated protein (SECP43); R 97.85
1x4d_A102 Matrin 3; structural genomics, RRM domain, NPPSFA, 97.84
2dnl_A114 Cytoplasmic polyadenylation element binding protei 97.84
2ytc_A85 PRE-mRNA-splicing factor RBM22; RRM domain, RBD, s 97.84
1l3k_A196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 97.83
4a8x_A88 RNA-binding protein with serine-rich domain 1; tra 97.82
2div_A99 TRNA selenocysteine associated protein; structural 97.82
2db1_A118 Heterogeneous nuclear ribonucleoprotein F; RRM dom 97.81
2m2b_A131 RNA-binding protein 10; T-cell, JCSG, MPP, PSI-bio 97.81
2g4b_A172 Splicing factor U2AF 65 kDa subunit; protein-RNA c 97.81
2nlw_A105 Eukaryotic translation initiation factor 3 subunit 97.81
2jwn_A124 Embryonic polyadenylate-binding protein 2-B; epabp 97.81
2lmi_A107 GRSF-1, G-rich sequence factor 1; G-rich RNA seque 97.78
2cpf_A98 RNA binding motif protein 19; RNA recognition moti 97.78
1why_A97 Hypothetical protein riken cDNA 1810017N16; RNA re 97.78
1p1t_A104 Cleavage stimulation factor, 64 kDa subunit; RNA r 97.77
1x4g_A109 Nucleolysin TIAR; structural genomics, RRM domain, 97.77
1wez_A102 HnRNP H', FTP-3, heterogeneous nuclear ribonucleop 97.76
2hvz_A101 Splicing factor, arginine/serine-rich 7; RRM, RNA 97.75
1whx_A111 Hypothetical protein riken cDNA 1200009A02; RNA re 97.75
4f02_A 213 Polyadenylate-binding protein 1; mRNA, eukaryotic 97.74
2dnq_A90 RNA-binding protein 4B; RRM domain,RBD, structural 97.74
1fxl_A167 Paraneoplastic encephalomyelitis antigen HUD; prot 97.74
2dis_A109 Unnamed protein product; structural genomics, RRM 97.74
1u6f_A139 Tcubp1, RNA-binding protein UBP1; trypanosome, mRN 97.71
2dgw_A91 Probable RNA-binding protein 19; RRM domain, struc 97.7
2dgx_A96 KIAA0430 protein; RRM domain, structural genomics, 97.69
2lea_A135 Serine/arginine-rich splicing factor 2; SR protein 97.68
1x4f_A112 Matrin 3; structural genomics, RRM domain, NPPSFA, 97.68
2jvo_A108 Nucleolar protein 3; nucleus, phosphorylation, rib 97.68
1l3k_A 196 Heterogeneous nuclear ribonucleoprotein A1; nuclea 97.68
3smz_A284 Protein raver-1, ribonucleoprotein PTB-binding 1; 97.67
1rk8_A165 CG8781-PA, CG8781-PA protein; mRNA processing, RRM 97.67
2dng_A103 Eukaryotic translation initiation factor 4H; RRM d 97.66
2kvi_A96 Nuclear polyadenylated RNA-binding protein 3; RNA- 97.66
3p5t_L90 Cleavage and polyadenylation specificity factor S; 97.66
2hgn_A139 Heterogeneous nuclear ribonucleoprotein F; RNA rec 97.66
2qfj_A 216 FBP-interacting repressor; protein-DNA complex; HE 97.64
2xnq_A97 Nuclear polyadenylated RNA-binding protein 3; tran 97.64
2hgl_A136 HNRPF protein, heterogeneous nuclear ribonucleopro 97.63
2la4_A101 Nuclear and cytoplasmic polyadenylated RNA-bindin 97.62
2cpi_A111 CCR4-NOT transcription complex subunit 4; RNA reco 97.62
2i2y_A150 Fusion protein consists of immunoglobin G- binding 97.6
1wf1_A110 RNA-binding protein RALY; structural genomics, RRM 97.6
2kn4_A158 Immunoglobulin G-binding protein G, splicing FACT 97.59
2ek1_A95 RNA-binding protein 12; RNA recognition motif, dim 97.58
2f3j_A177 RNA and export factor binding protein 2; RRM domai 97.58
2dha_A123 FLJ20171 protein; RRM domain, structural genomics, 97.58
2yh0_A198 Splicing factor U2AF 65 kDa subunit; PRE-mRNA spli 97.56
1wel_A124 RNA-binding protein 12; structural genomics, NPPSF 97.55
1x4c_A108 Splicing factor, arginine/serine-rich 1; structura 97.53
2fc9_A101 NCL protein; structure genomics, RRM_1 domain, str 97.53
2dnn_A109 RNA-binding protein 12; RRM domain, RBD, structura 97.53
2dgu_A103 Heterogeneous nuclear ribonucleoprotein Q; RRM dom 97.52
3n9u_C156 Cleavage and polyadenylation specificity factor S; 97.49
2cjk_A167 Nuclear polyadenylated RNA-binding protein 4; HRP1 97.49
2ghp_A292 U4/U6 snRNA-associated splicing factor PRP24; RNA 97.48
2hzc_A87 Splicing factor U2AF 65 kDa subunit; RNA splicing, 97.47
2a3j_A127 U1 small nuclear ribonucleoprotein A; computationa 97.47
1nu4_A97 U1A RNA binding domain; RNA recognition motif, U1 97.46
2cqp_A98 RNA-binding protein 12; RNA recognition motif, RRM 97.45
2dgt_A92 RNA-binding protein 30; RRM domain, structural gen 97.44
2j8a_A136 Histone-lysine N-methyltransferase, H3 lysine-4 sp 97.43
2lcw_A116 RNA-binding protein FUS; RRM, nucleic acid binding 96.55
2cpd_A99 Apobec-1 stimulating protein; RNA recognition moti 97.42
2dnp_A90 RNA-binding protein 14; RRM domain, RBD, structura 97.39
2hgm_A126 HNRPF protein, heterogeneous nuclear ribonucleopro 97.38
2cpx_A115 Hypothetical protein FLJ11016; RRM domain, structu 97.37
3sde_A 261 Paraspeckle component 1; RRM, anti parallel right 97.37
2bz2_A121 Negative elongation factor E; NELF E, RNA recognit 97.36
2e5j_A97 Methenyltetrahydrofolate synthetase domain contain 97.31
2qfj_A216 FBP-interacting repressor; protein-DNA complex; HE 97.3
2adc_A 229 Polypyrimidine tract-binding protein 1; RBD, RRM, 97.29
2jvr_A111 Nucleolar protein 3; RNA recognition motif, nucleu 97.23
3sde_A 261 Paraspeckle component 1; RRM, anti parallel right 97.23
3q2s_C 229 Cleavage and polyadenylation specificity factor S; 97.21
4f02_A213 Polyadenylate-binding protein 1; mRNA, eukaryotic 97.19
2ghp_A 292 U4/U6 snRNA-associated splicing factor PRP24; RNA 97.17
3beg_B115 Splicing factor, arginine/serine-rich 1; kinase, S 97.16
1x5p_A97 Negative elongation factor E; structure genomics, 97.15
1fje_B175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 97.15
2e5g_A94 U6 snRNA-specific terminal uridylyltransferase 1; 97.12
3egn_A143 RNA-binding protein 40; RNA recognition motif (RRM 97.09
1fj7_A101 Nucleolin RBD1, protein C23; RNP, RRM, RNA binding 97.08
1fjc_A96 Nucleolin RBD2, protein C23; RNP, RRM, RNA binding 97.07
2cqh_A93 IGF-II mRNA-binding protein 2 isoform A; RNA recog 97.06
2wbr_A89 GW182, gawky, LD47780P; DNA-binding protein, RRM, 97.04
1wg1_A88 KIAA1579 protein, homolog EXC-7; RBD, structural g 97.04
3pgw_S 437 U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM 97.02
2cq2_A114 Hypothetical protein LOC91801; RRM domain, structu 97.01
3smz_A 284 Protein raver-1, ribonucleoprotein PTB-binding 1; 96.94
2e44_A96 Insulin-like growth factor 2 mRNA binding protein 96.93
3pgw_A282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 96.87
3tyt_A205 Heterogeneous nuclear ribonucleoprotein L; ferredo 96.73
1qm9_A198 Polypyrimidine tract-binding protein; ribonucleopr 96.73
2adc_A229 Polypyrimidine tract-binding protein 1; RBD, RRM, 96.69
1sjr_A164 Polypyrimidine tract-binding protein 1; extended b 96.62
2pe8_A105 Splicing factor 45; RRM, protein binding; 2.00A {H 96.62
3u1l_A240 PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 96.59
3pgw_A 282 U1-A; protein-RNA complex, U1 snRNA, SM fold, SM c 96.51
2fc8_A102 NCL protein; structure genomics, RRM_1 domain, str 96.51
3zzy_A130 Polypyrimidine tract-binding protein 1; protein bi 96.5
1fje_B 175 Nucleolin RBD12, protein C23; RNP, RRM, RNA bindin 96.4
3v4m_A105 Splicing factor U2AF 65 kDa subunit; canonical RNA 96.33
2dit_A112 HIV TAT specific factor 1 variant; structural geno 96.24
2e5i_A124 Heterogeneous nuclear ribonucleoprotein L-like; RR 96.04
3htx_A 950 HEN1; HEN1, small RNA methyltransferase, protein-R 95.88
2d9o_A100 DNAJ (HSP40) homolog, subfamily C, member 17; RRM 95.65
3tht_A 345 Alkylated DNA repair protein ALKB homolog 8; struc 95.6
1owx_A121 Lupus LA protein, SS-B, LA; RRM, transcription; NM 95.07
1jmt_A104 Splicing factor U2AF 35 kDa subunit; RRM, RNA spli 94.68
3s6e_A114 RNA-binding protein 39; ferredoxin-like, structura 94.57
3ue2_A118 Poly(U)-binding-splicing factor PUF60; RNA recogni 93.49
2diu_A96 KIAA0430 protein; structural genomics, RRM domain, 93.02
1wfx_A186 Probable RNA 2'-phosphotransferase; tRNA splicing, 88.2
1whv_A100 Poly(A)-specific ribonuclease; RNA recognition mot 81.0
2dnr_A91 Synaptojanin-1; RRM domain, RBD, structural genomi 80.16
>2voo_A Lupus LA protein; RNA-binding protein, RNA recognition motif, systemic lupus erythematosus, phosphoprotein, RNA maturation; 1.8A {Homo sapiens} SCOP: a.4.5.46 d.58.7.1 PDB: 2von_A 2vod_A 2vop_A 1zh5_A 1yty_A 1s7a_A Back     alignment and structure
Probab=100.00  E-value=3.1e-37  Score=248.45  Aligned_cols=141  Identities=32%  Similarity=0.542  Sum_probs=123.3

Q ss_pred             CCCCHHHHHHHHhhhhhhccCCCCCcchHHHHhhccCCCCceeHHHHhcchhhhhhcCCHHHHHHHHhcC--CceEEeec
Q psy9843          28 VKPDEDLTKRIIDQVEFYFSDENIVKDAFLLKHVKRNKEGFVSLKLISSFKRVKHLSKDWRVVAFALAKS--EKLQINEQ  105 (175)
Q Consensus        28 ~~~~e~l~~~I~~QvEfYFSd~NL~~D~fL~~~~~~~~~g~Vpl~~i~~F~r~k~lt~d~~~i~~Al~~S--~~lev~ed  105 (175)
                      ..|.+++..+|++||||||||+||++|.||+++|.++ +|||||++|++|+||++|+.|.+.|++||+.|  ..|+++++
T Consensus         6 ~~~~~~~~~~i~~q~e~yfs~~nl~~D~fl~~~~~~~-~g~V~l~~i~sF~r~k~l~~d~~~I~~Al~~S~~~~lev~ed   84 (193)
T 2voo_A            6 NEKMAALEAKICHQIEYYFGDFNLPRDKFLKEQIKLD-EGWVPLEIMIKFNRLNRLTTDFNVIVEALSKSKAELMEISED   84 (193)
T ss_dssp             ---CHHHHHHHHHHHHHHTSTTTGGGCHHHHHHHHHT-TTCEEHHHHTTSHHHHHHCCCHHHHHHHHHTCSSCCEEECTT
T ss_pred             cCCcHHHHHHHHHHhheecchhhcccCHHHHHHhccc-CCcEEeHHHhhhhHHHHhcCCHHHHHHHHhhcccceEEEecc
Confidence            4577899999999999999999999999999999765 99999999999999999999999999999999  89999999


Q ss_pred             CcEEEeCC--CCCCCC----CCCCCceEEEecCCCCCCCHHHHHHHhccCCcccEEEeeCCCCCCCCCCCccCCC
Q psy9843         106 GTKIRRVD--PLPAYD----QTTPSRTIVAINIPPESATIELVAEMFKPCGEIALIRLLRPGKYTKYGNTRHFSF  174 (175)
Q Consensus       106 g~~VRR~~--plp~~~----~~~~~rtv~v~~~p~~~~t~e~i~~~F~~~G~V~~Vrl~r~~~~~p~~~~~~~~~  174 (175)
                      |.+|||..  |+|...    .....|||||.++|.+ ++.++|+++|++||.|..|+|+++....+    |+|+|
T Consensus        85 ~~~vrR~~~~p~p~~~~~~~~~~~~~~l~V~nLp~~-~t~~~L~~~F~~~G~v~~v~i~~~~~~~~----kG~aF  154 (193)
T 2voo_A           85 KTKIRRSPSKPLPEVTDEYKNDVKNRSVYIKGFPTD-ATLDDIKEWLEDKGQVLNIQMRRTLHKAF----KGSIF  154 (193)
T ss_dssp             SSEEEECTTSCCCCCCHHHHHHHHHTEEEEECCCTT-CCHHHHHHHHTTSCCEEEEEEEECTTCCE----EEEEE
T ss_pred             cceEEecccCCCcccchhhhhccccCEEEecCCCCc-CCHHHHHHHHhcCCCEEEEEEEECCCCCc----ccEEE
Confidence            99999984  444431    1234689999999985 89999999999999999999998765444    88887
>1s29_A LA protein; winged helix-turn-helix, autoantigen, RNA-binding, RNA binding protein; 1.60A {Trypanosoma brucei} SCOP: a.4.5.46 Back     alignment and structure
>2cqk_A C-MPL binding protein; LA domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: a.4.5.46 Back     alignment and structure
>1s79_A Lupus LA protein; RRM, alpha/beta, RNA binding protein, translation; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lxi_A RNA-binding protein 10; NMR {Homo sapiens} Back     alignment and structure
>2dnh_A Bruno-like 5, RNA binding protein; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dnk_A 2dno_A Back     alignment and structure
>2do4_A Squamous cell carcinoma antigen recognized by T- cells 3; RRM domaim, RDB, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1wf0_A TDP-43, TAR DNA-binding protein-43; structural genomics, RRM domain, riken structural genomics/proteomics initiative RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3s7r_A Heterogeneous nuclear ribonucleoprotein A/B; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 2.15A {Homo sapiens} PDB: 1hd0_A 1hd1_A Back     alignment and structure
>2ywk_A Putative RNA-binding protein 11; RRM-domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.54A {Homo sapiens} Back     alignment and structure
>2cq3_A RNA-binding protein 9; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1whw_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2rs2_A Musashi-1, RNA-binding protein musashi homolog 1; protein-RNA complex, RRM, RBD, RNA binding protein- complex; NMR {Mus musculus} Back     alignment and structure
>3r27_A HnRNP L, heterogeneous nuclear ribonucleoprotein L; RBD fold, protein binding, nucleus; 2.04A {Homo sapiens} Back     alignment and structure
>4fxv_A ELAV-like protein 1; RNA recognition motif, putative RNA-binding domain, transcri structural genomics, joint center for structural genomics; 1.90A {Homo sapiens} Back     alignment and structure
>2lkz_A RNA-binding protein 5; RRM; NMR {Homo sapiens} Back     alignment and structure
>3mdf_A Peptidyl-prolyl CIS-trans isomerase E; RRM domain, PHD finger, CYP33, MLL, RNA binding protein, ISO mRNA processing, mRNA splicing, nucleus; 1.85A {Homo sapiens} SCOP: d.58.7.1 PDB: 2kyx_A 3lpy_A* Back     alignment and structure
>2e5h_A Zinc finger CCHC-type and RNA-binding motif- containing protein 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2err_A Ataxin-2-binding protein 1; protein-RNA complex, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cpy_A RNA-binding protein 12; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ucg_A Polyadenylate-binding protein 2; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative; HET: PGE; 1.95A {Homo sapiens} PDB: 3b4d_A 3b4m_A Back     alignment and structure
>2fy1_A RNA-binding motif protein, Y chromosome, family 1 member A1; RNA binding protein, structure, protein-RNA complex, RNA stem-loop, structural protein/RNA complex; NMR {Homo sapiens} Back     alignment and structure
>1uaw_A Mouse-musashi-1; RNP-type structure, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1x4e_A RNA binding motif, single-stranded interacting protein 2; structural genomics, RRM domain, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgs_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1h2v_Z 20 kDa nuclear CAP binding protein; CAP-binding-complex, RNP domain, MIF4G domain, RNA maturation, RNA export, nuclear protein, RNA-binding; 2.0A {Homo sapiens} SCOP: d.58.7.1 PDB: 1h2u_X* 1h2t_Z 1n52_B* 1n54_B 3fex_B 3fey_B 1h6k_X Back     alignment and structure
>3bs9_A Nucleolysin TIA-1 isoform P40; RNA recognition motif, RRM, RNA binding domain, RBD, RNA splicing, apoptosis, phosphoprotein, RNA-binding; 1.95A {Homo sapiens} Back     alignment and structure
>2cqi_A Nucleolysin TIAR; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, ST genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3d2w_A TAR DNA-binding protein 43; DP-43 proteinopathy, TDP-43 inclusions, RNA recognition MOTI U, ALS, RRM; HET: DNA; 1.65A {Mus musculus} Back     alignment and structure
>2cph_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2cqd_A RNA-binding region containing protein 1; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2xs2_A Deleted in azoospermia-like; RNA binding protein-RNA complex; 1.35A {Mus musculus} PDB: 2xs7_A 2xs5_A 2xsf_A Back     alignment and structure
>1x5u_A Splicing factor 3B subunit 4 (spliceosome associated protein 49) (SAP 49) (SF3B50)...; structure genomics,RRM domain,splicing factor 3B; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4a_A Splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor)...; structure genomics, SURP domain, splicing factor SF2; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3s8s_A Histone-lysine N-methyltransferase SETD1A; chromatin modification, transcription regulation, structural genomics, structural genomics consortium; 1.30A {Homo sapiens} Back     alignment and structure
>2dnz_A Probable RNA-binding protein 23; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2cq1_A PTB-like protein L; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cq4_A RNA binding motif protein 23; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4h_A RNA-binding protein 28; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2d9p_A Polyadenylate-binding protein 3; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5t_A Splicing factor 3B subunit 4; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgp_A Bruno-like 4, RNA binding protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dgq_A Back     alignment and structure
>2x1f_A MRNA 3'-END-processing protein RNA15; transcription-RNA complex, mRNA processing; 1.60A {Saccharomyces cerevisiae} PDB: 2x1b_A 2x1a_A 2km8_B Back     alignment and structure
>1sjq_A Polypyrimidine tract-binding protein 1; babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2krb_A Eukaryotic translation initiation factor 3 subunit B; EIF3, eukaryotic initiation factor, EIF3B, EIF3J; NMR {Homo sapiens} Back     alignment and structure
>2do0_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RNA recognition motif, RRM, RNA binding domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1p27_B RNA-binding protein 8A; nuclear protein, mRNA splicing; 2.00A {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3lqv_A PRE-mRNA branch site protein P14; cysless mutant, PRE-mRNA splicing, adenine, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: ADE; 2.38A {Homo sapiens} SCOP: d.58.7.1 PDB: 2f9d_A 2f9j_A 2fho_B Back     alignment and structure
>2khc_A Testis-specific RNP-type RNA binding protein; RRM, RNA recognition motif, bruno; NMR {Drosophila melanogaster} Back     alignment and structure
>2dnm_A SRP46 splicing factor; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1x5o_A RNA binding motif, single-stranded interacting protein 1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2cqb_A Peptidyl-prolyl CIS-trans isomerase E; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wex_A Hypothetical protein (riken cDNA 2810036L13); structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3ulh_A THO complex subunit 4; nuclear protein, RNA binding, structural genomi center for structural genomics, JCSG, protein structure INI PSI-biology; 2.54A {Homo sapiens} PDB: 1no8_A Back     alignment and structure
>2ad9_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x5s_A Cold-inducible RNA-binding protein; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgo_A Cytotoxic granule-associated RNA binding protein 1; RRM domain, structural genomics, NPPSFA; NMR {Mus musculus} PDB: 2rne_A 2dh7_A Back     alignment and structure
>2cqg_A TDP-43, TAR DNA-binding protein-43; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wg5_A Heterogeneous nuclear ribonucleoprotein H; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3md1_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RBD, RNP, poly(U) binding, nucleus, RNA-binding, binding protein; 1.60A {Saccharomyces cerevisiae} SCOP: d.58.7.0 Back     alignment and structure
>1oo0_B CG8781-PA, drosophila Y14; RNA recognition motif, splicing, protein complex, EXON junct complex, signaling protein; 1.85A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 2hyi_B* 2j0s_D* 2xb2_D* Back     alignment and structure
>1wi8_A EIF-4B, eukaryotic translation initiation factor 4B; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3ex7_B RNA-binding protein 8A; protein-RNA complex, mRNA processing, mRNA splicing, mRNA transport, nonsense-mediated mRNA decay, nucleus; HET: ADP; 2.30A {Homo sapiens} PDB: 2j0q_D* Back     alignment and structure
>2cpj_A Non-POU domain-containing octamer-binding protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>3nmr_A Cugbp ELAV-like family member 1; RRM, PRE-mRNA splicing, RNA binding protein-RNA complex; 1.85A {Homo sapiens} PDB: 3nna_A 3nnc_A 2dhs_A 3nnh_A Back     alignment and structure
>1x4b_A Heterogeneous nuclear ribonucleoproteins A2/B1; structure genomics, RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dgv_A HnRNP M, heterogeneous nuclear ribonucleoprotein M; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} PDB: 2dh9_A Back     alignment and structure
>2cqc_A Arginine/serine-rich splicing factor 10; RNA recognition motif, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>4f25_A Polyadenylate-binding protein 1; RRM fold, translation initiation, RNA-binding, EIF4G-binding translation; 1.90A {Homo sapiens} PDB: 4f26_A 2k8g_A Back     alignment and structure
>1b7f_A Protein (SXL-lethal protein), RNA (5'-R(P*GP*UP*UP*GP*UP*UP*UP*UP*UP*UP*UP*U)-3; splicing regulation, RNP domain, RNA complex; 2.60A {Drosophila melanogaster} SCOP: d.58.7.1 d.58.7.1 PDB: 3sxl_A* 1sxl_A 2sxl_A Back     alignment and structure
>2mss_A Protein (musashi1); RNA-binding domain, RNA binding protein; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2mst_A Back     alignment and structure
>2ku7_A MLL1 PHD3-CYP33 RRM chimeric protein; transcriptional regulation, RRM domain, transcr; NMR {Homo sapiens} Back     alignment and structure
>2cq0_A Eukaryotic translation initiation factor 3 subunit 4; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1iqt_A AUF1, heterogeneous nuclear ribonucleoprotein D0; RNA-binding protein, hnRNP, telomere, DNA-binding protein, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wtb_A 1x0f_A Back     alignment and structure
>3md3_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNP, RBD, poly(U) binding, tandem, acetylation, cytopla nucleus; 2.70A {Saccharomyces cerevisiae} Back     alignment and structure
>2cpz_A CUG triplet repeat RNA-binding protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2rq4_A 2rqc_A Back     alignment and structure
>2kxn_B Transformer-2 protein homolog beta; SR protein, RRM, splicing factor, RNA protein complex, SMN, binding protein-RNA complex; NMR {Homo sapiens} PDB: 2rra_A 2rrb_A Back     alignment and structure
>2kt5_A RNA and export factor-binding protein 2; chaperone, mRNA processing, mRNA splicing, transport, nucleus, RNA-binding, spliceosome, transport; NMR {Mus musculus} Back     alignment and structure
>2ki2_A SS-DNA binding protein 12RNP2; HP0827, RRM, SS-DNA binding proteins, RNA binding protein/SS-DNA binding protein complex; NMR {Helicobacter pylori} Back     alignment and structure
>2dh8_A DAZ-associated protein 1; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2jrs_A RNA-binding protein 39; RNA binding motif of RBM39_human (caper), RRM2 domain, solution structure, structural genomics, PSI-2; NMR {Homo sapiens} Back     alignment and structure
>2j76_E EIF-4B, EIF4B, eukaryotic translation initiation factor 4B; protein biosynthesis, RNA recognition motif, RNA binding domain, RRM, RBD, RNP; NMR {Homo sapiens} Back     alignment and structure
>2cpe_A RNA-binding protein EWS; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2la6_A RNA-binding protein FUS; structural genomics, northeast structural genomics consortiu PSI-biology, protein structure initiative, RNA recognition; NMR {Homo sapiens} Back     alignment and structure
>3ns6_A Eukaryotic translation initiation factor 3 subuni; 1.25A {Saccharomyces cerevisiae} PDB: 3ns5_A Back     alignment and structure
>2dhg_A TRNA selenocysteine associated protein (SECP43); RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x4d_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dnl_A Cytoplasmic polyadenylation element binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ytc_A PRE-mRNA-splicing factor RBM22; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>4a8x_A RNA-binding protein with serine-rich domain 1; transcription, splicing, RNA processing, nonsense mediated D NMD, HDAC, histone deacetylation; 1.90A {Homo sapiens} Back     alignment and structure
>2div_A TRNA selenocysteine associated protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2db1_A Heterogeneous nuclear ribonucleoprotein F; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} Back     alignment and structure
>2m2b_A RNA-binding protein 10; T-cell, JCSG, MPP, PSI-biology; NMR {Homo sapiens} Back     alignment and structure
>2g4b_A Splicing factor U2AF 65 kDa subunit; protein-RNA complex, RNA splicing factor, RNA recognition motif, RNA binding protein/RNA complex; 2.50A {Homo sapiens} PDB: 2u2f_A Back     alignment and structure
>2nlw_A Eukaryotic translation initiation factor 3 subunit 9; eukaryotic initiation factor 3 complex, RNA recognition motif; NMR {Homo sapiens} Back     alignment and structure
>2jwn_A Embryonic polyadenylate-binding protein 2-B; epabp2, poly(A) binding, structural genomics, protein structure initiative, PSI-2; NMR {Xenopus laevis} Back     alignment and structure
>2lmi_A GRSF-1, G-rich sequence factor 1; G-rich RNA sequence binding factor, RNA binding domain, STRU genomics, joint center for structural genomics, JCSG; NMR {Homo sapiens} Back     alignment and structure
>2cpf_A RNA binding motif protein 19; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1why_A Hypothetical protein riken cDNA 1810017N16; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>1p1t_A Cleavage stimulation factor, 64 kDa subunit; RNA recognition motif, C-terminal helix, N-terminal helix, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4g_A Nucleolysin TIAR; structural genomics, RRM domain, TIA-1 related protein, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1wez_A HnRNP H', FTP-3, heterogeneous nuclear ribonucleoprotein H'; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2hvz_A Splicing factor, arginine/serine-rich 7; RRM, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1whx_A Hypothetical protein riken cDNA 1200009A02; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>2dnq_A RNA-binding protein 4B; RRM domain,RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1fxl_A Paraneoplastic encephalomyelitis antigen HUD; protein-RNA complex, AU-rich element, transcription/RNA complex; 1.80A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1g2e_A 1fnx_H 1d8z_A 1d9a_A 3hi9_A Back     alignment and structure
>2dis_A Unnamed protein product; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1u6f_A Tcubp1, RNA-binding protein UBP1; trypanosome, mRNA-binding protein, GU-rich RNA, structure; NMR {Trypanosoma cruzi} SCOP: d.58.7.1 Back     alignment and structure
>2dgw_A Probable RNA-binding protein 19; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dgx_A KIAA0430 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2lea_A Serine/arginine-rich splicing factor 2; SR protein, RNA binding protein; NMR {Homo sapiens} PDB: 2leb_A 2lec_A Back     alignment and structure
>1x4f_A Matrin 3; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2jvo_A Nucleolar protein 3; nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding, rRNA processing; NMR {Saccharomyces cerevisiae} PDB: 2osq_A Back     alignment and structure
>1l3k_A Heterogeneous nuclear ribonucleoprotein A1; nuclear protein hnRNP A1, RNA-recognition motif, RNA- binding, UP1, RNA binding protein; 1.10A {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 1u1k_A* 1u1l_A* 1u1m_A* 1u1n_A* 1u1o_A 1u1p_A* 1u1q_A 1u1r_A* 1pgz_A* 1ha1_A 1po6_A* 2up1_A* 1up1_A Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>1rk8_A CG8781-PA, CG8781-PA protein; mRNA processing, RRM, RBD, NMD, oskar mRNA localization, translation; 1.90A {Drosophila melanogaster} SCOP: d.58.7.1 PDB: 1hl6_A 2x1g_A Back     alignment and structure
>2dng_A Eukaryotic translation initiation factor 4H; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2kvi_A Nuclear polyadenylated RNA-binding protein 3; RNA-binding motif, RRM, transcription termination, NUC phosphoprotein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3p5t_L Cleavage and polyadenylation specificity factor S; RRM domain, poly(A) site recognition, RNA, nuclear, RNA BIND protein; 2.70A {Homo sapiens} PDB: 3p6y_C Back     alignment and structure
>2hgn_A Heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg1_A Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>2xnq_A Nuclear polyadenylated RNA-binding protein 3; transcription termination, RNA processi recognition, RRM; HET: CAF; 1.30A {Saccharomyces cerevisiae} PDB: 2xnr_A 2l41_A Back     alignment and structure
>2hgl_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative, splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kfy_A Back     alignment and structure
>2la4_A Nuclear and cytoplasmic polyadenylated RNA-bindin PUB1; RRM, RNA recognition, stress granules, nucleus, RNA-binding, transcription; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2cpi_A CCR4-NOT transcription complex subunit 4; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2i2y_A Fusion protein consists of immunoglobin G- binding protein G and splicing factor,...; protein-RNA complex RRM alpha-beta sandwich BETA1-alpha1- BETA2-BETA3-alpha2-BETA4; NMR {Streptococcus SP} PDB: 2i38_A Back     alignment and structure
>1wf1_A RNA-binding protein RALY; structural genomics, RRM domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wf2_A Back     alignment and structure
>2kn4_A Immunoglobulin G-binding protein G, splicing FACT arginine/serine-rich 2, S35, splicing factor SC35,; RRM domain, cell WALL; NMR {Streptococcus SP} Back     alignment and structure
>2ek1_A RNA-binding protein 12; RNA recognition motif, dimer, structural genomics, NPPSFA, national project on protein structural and functional analyses; 2.00A {Homo sapiens} PDB: 2ek6_A Back     alignment and structure
>2f3j_A RNA and export factor binding protein 2; RRM domain, RBD domain., transport protein; NMR {Mus musculus} Back     alignment and structure
>2dha_A FLJ20171 protein; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yh0_A Splicing factor U2AF 65 kDa subunit; PRE-mRNA splicing, transcription, RNA binding protein, mRNA processing; NMR {Homo sapiens} PDB: 2yh1_A Back     alignment and structure
>1wel_A RNA-binding protein 12; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1x4c_A Splicing factor, arginine/serine-rich 1; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2fc9_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dnn_A RNA-binding protein 12; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2dgu_A Heterogeneous nuclear ribonucleoprotein Q; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} PDB: 2dk2_A Back     alignment and structure
>3n9u_C Cleavage and polyadenylation specificity factor S; protein-protein complex, coexpression, heterotetramer, mRNA maturation, mRNA cleavage; 1.92A {Homo sapiens} Back     alignment and structure
>2cjk_A Nuclear polyadenylated RNA-binding protein 4; HRP1, RNA-binding, RNA processing, mRNA processing, nonsense-mediated mRNA decay, cleavage; NMR {Saccharomyces cerevisiae} PDB: 2km8_C Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>2hzc_A Splicing factor U2AF 65 kDa subunit; RNA splicing, RRM, RNA recognition, alternative conformation binding protein; HET: P6G; 1.47A {Homo sapiens} PDB: 1u2f_A Back     alignment and structure
>2a3j_A U1 small nuclear ribonucleoprotein A; computationally designed protein, RRM, U1A, RNA binding protein; NMR {Homo sapiens} Back     alignment and structure
>1nu4_A U1A RNA binding domain; RNA recognition motif, U1 small nuclear ribonucleoprotein, R binding domain, RNA binding protein; HET: MLA; 1.80A {Homo sapiens} SCOP: d.58.7.1 PDB: 1drz_A* 1urn_A 3hhn_B* 3egz_A* 1zzn_A* 1u6b_A* 3cun_A* 3cul_A* 3g8s_A* 3g8t_A* 3g96_A* 3g9c_A* 3irw_P* 3mum_P* 3mur_P* 3mut_P* 3muv_P* 3mxh_P* 3p49_B 3r1h_A* ... Back     alignment and structure
>2cqp_A RNA-binding protein 12; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: d.58.7.1 Back     alignment and structure
>2dgt_A RNA-binding protein 30; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2j8a_A Histone-lysine N-methyltransferase, H3 lysine-4 specific; histone methyltransferase, RRM fold, telomere, nuclear protein; 3.0A {Saccharomyces cerevisiae} Back     alignment and structure
>2lcw_A RNA-binding protein FUS; RRM, nucleic acid binding protein; NMR {Homo sapiens} Back     alignment and structure
>2cpd_A Apobec-1 stimulating protein; RNA recognition motif, RRM, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2dnp_A RNA-binding protein 14; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2hgm_A HNRPF protein, heterogeneous nuclear ribonucleoprotein F; RNA recognition motif, G-tract, G-quadruplex, alternative splicing, RNA binding protein; NMR {Homo sapiens} PDB: 2kg0_A Back     alignment and structure
>2cpx_A Hypothetical protein FLJ11016; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>2e5j_A Methenyltetrahydrofolate synthetase domain containing; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2qfj_A FBP-interacting repressor; protein-DNA complex; HET: DNA; 2.10A {Homo sapiens} PDB: 3uwt_A 2kxf_A 2kxh_A Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>2jvr_A Nucleolar protein 3; RNA recognition motif, nucleus, phosphorylation, ribonucleoprotein, ribosome biogenesis, RNA-binding; NMR {Saccharomyces cerevisiae} PDB: 2osr_A Back     alignment and structure
>3sde_A Paraspeckle component 1; RRM, anti parallel right handed coiled-coil, NOPS, DBHS, RNA protein, RNA binding; 1.90A {Homo sapiens} PDB: 3sde_B Back     alignment and structure
>3q2s_C Cleavage and polyadenylation specificity factor S; CFIM, CFIM25, CFIM68, CPSF5, CPSF6, CPSF, 3' END processing, processing, cleavage factor; 2.90A {Homo sapiens} PDB: 3q2t_C Back     alignment and structure
>4f02_A Polyadenylate-binding protein 1; mRNA, eukaryotic initiation factors PAIP1 and PAIP2, translation-RNA complex; 2.00A {Homo sapiens} PDB: 1cvj_A* Back     alignment and structure
>2ghp_A U4/U6 snRNA-associated splicing factor PRP24; RNA chaperone, RNA binding domain, RNA recognition motif, SP factor, snRNP, spliceosome; 2.70A {Saccharomyces cerevisiae} SCOP: d.58.7.1 d.58.7.1 d.58.7.1 PDB: 2go9_A 2kh9_A Back     alignment and structure
>3beg_B Splicing factor, arginine/serine-rich 1; kinase, SR protein kinase, SR protein, PRE-mRNA splicing, at binding, chromosome partition; HET: SEP ANP; 2.90A {Homo sapiens} SCOP: d.58.7.1 PDB: 2o3d_A 1wg4_A Back     alignment and structure
>1x5p_A Negative elongation factor E; structure genomics, RRM domain, PARP14, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>2e5g_A U6 snRNA-specific terminal uridylyltransferase 1; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3egn_A RNA-binding protein 40; RNA recognition motif (RRM), RNP motif, U11/U12-65K protein, DI-snRNP, U1A protein, U2B protein; 2.50A {Homo sapiens} Back     alignment and structure
>1fj7_A Nucleolin RBD1, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>1fjc_A Nucleolin RBD2, protein C23; RNP, RRM, RNA binding domain, nucleolus, structural protein; NMR {Mesocricetus auratus} SCOP: d.58.7.1 Back     alignment and structure
>2cqh_A IGF-II mRNA-binding protein 2 isoform A; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2wbr_A GW182, gawky, LD47780P; DNA-binding protein, RRM, RBD, TNRC6A, mirnas, P-bodies, argonaute, mRNA decay; NMR {Drosophila melanogaster} Back     alignment and structure
>1wg1_A KIAA1579 protein, homolog EXC-7; RBD, structural genomics, riken structural genomics/proteomics initiative, RSGI, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 1wi6_A Back     alignment and structure
>3pgw_S U1-70K; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_K 2l5i_A 2l5j_A* Back     alignment and structure
>2cq2_A Hypothetical protein LOC91801; RRM domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>3smz_A Protein raver-1, ribonucleoprotein PTB-binding 1; RNA binding, RNA recognition motif, vincu alpha-actinin, nucleus, RNA binding protein; 1.99A {Homo sapiens} PDB: 3vf0_B* 3h2u_B 3h2v_E Back     alignment and structure
>2e44_A Insulin-like growth factor 2 mRNA binding protein 3; RRM domain, RBD, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>3tyt_A Heterogeneous nuclear ribonucleoprotein L; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG; 1.60A {Mus musculus} PDB: 3s01_A 3to8_A Back     alignment and structure
>1qm9_A Polypyrimidine tract-binding protein; ribonucleoprotein, RNP, RNA, spicing, translation; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 Back     alignment and structure
>2adc_A Polypyrimidine tract-binding protein 1; RBD, RRM, protein-RNA complex, RNA binding protein/RNA complex; NMR {Homo sapiens} SCOP: d.58.7.1 d.58.7.1 PDB: 2evz_A Back     alignment and structure
>1sjr_A Polypyrimidine tract-binding protein 1; extended babbab motif, RNA binding protein; NMR {Homo sapiens} SCOP: d.58.7.1 PDB: 2adb_A Back     alignment and structure
>2pe8_A Splicing factor 45; RRM, protein binding; 2.00A {Homo sapiens} PDB: 2peh_A Back     alignment and structure
>3u1l_A PRE-mRNA-splicing factor CWC2; CSMP, zinc finger; 1.64A {Saccharomyces cerevisiae} PDB: 3u1m_A 3tp2_A Back     alignment and structure
>3pgw_A U1-A; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 1fht_A 2u1a_A 2aym_A 2b0g_A Back     alignment and structure
>2fc8_A NCL protein; structure genomics, RRM_1 domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3zzy_A Polypyrimidine tract-binding protein 1; protein binding, peptide binding, RNA recognition motif; 1.40A {Homo sapiens} PDB: 3zzz_A Back     alignment and structure
>1fje_B Nucleolin RBD12, protein C23; RNP, RRM, RNA binding domain, RNA-protein complex, nucleolus, structural protein/RNA complex; NMR {Mesocricetus auratus} SCOP: d.58.7.1 d.58.7.1 PDB: 1rkj_A 2krr_A Back     alignment and structure
>3v4m_A Splicing factor U2AF 65 kDa subunit; canonical RNA binding protein, RNA splicing, structural GENO joint center for structural genomics, JCSG; HET: MSE; 1.80A {Mus musculus} PDB: 1o0p_A 1opi_A Back     alignment and structure
>2dit_A HIV TAT specific factor 1 variant; structural genomics, RRM_1 domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>2e5i_A Heterogeneous nuclear ribonucleoprotein L-like; RRM domain, RBD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Back     alignment and structure
>2d9o_A DNAJ (HSP40) homolog, subfamily C, member 17; RRM domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3tht_A Alkylated DNA repair protein ALKB homolog 8; structural genomics, PSI-biology, northeast structural genom consortium, NESG; HET: AKG; 3.01A {Homo sapiens} PDB: 3thp_A* Back     alignment and structure
>1owx_A Lupus LA protein, SS-B, LA; RRM, transcription; NMR {Homo sapiens} SCOP: d.58.7.1 Back     alignment and structure
>1jmt_A Splicing factor U2AF 35 kDa subunit; RRM, RNA splicing, proline, PPII helix, peptide recognition, RNA binding protein; 2.20A {Homo sapiens} SCOP: d.58.7.3 Back     alignment and structure
>3s6e_A RNA-binding protein 39; ferredoxin-like, structural genomics, joint center for struc genomics, JCSG, protein structure initiative, PSI-biology; HET: MSE CIT; 0.95A {Mus musculus} PDB: 2lq5_A Back     alignment and structure
>3ue2_A Poly(U)-binding-splicing factor PUF60; RNA recognition motif, RRM, RNA binding domain, ST genomics, joint center for structural genomics, JCSG; HET: MSE; 1.23A {Homo sapiens} SCOP: d.58.7.0 PDB: 3us5_A 2dny_A Back     alignment and structure
>2diu_A KIAA0430 protein; structural genomics, RRM domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wfx_A Probable RNA 2'-phosphotransferase; tRNA splicing, NAD, structural GE riken structural genomics/proteomics initiative, RSGI; 2.80A {Aeropyrum pernix} SCOP: d.166.1.5 Back     alignment and structure
>1whv_A Poly(A)-specific ribonuclease; RNA recognition motif, RRM, RNA binding domain, RBD, RNP, PARN, structural genomics; NMR {Mus musculus} SCOP: d.58.7.1 PDB: 2rok_A* Back     alignment and structure
>2dnr_A Synaptojanin-1; RRM domain, RBD, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 175
d1s29a_92 a.4.5.46 (A:) Lupus La autoantigen N-terminal doma 5e-36
d2cqka188 a.4.5.46 (A:43-130) La-related protein 4 LARP4 {Hu 2e-30
d1zh5a199 a.4.5.46 (A:5-103) Lupus La autoantigen N-terminal 1e-28
>d1s29a_ a.4.5.46 (A:) Lupus La autoantigen N-terminal domain {Trypanosoma brucei [TaxId: 5691]} Length = 92 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: "Winged helix" DNA-binding domain
family: La domain
domain: Lupus La autoantigen N-terminal domain
species: Trypanosoma brucei [TaxId: 5691]

 Score =  118 bits (298), Expect = 5e-36
 Identities = 38/90 (42%), Positives = 56/90 (62%)

Query: 27  FVKPDEDLTKRIIDQVEFYFSDENIVKDAFLLKHVKRNKEGFVSLKLISSFKRVKHLSKD 86
            +    +  +++  QVEFYFSD N+ +D FL   +  N EGFVSL+ + +FKRV  ++ D
Sbjct: 3   HMPLSSENKQKLQKQVEFYFSDVNVQRDIFLKGKMAENAEGFVSLETLLTFKRVNSVTTD 62

Query: 87  WRVVAFALAKSEKLQINEQGTKIRRVDPLP 116
            + V  A+  SEKL ++E G  +RR DPLP
Sbjct: 63  VKEVVEAIRPSEKLVLSEDGLMVRRRDPLP 92
>d2cqka1 a.4.5.46 (A:43-130) La-related protein 4 LARP4 {Human (Homo sapiens) [TaxId: 9606]} Length = 88 Back     information, alignment and structure
>d1zh5a1 a.4.5.46 (A:5-103) Lupus La autoantigen N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 99 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query175
d1s29a_92 Lupus La autoantigen N-terminal domain {Trypanosom 100.0
d2cqka188 La-related protein 4 LARP4 {Human (Homo sapiens) [ 99.97
d1zh5a199 Lupus La autoantigen N-terminal domain {Human (Hom 99.97
d1zh5a285 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 98.51
d2cq4a1101 RNA binding protein 23 {Human (Homo sapiens) [TaxI 98.32
d2cqba189 Peptidyl-prolyl cis-trans isomerase E, N-terminal 98.29
d1l3ka184 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 98.25
d1x5ua193 Splicing factor 3B subunit 4 {Human (Homo sapiens) 98.23
d1x4ba1103 Heterogeneous nuclear ribonucleoproteins A2/B1 {Hu 98.22
d2f9da1114 Pre-mRNA branch site protein p14 {Human (Homo sapi 98.22
d2cqda1103 RNA-binding region containing protein 1 {Human (Ho 98.2
d1fxla182 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 98.19
d1b7fa285 Sex-lethal protein {Drosophila melanogaster [TaxId 98.19
d2cqia190 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 98.19
d1p1ta_104 Cleavage stimulation factor, 64 kda subunit {Human 98.17
d1h2vz_93 CBP20, 20KDa nuclear cap-binding protein {Human (H 98.14
d1b7fa182 Sex-lethal protein {Drosophila melanogaster [TaxId 98.13
d2cq3a193 RNA-binding protein 9 {Human (Homo sapiens) [TaxId 98.12
d2cqca183 Arginine/serine-rich splicing factor 10 {Human (Ho 98.1
d1x5oa1101 RNA-binding motif, single-stranded-interacting pro 98.1
d2ghpa386 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 98.1
d1x4ha198 RNA-binding protein 28 {Mouse (Mus musculus) [TaxI 98.09
d1rk8a_88 RNA-binding protein 8 {Fruit fly (Drosophila melan 98.08
d1uawa_77 Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} 98.08
d1x5sa190 Cold-inducible RNA-binding protein {Human (Homo sa 98.08
d2cqga190 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 98.07
d2cq0a190 Eukaryotic translation initiation factor 3 subunit 98.06
d1cvja180 Poly(A)-binding protein {Human (Homo sapiens) [Tax 98.06
d2cpha194 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 98.05
d1no8a_78 Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 1 98.04
d2b0ga183 Splicesomal U1A protein {Drosophila melanogaster [ 98.04
d1fxla285 Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9 98.03
d1x0fa175 Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo s 98.03
d1l3ka279 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 98.01
d2ghpa181 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 97.98
d1wf0a_88 TAR DNA-binding protein 43, TDP-43 {Human (Homo sa 97.96
d2ghpa275 U4/U6 snRNA-associated-splicing factor PRP24 {Bake 97.95
d1cvja289 Poly(A)-binding protein {Human (Homo sapiens) [Tax 97.94
d2adca1109 Polypyrimidine tract-binding protein {Human (Homo 97.93
d1hd0a_75 Heterogeneous nuclear ribonucleoprotein d0 {Human 97.93
d1whxa_111 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 97.93
d1whwa_99 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 97.9
d1wexa_104 Heterogeneous nuclear ribonucleoprotein L-like {Mo 97.88
d1x4fa199 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 97.87
d2u2fa_85 Splicing factor U2AF 65 KDa subunit {Human (Homo s 97.86
d1u6fa1139 RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId 97.85
d1x4aa195 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 97.85
d2cpza1102 CUG triplet repeat RNA-binding protein 1 {Human (H 97.84
d1x4ga196 Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 960 97.84
d1x4ea172 RNA-binding motif, single-stranded-interacting pro 97.83
d2cpfa185 Probable RNA-binding protein 19, Rbm19 {Mouse (Mus 97.82
d1whya_97 Putative RNA-binding protein 15B, Rbm15b {Mouse (M 97.81
d2cpja186 Non-POU domain-containing octamer-binding protein, 97.79
d2cpia189 E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musc 97.79
d2cpya1103 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 97.75
d1fjeb191 Nucleolin {Golden hamster (Mesocricetus auratus) [ 97.72
d2msta_75 Neural RNA-binding protein Musashi-1 {Mouse (Mus m 97.72
d2cpxa1102 RNA-binding protein 41, RBM41 {Human (Homo sapiens 97.66
d2adca288 Polypyrimidine tract-binding protein {Human (Homo 97.65
d2cq1a188 Polypyrimidine tract-binding protein 2, PTBP2 {Hum 97.63
d1x4da189 Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} 97.61
d1weza_102 Heterogeneous nuclear ribonucleoprotein H' {Human 97.58
d1wi8a_104 Eukaryotic translation initiation factor 4B {Human 97.58
d2cpea1101 RNA-binding protein EWS {Human (Homo sapiens) [Tax 97.57
d1wf2a_98 Heterogeneous nuclear ribonucleoproteins C1/C2 {Hu 97.55
d2cpda186 APOBEC1 stimulating protein {Human (Homo sapiens) 97.52
d2disa196 Hypothetical protein FLJ20273 {Human (Homo sapiens 97.51
d1nu4a_91 Splicesomal U1A protein {Human (Homo sapiens) [Tax 97.49
d1wg4a_98 Splicing factor, arginine/serine-rich 9 (SFRS9) {M 97.45
d1wg5a_104 Heterogeneous nuclear ribonucleoprotein H' {Human 97.42
d1x5ta183 Splicing factor 3B subunit 4 {Human (Homo sapiens) 97.4
d3begb187 Splicing factor, arginine/serine-rich 1, SFRS1 {Hu 97.3
d2adba1108 Polypyrimidine tract-binding protein {Human (Homo 97.29
d2cqpa186 RNA-binding protein 12 {Mouse (Mus musculus) [TaxI 97.28
d2bz2a179 Negative elongation factor E, NELF-E {Human (Homo 97.23
d1owxa_113 Lupus LA protein {Human (Homo sapiens) [TaxId: 960 97.22
d1wela1112 RNA-binding protein 12 {Human (Homo sapiens) [TaxI 97.19
d1u1qa_183 Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human 97.18
d2cqha180 IGF-II mRNA-binding protein 2 isoform A {Human (Ho 97.05
d1wg1a_88 Probable RNA-binding protein KIAA1579 {Human (Homo 96.96
d2cq2a1101 Alkylation repair AlkB homolog 8, ALKBH8 {Human (H 96.92
d1wi6a175 Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (M 96.9
d1u2fa_90 Splicing factor U2AF 65 KDa subunit {Human (Homo s 96.86
d1fjca_96 Nucleolin {Golden hamster (Mesocricetus auratus) [ 96.55
d1wwha181 Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090 95.94
U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]}" target="_blank" href="http://scop.mrc-lmb.cam.ac.uk/scop/search.cgi?sid=d1jmta_">d1jmta_104 U2 95.76
d1o0pa_104 Splicing factor U2AF 65 KDa subunit {Human (Homo s 95.06
d1weya_104 Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090 93.25
d2dita199 HIV Tat-specific factor 1 {Human (Homo sapiens) [T 93.24
d1wfxa_180 Probable RNA 2'-phosphotransferase KptA {Aeropyrum 88.6
>d1s29a_ a.4.5.46 (A:) Lupus La autoantigen N-terminal domain {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: "Winged helix" DNA-binding domain
family: La domain
domain: Lupus La autoantigen N-terminal domain
species: Trypanosoma brucei [TaxId: 5691]

Probab=100.00  E-value=8.3e-37  Score=220.99  Aligned_cols=90  Identities=42%  Similarity=0.675  Sum_probs=86.6

Q ss_pred             CCCCCHHHHHHHHhhhhhhccCCCCCcchHHHHhhccCCCCceeHHHHhcchhhhhhcCCHHHHHHHHhcCCceEEeecC
Q psy9843          27 FVKPDEDLTKRIIDQVEFYFSDENIVKDAFLLKHVKRNKEGFVSLKLISSFKRVKHLSKDWRVVAFALAKSEKLQINEQG  106 (175)
Q Consensus        27 ~~~~~e~l~~~I~~QvEfYFSd~NL~~D~fL~~~~~~~~~g~Vpl~~i~~F~r~k~lt~d~~~i~~Al~~S~~lev~edg  106 (175)
                      ..+.+++..++|++||||||||+||++|+||+++|.++++|||||++|++|||||+|+.|.+.|++||+.|+.|||++||
T Consensus         3 ~~p~~~e~~~~I~~QvEfYFSd~NL~~D~fL~~~m~~~~~G~V~i~~i~~F~rmk~lt~d~~~i~~Al~~S~~lev~ed~   82 (92)
T d1s29a_           3 HMPLSSENKQKLQKQVEFYFSDVNVQRDIFLKGKMAENAEGFVSLETLLTFKRVNSVTTDVKEVVEAIRPSEKLVLSEDG   82 (92)
T ss_dssp             TSCCCHHHHHHHHHHHHHHTSHHHHTTCHHHHHHHTTSTTCCEEHHHHTTSHHHHTTCSCHHHHHHHHTTCSSEEECTTS
T ss_pred             CCCCCHHHHHHHHHHHHHHccHhhhccCHHHHHHHhccCCCcEEhHHHhcCcCHHHhcCCHHHHHHHHhhCCeEEEeCCC
Confidence            34667889999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             cEEEeCCCCC
Q psy9843         107 TKIRRVDPLP  116 (175)
Q Consensus       107 ~~VRR~~plp  116 (175)
                      ++|||+.|||
T Consensus        83 ~~VRRk~plP   92 (92)
T d1s29a_          83 LMVRRRDPLP   92 (92)
T ss_dssp             SEEEESSCCC
T ss_pred             CEEeeCCCCC
Confidence            9999999997
>d2cqka1 a.4.5.46 (A:43-130) La-related protein 4 LARP4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zh5a1 a.4.5.46 (A:5-103) Lupus La autoantigen N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zh5a2 d.58.7.1 (A:105-189) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq4a1 d.58.7.1 (A:132-232) RNA binding protein 23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqba1 d.58.7.1 (A:1-89) Peptidyl-prolyl cis-trans isomerase E, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka1 d.58.7.1 (A:8-91) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ua1 d.58.7.1 (A:7-99) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ba1 d.58.7.1 (A:8-110) Heterogeneous nuclear ribonucleoproteins A2/B1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2f9da1 d.58.7.1 (A:12-125) Pre-mRNA branch site protein p14 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqda1 d.58.7.1 (A:1-103) RNA-binding region containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa2 d.58.7.1 (A:205-289) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cqia1 d.58.7.1 (A:1-90) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p1ta_ d.58.7.1 (A:) Cleavage stimulation factor, 64 kda subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h2vz_ d.58.7.1 (Z:) CBP20, 20KDa nuclear cap-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1b7fa1 d.58.7.1 (A:123-204) Sex-lethal protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d2cq3a1 d.58.7.1 (A:110-202) RNA-binding protein 9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqca1 d.58.7.1 (A:109-191) Arginine/serine-rich splicing factor 10 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5oa1 d.58.7.1 (A:8-108) RNA-binding motif, single-stranded-interacting protein 1, RBMS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa3 d.58.7.1 (A:206-291) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1x4ha1 d.58.7.1 (A:8-105) RNA-binding protein 28 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rk8a_ d.58.7.1 (A:) RNA-binding protein 8 {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1uawa_ d.58.7.1 (A:) Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x5sa1 d.58.7.1 (A:8-97) Cold-inducible RNA-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqga1 d.58.7.1 (A:96-185) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq0a1 d.58.7.1 (A:231-320) Eukaryotic translation initiation factor 3 subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cvja1 d.58.7.1 (A:11-90) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpha1 d.58.7.1 (A:454-547) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1no8a_ d.58.7.1 (A:) Nuclear factor Aly {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2b0ga1 d.58.7.1 (A:1-83) Splicesomal U1A protein {Drosophila melanogaster [TaxId: 7227]} Back     information, alignment and structure
>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x0fa1 d.58.7.1 (A:183-257) Nuclear ribonucleoprotein D0 (AUF1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1l3ka2 d.58.7.1 (A:103-181) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa1 d.58.7.1 (A:116-196) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wf0a_ d.58.7.1 (A:) TAR DNA-binding protein 43, TDP-43 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ghpa2 d.58.7.1 (A:41-115) U4/U6 snRNA-associated-splicing factor PRP24 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1cvja2 d.58.7.1 (A:91-179) Poly(A)-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca1 d.58.7.1 (A:335-443) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hd0a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein d0 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1whxa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whwa_ d.58.7.1 (A:) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wexa_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein L-like {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1x4fa1 d.58.7.1 (A:8-106) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u6fa1 d.58.7.1 (A:1-139) RNA-binding protein UBP1 {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1x4aa1 d.58.7.1 (A:9-103) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpza1 d.58.7.1 (A:383-484) CUG triplet repeat RNA-binding protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ga1 d.58.7.1 (A:8-103) Nucleolysin TIAR {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4ea1 d.58.7.1 (A:8-79) RNA-binding motif, single-stranded-interacting protein 2, RBMS2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpfa1 d.58.7.1 (A:362-446) Probable RNA-binding protein 19, Rbm19 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1whya_ d.58.7.1 (A:) Putative RNA-binding protein 15B, Rbm15b {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpja1 d.58.7.1 (A:65-150) Non-POU domain-containing octamer-binding protein, NonO {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpia1 d.58.7.1 (A:101-189) E3 ubiquitin protein ligase CNOT4 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpya1 d.58.7.1 (A:536-638) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjeb1 d.58.7.1 (B:1-91) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d2msta_ d.58.7.1 (A:) Neural RNA-binding protein Musashi-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cpxa1 d.58.7.1 (A:291-392) RNA-binding protein 41, RBM41 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adca2 d.58.7.1 (A:444-531) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq1a1 d.58.7.1 (A:51-138) Polypyrimidine tract-binding protein 2, PTBP2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x4da1 d.58.7.1 (A:8-96) Matrin 3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weza_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi8a_ d.58.7.1 (A:) Eukaryotic translation initiation factor 4B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpea1 d.58.7.1 (A:353-453) RNA-binding protein EWS {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wf2a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoproteins C1/C2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cpda1 d.58.7.1 (A:223-308) APOBEC1 stimulating protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2disa1 d.58.7.1 (A:8-103) Hypothetical protein FLJ20273 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nu4a_ d.58.7.1 (A:) Splicesomal U1A protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg4a_ d.58.7.1 (A:) Splicing factor, arginine/serine-rich 9 (SFRS9) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wg5a_ d.58.7.1 (A:) Heterogeneous nuclear ribonucleoprotein H' {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x5ta1 d.58.7.1 (A:8-90) Splicing factor 3B subunit 4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d3begb1 d.58.7.1 (B:121-207) Splicing factor, arginine/serine-rich 1, SFRS1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2adba1 d.58.7.1 (A:177-284) Polypyrimidine tract-binding protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqpa1 d.58.7.1 (A:917-1002) RNA-binding protein 12 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bz2a1 d.58.7.1 (A:35-113) Negative elongation factor E, NELF-E {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1owxa_ d.58.7.1 (A:) Lupus LA protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wela1 d.58.7.1 (A:412-523) RNA-binding protein 12 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1u1qa_ d.58.7.1 (A:) Nuclear ribonucleoprotein A1 (RNP A1, UP1) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqha1 d.58.7.1 (A:2-81) IGF-II mRNA-binding protein 2 isoform A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wg1a_ d.58.7.1 (A:) Probable RNA-binding protein KIAA1579 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cq2a1 d.58.7.1 (A:25-125) Alkylation repair AlkB homolog 8, ALKBH8 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wi6a1 d.58.7.1 (A:69-143) Ribonucleoprotein PTB-binding 1, Raver-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u2fa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]} Back     information, alignment and structure
>d1wwha1 d.58.7.1 (A:169-249) Nucleoporin 35 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jmta_ d.58.7.3 (A:) U2AF35 (35 KDa subunit) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1o0pa_ d.58.7.1 (A:) Splicing factor U2AF 65 KDa subunit {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weya_ d.58.7.1 (A:) Calcipressin-1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2dita1 d.58.7.1 (A:8-106) HIV Tat-specific factor 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfxa_ d.166.1.5 (A:) Probable RNA 2'-phosphotransferase KptA {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure