Catalyzes the reduction of fatty acyl-CoA to fatty alcohols. The preferred substrates are C16, C18, C18:1 and C18:2 but low activity can be observed with C10-C14 substrates.
Score = 84.0 bits (206), Expect = 2e-16, Method: Composition-based stats.
Identities = 37/100 (37%), Positives = 60/100 (60%)
Query: 7 KLGKVASTLEYFVDRKWNWSNENVQALWDQLSPEDQEMFFFDMGQLDWEYHAEALCLGLR 66
+L K S LEYF++ W WS N + L +LSPEDQ +F FD+ QL+W + E LG++
Sbjct: 383 RLLKTISMLEYFINHSWEWSTNNTEMLLSELSPEDQRVFNFDVRQLNWLEYIENYVLGVK 442
Query: 67 LYLVHDDLTSLPAARRKWQKLYIAHCILRAVAVFVLFRIL 106
YL+ +DL +P A++ ++L H + +++R+L
Sbjct: 443 KYLLKEDLAGIPKAKQHLRRLRNIHYLFNTALFLIIWRLL 482
Catalyzes the reduction of fatty acyl-CoA to fatty alcohols. The preferred substrates are C16, C18, C18:1 and C18:2 but low activity can be observed with C10-C14 substrates.
Catalyzes the reduction of fatty acyl-CoA to fatty alcohols. The preferred substrates are C16, C18, C18:1 and C18:2 but low activity can be observed with C10-C14 substrates.
C-terminal domain of fatty acyl CoA reductases, a family of SDR-like proteins. SDRs or short-chain dehydrogenases/reductases are Rossmann-fold NAD(P)H-binding proteins. Many proteins in this FAR_C family may function as fatty acyl-CoA reductases (FARs), acting on medium and long chain fatty acids, and have been reported to be involved in diverse processes such as the biosynthesis of insect pheromones, plant cuticular wax production, and mammalian wax biosynthesis. In Arabidopsis thaliana, proteins with this particular architecture have also been identified as the MALE STERILITY 2 (MS2) gene product, which is implicated in male gametogenesis. Mutations in MS2 inhibit the synthesis of exine (sporopollenin), rendering plants unable to reduce pollen wall fatty acids to corresponding alcohols. The function of this C-terminal domain is unclear. Length = 92
>gnl|CDD|111859 pfam03015, Sterile, Male sterility protein
This family represents the C-terminal region of the male sterility protein in a number of arabidopsis and drosophila. A sequence-related jojoba acyl CoA reductase is also included. Length = 94
DUF2621: Protein of unknown function (DUF2621); In
81.41
>PF03015 Sterile: Male sterility protein; InterPro: IPR004262 This family represents the C-terminal region of the male sterility protein in a number of organisms
The Arabidopsis thaliana male sterility 2 (MS2) protein is involved in male gametogenesis. The MS2 protein shows sequence similarity to a jojoba protein (also a member of this group) that converts wax fatty acids to fatty alcohols. It has been suggested that a possible function of the MS2 protein may be as a fatty acyl reductase in the formation of pollen wall substances [].; GO: 0016620 oxidoreductase activity, acting on the aldehyde or oxo group of donors, NAD or NADP as acceptor, 0055114 oxidation-reduction process
>cd09071 FAR_C C-terminal domain of fatty acyl CoA reductases
C-terminal domain of fatty acyl CoA reductases, a family of SDR-like proteins. SDRs or short-chain dehydrogenases/reductases are Rossmann-fold NAD(P)H-binding proteins. Many proteins in this FAR_C family may function as fatty acyl-CoA reductases (FARs), acting on medium and long chain fatty acids, and have been reported to be involved in diverse processes such as the biosynthesis of insect pheromones, plant cuticular wax production, and mammalian wax biosynthesis. In Arabidopsis thaliana, proteins with this particular architecture have also been identified as the MALE STERILITY 2 (MS2) gene product, which is implicated in male gametogenesis. Mutations in MS2 inhibit the synthesis of exine (sporopollenin), rendering plants unable to reduce pollen wall fatty acids to corresponding alcohols. The function of this C-terminal domain is unclear.
>PF05208 ALG3: ALG3 protein; InterPro: IPR007873 The formation of N-glycosidic linkages of glycoproteins involves the ordered assembly of the common Glc3Man9GlcNAc2 core-oligosaccharide on the lipid carrier dolichyl pyrophosphate
Whereas early mannosylation steps occur on the cytoplasmic side of the endoplasmic reticulum with GDP-Man as donor, the final reactions from Man5GlcNAc2-PP-Dol to Man9GlcNAc2-PP-Dol on the lumenal side use Dol-P-Man []. The ALG3 gene encodes the Dol-P-Man:Man5GlcNAc2-PP-Dol mannosyltransferase.; GO: 0016758 transferase activity, transferring hexosyl groups, 0005783 endoplasmic reticulum, 0016021 integral to membrane
