Citrus Sinensis ID: 011036

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-----
MDLSGRYSYSPLLRWNPQVEEYFIRAYGADHFSRISKALTRPSCYSCIRVNTLKTTTDDVIQKLLAIIQNSGSSEADVASSVKGRLQNGTISESQIPGLEYVVFVKGSGPHTIDYGYEPDKPPKEVIVSRKCAEAVLRGAQVYVPGVMACSSHVEKGDVVAVSVAVEQPTLDGGWGLGITRGTVLQGSQTDPYYFERSGLYIGQGTAMMSRAGIFRASEGIAVDMHNRIFQLPSFYDVLEGEIFLQNLPSIVTAHALDPQKGERILDMCAAPGGKTTAIASLLRDEGEVVAVDRSHNKVMDIQKLAAEMGLKCITTYKLDALKAVRRKNESNDEPNMCNSKDNNYITSQTSDSMKLHKEVPSIAAEGLNGDKSCKEKVSNEKGVERTYVSKADTRKNMRRMRNGPGRNQCLGGRAENSKGFSPNSFDRVLLDAPCSALGLRPRLFAAEETIQSLRNHGKYQRRMFDQAVQLVRPGGIIVYSTCTINPGENEALCA
ccccccccccccccccHHHHHHHHHHHcHHHHHHHHHHHccccccEEEEEccccccHHHHHHHHHHHHHcccccccccHHHHcccccccccccccccccccEEEEEccccccccccccccccccEEEEcHHHHHHHHHccccccccccccccccccccEEEEEEcccccccccccccccccccccccccccccccccccEEEEEccEEccHHHHHcccccEEEEEccccccccccccccccEEEEEcccccccccccccccccEEEEccccccHHHHHHHHHcccccEEEEEcccHHHHHHHHHHHHHHcccEEEEEEccHHHHHHHccccccccccccccccccEEEcccccccccccccHHHHccccccccccccccccccEEEEcccHHHHHHHHHHHcccccEEEEcccccccccccccccccEEEEcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHccccccEEEEEcccccccccccccc
ccccccccccccEcccHHHHHHHHHHccHHHHHHHHHHHcccccEEEEEEEcccccHHHHHHHHHHHHHHHHHccccccHHHHHHHcccccccccccccccEEEEEccccccccccccccccccEEEEEHHHHHHHHHcccEEcccEEEcccccccccEEEEEEEcccccccccEEccccccEEEEccccccccccHcEEEEcccEEEccHHHHccccccEEEEEEcccccccccHHHccccEEHccccccHEHEHcccccccEEEEEccccccHHHHHHHHHccccEEEEEcccHHHHHHHHHHHHHccccEEEEEEcccccccccccHHcccccccccccccccccccccHHHHHHHHHHccccccccccEEEEEEEHcccccccHEEHHHHHHHHHHHcccccEEEEEccccccccccccccccEEEEcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEEcccHcHHHcc
mdlsgrysyspllrwnpqVEEYFIRAYgadhfsriskaltrpscyscirvntlkttTDDVIQKLLAIIQNsgsseadvASSVKgrlqngtisesqipglEYVVFVkgsgphtidygyepdkppkevivsRKCAEAVLRGAQVYVPGvmacsshvekgDVVAVSVAVeqptldggwglgitrgtvlqgsqtdpyyfersglyigqgtamMSRAGIfrasegiavdmhnrifqlpsfydvlegeiflqnlpsivtahaldpqkgerildmcaapggkTTAIASLLRDegevvavdrshnkVMDIQKLAAEMGLKCITTYKLDALKAVRRknesndepnmcnskdnnyitsqtsdsmklhkevpsiaaeglngdksckekvsnekgvertyvskadtrknmrrmrngpgrnqclggraenskgfspnsfdrvlldapcsalglrprlFAAEETIQSLRNHGKYQRRMFDQAVQLvrpggiivystctinpgenealca
mdlsgrysyspllrwnPQVEEYFIRAYGADHFSriskaltrpscYSCIRVNTLKTTTDDVIQKLLAIIqnsgsseadvASSVKGRLQngtisesqipgLEYVVFVKGSGPHTIDYGYEPDKPPKEVIVSRKCAEAVLRGAQVYVPGVMACSSHVEKGDVVAVSVAVEQptldggwglgitRGTVLQGSQTDPYYFERSGLYIGQGTAMMSRAGIFRASEGIAVDMHNRIFQLPSFYDVLEGEIFLQNLPSIVTAHALDPQKGERILDMCAAPGGKTTAIASLLRDEGEvvavdrshnkVMDIQKLAAEMGLKCITTYKLDALKAVRrknesndepnmcnskdnnYITSQTSDSMKLHKEVPSIaaeglngdksckekvsnekgvertyvskadtrknmrrmrngpgrnqclggraenskgfspnSFDRVLLDAPCSALGLRPRLFAAEETIQSLrnhgkyqrRMFDQAVQLVRPGGIIVystctinpgenealca
MDLSGRYSYSPLLRWNPQVEEYFIRAYGADHFSRISKALTRPSCYSCIRVNTLKTTTDDVIQKLLAIIQNSGSSEADVASSVKGRLQNGTISESQIPGLEYVVFVKGSGPHTIDYGYEPDKPPKEVIVSRKCAEAVLRGAQVYVPGVMACSSHVEKGDVVAVSVAVEQPTLDGGWGLGITRGTVLQGSQTDPYYFERSGLYIGQGTAMMSRAGIFRASEGIAVDMHNRIFQLPSFYDVLEGEIFLQNLPSIVTAHALDPQKGERILDMCAAPGGKTTAIASLLRDEGEVVAVDRSHNKVMDIQKLAAEMGLKCITTYKLDALKAVRRKNESNDEPNMCNSKDNNYITSQTSDSMKLHKEVPSIAAEGLNGDKSCKEKVSNEKGVERTYVSKADTrknmrrmrngpgrnQCLGGRAENSKGFSPNSFDRVLLDAPCSALGLRPRLFAAEETIQSLRNHGKYQRRMFDQAVQLVRPGGIIVYSTCTINPGENEALCA
******YSYSPLLRWNPQVEEYFIRAYGADHFSRISKALTRPSCYSCIRVNTLKTTTDDVIQKLLAIIQ*************************QIPGLEYVVFVKGSGPHTIDYGYEPDKPPKEVIVSRKCAEAVLRGAQVYVPGVMACSSHVEKGDVVAVSVAVEQPTLDGGWGLGITRGTVLQGSQTDPYYFERSGLYIGQGTAMMSRAGIFRASEGIAVDMHNRIFQLPSFYDVLEGEIFLQNLPSIVTAHALDPQKGERILDMCAAPGGKTTAIASLLRDEGEVVAVDRSHNKVMDIQKLAAEMGLKCITTYKLDALKA*****************************************************************************************************FDRVLLDAPCSALGLRPRLFAAEETIQSLRNHGKYQRRMFDQAVQLVRPGGIIVYSTCTIN*********
******Y*YSPLLRWNPQVEEYFIRAYGADHFSRISKALTRPSCYSCIRVNTLKTTTDDVIQKLLAIIQNSGSSEADVASSVKGRLQNGTISESQIPGLEYVVFVKGSGPHTIDYGYEPDKPPKEVIVSRKCAEAVLRGAQVYVPGVMACSSHVEKGDVVAVSVAVEQPTLDGGWGLGITRGTVLQGSQTDPYYFERSGLYIGQGTAMMSRAGIFRASEGIAVDMHNRIFQLPSFYDVLEGEIFLQNLPSIVTAHALDPQKGERILDMCAAPGGKTTAIASLLRDEGEVVAVDRSHNKVMDIQKLAAEMGLKCITTYKLDALKAVRRKNESNDEPNMCNSKDNNYITSQTSDSMKLHKEVPSIAAEGLNGDKSCKEKVSNEKGVERTYVSKADTRKNMRRMRNGPGRNQCLGGRAENSKGFSPNSFDRVLLDAPCSALGLRPRLFAAEETIQSLRNHGKYQRRMFDQAVQLVRPGGIIVYSTCTINPGENEALCA
MDLSGRYSYSPLLRWNPQVEEYFIRAYGADHFSRISKALTRPSCYSCIRVNTLKTTTDDVIQKLLAIIQN**************RLQNGTISESQIPGLEYVVFVKGSGPHTIDYGYEPDKPPKEVIVSRKCAEAVLRGAQVYVPGVMACSSHVEKGDVVAVSVAVEQPTLDGGWGLGITRGTVLQGSQTDPYYFERSGLYIGQGTAMMSRAGIFRASEGIAVDMHNRIFQLPSFYDVLEGEIFLQNLPSIVTAHALDPQKGERILDMCAAPGGKTTAIASLLRDEGEVVAVDRSHNKVMDIQKLAAEMGLKCITTYKLDALKAVRRKNESNDEPNMCNSKDNNYITSQTSDSMKLHKEVPSIAAEGLNGDKSCKEKVSNEKGVERTYVSKADTRKNMRRMRNGPGRNQCLGGRAENSKGFSPNSFDRVLLDAPCSALGLRPRLFAAEETIQSLRNHGKYQRRMFDQAVQLVRPGGIIVYSTCTINPGENEALCA
*****RYSYSPLLRWNPQVEEYFIRAYGADHFSRISKALTRPSCYSCIRVNTLKTTTDDVIQKLLAIIQNSGSSEADVASSVKGRLQNGTISESQIPGLEYVVFVKGSGPHTIDYGYEPDKPPKEVIVSRKCAEAVLRGAQVYVPGVMACSSHVEKGDVVAVSVAVEQPTLDGGWGLGITRGTVLQGSQTDPYYFERSGLYIGQGTAMMSRAGIFRASEGIAVDMHNRIFQLPSFYDVLEGEIFLQNLPSIVTAHALDPQKGERILDMCAAPGGKTTAIASLLRDEGEVVAVDRSHNKVMDIQKLAAEMGLKCITTYKLDALKAVRRKNESNDEPNMCNSKDNNYITSQTSDSMKLHKEVPSIAAEGLNGDKSCKEKVSNEKGVERTYVSKADTRKNMRRMRNGPGRNQCLGGRAENSKGFSPNSFDRVLLDAPCSALGLRPRLFAAEETIQSLRNHGKYQRRMFDQAVQLVRPGGIIVYSTCTINPGENE****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MDLSGRYSYSPLLRWNPQVEEYFIRAYGADHFSRISKALTRPSCYSCIRVNTLKTTTDDVIQKLLAIIQNSGSSEADVASSVKGRLQNGTISESQIPGLEYVVFVKGSGPHTIDYGYEPDKPPKEVIVSRKCAEAVLRGAQVYVPGVMACSSHVEKGDVVAVSVAVEQPTLDGGWGLGITRGTVLQGSQTDPYYFERSGLYIGQGTAMMSRAGIFRASEGIAVDMHNRIFQLPSFYDVLEGEIFLQNLPSIVTAHALDPQKGERILDMCAAPGGKTTAIASLLRDEGEVVAVDRSHNKVMDIQKLAAEMGLKCITTYKLDALKAVRRKNESNDEPNMCNSKDNNYITSQTSDSMKLHKEVPSIAAEGLNGDKSCKEKVSNEKGVERTYVSKADTRKNMRRMRNGPGRNQCLGGRAENSKGFSPNSFDRVLLDAPCSALGLRPRLFAAEETIQSLRNHGKYQRRMFDQAVQLVRPGGIIVYSTCTINPGENEALCA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query495 2.2.26 [Sep-21-2011]
Q7TS68476 Putative methyltransferas yes no 0.563 0.586 0.331 2e-40
Q8TEA1469 Putative methyltransferas yes no 0.569 0.601 0.322 4e-39
Q9V106311 tRNA (cytosine(49)-C(5))- no no 0.143 0.228 0.452 3e-12
P94464447 Ribosomal RNA small subun yes no 0.161 0.178 0.428 7e-12
P72943446 Ribosomal RNA small subun N/A no 0.179 0.199 0.391 2e-09
A4WBJ4 480 Ribosomal RNA small subun yes no 0.133 0.137 0.412 2e-09
Q6LQU5 476 Ribosomal RNA small subun yes no 0.151 0.157 0.428 2e-09
Q96P11429 Putative methyltransferas no no 0.258 0.298 0.279 2e-09
Q7MKY6 472 Ribosomal RNA small subun yes no 0.220 0.230 0.380 2e-09
Q8D9F3 472 Ribosomal RNA small subun yes no 0.220 0.230 0.380 2e-09
>sp|Q7TS68|NSUN6_MOUSE Putative methyltransferase NSUN6 OS=Mus musculus GN=Nsun6 PE=2 SV=2 Back     alignment and function desciption
 Score =  167 bits (422), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 110/332 (33%), Positives = 166/332 (50%), Gaps = 53/332 (15%)

Query: 11  PLLRWNPQVEEYFIRAY-------------GADHFSRISKALTRPSCYSCIRVNTLKTTT 57
           P +   P+VE Y   ++                 F  +   L+ P   + +RVNT   + 
Sbjct: 5   PKISLRPEVENYLKESFLNEEAVSASSRQEAERKFETLLLRLSHPPSMTTVRVNTHLGSV 64

Query: 58  DDVIQKLLAIIQNSGSSEADVASSVKGRLQNGTISESQIPGLEYVVFVKGSGPHTIDYGY 117
             V   LL  +Q               +    +I   Q P L  V+ +  +GP       
Sbjct: 65  QHVRGLLLEELQK--------------QFGESSIPVVQHPALPDVLLIPMTGPRK----- 105

Query: 118 EPDKPPKEVIVSRKCAEAVLRGAQVYVPGVMACSSHVEKGDVVAVSVAVEQPTLDGGWGL 177
             ++   EVIV  +C  AVLRGA VYVPG+++ S  ++ GDV++V   +           
Sbjct: 106 NIERQQGEVIVGAQCGNAVLRGAHVYVPGIVSASKFMKAGDVISVYSDI----------- 154

Query: 178 GITRGTVLQGSQTDPYYFERSGLYIGQGTAMMSRAGIFRAS---EGIAVDMHNRIFQLPS 234
               G   +G++     F+ + +++G G + +SR  IF      +GI + M   I+  PS
Sbjct: 155 ---NGKCKKGAKE----FDGTKVFLGNGISELSRKDIFNGLPDLKGIGIRMTEPIYLSPS 207

Query: 235 FYDVLEGEIFLQNLPSIVTAHALDPQKGERILDMCAAPGGKTTAIASLLRDEGEVVAVDR 294
           F +VL   IFLQNLPS V AH LDPQ GE+ILDMCAAPGGKTT  A+L++D+GEV+A+D+
Sbjct: 208 FDNVLPSYIFLQNLPSTVVAHVLDPQPGEKILDMCAAPGGKTTHTAALMQDKGEVIALDK 267

Query: 295 SHNKVMDIQKLAAEMGLKCITTYKLDALKAVR 326
              KV  +++ A+ +GL  I  +  DA KA++
Sbjct: 268 ILTKVNKLKQNASLLGLHSIRAFCFDATKALK 299
May have S-adenosyl-L-methionine-dependent methyl-transferase activity.
Mus musculus (taxid: 10090)
EC: 2EC: .EC: 1EC: .EC: 1EC: .EC: -
>sp|Q8TEA1|NSUN6_HUMAN Putative methyltransferase NSUN6 OS=Homo sapiens GN=NSUN6 PE=1 SV=1 Back     alignment and function description
>sp|Q9V106|TRCM_PYRAB tRNA (cytosine(49)-C(5))-methyltransferase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=PYRAB06230 PE=1 SV=1 Back     alignment and function description
>sp|P94464|RSMB_BACSU Ribosomal RNA small subunit methyltransferase B OS=Bacillus subtilis (strain 168) GN=rsmB PE=3 SV=2 Back     alignment and function description
>sp|P72943|RSMB_SYNY3 Ribosomal RNA small subunit methyltransferase B OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=rsmB PE=3 SV=1 Back     alignment and function description
>sp|A4WBJ4|RSMF_ENT38 Ribosomal RNA small subunit methyltransferase F OS=Enterobacter sp. (strain 638) GN=rsmF PE=3 SV=1 Back     alignment and function description
>sp|Q6LQU5|RSMF_PHOPR Ribosomal RNA small subunit methyltransferase F OS=Photobacterium profundum GN=rsmF PE=3 SV=2 Back     alignment and function description
>sp|Q96P11|NSUN5_HUMAN Putative methyltransferase NSUN5 OS=Homo sapiens GN=NSUN5 PE=1 SV=2 Back     alignment and function description
>sp|Q7MKY6|RSMF_VIBVY Ribosomal RNA small subunit methyltransferase F OS=Vibrio vulnificus (strain YJ016) GN=rsmF PE=3 SV=2 Back     alignment and function description
>sp|Q8D9F3|RSMF_VIBVU Ribosomal RNA small subunit methyltransferase F OS=Vibrio vulnificus (strain CMCP6) GN=rsmF PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query495
359485187590 PREDICTED: putative methyltransferase NS 0.991 0.832 0.768 0.0
302143528561 unnamed protein product [Vitis vinifera] 0.983 0.868 0.768 0.0
255574263586 RNA binding protein, putative [Ricinus c 0.971 0.820 0.717 0.0
449453870556 PREDICTED: putative methyltransferase NS 0.957 0.852 0.717 0.0
449504229559 PREDICTED: LOW QUALITY PROTEIN: putative 0.963 0.853 0.717 0.0
356553761571 PREDICTED: putative methyltransferase NS 0.977 0.847 0.696 0.0
357494215572 Ribosomal RNA small subunit methyltransf 0.971 0.840 0.649 0.0
297843456 599 predicted protein [Arabidopsis lyrata su 0.975 0.806 0.655 0.0
226495531585 hypothetical protein [Zea mays] gi|21988 0.965 0.817 0.643 1e-180
115476098589 Os08g0365900 [Oryza sativa Japonica Grou 0.983 0.826 0.628 1e-180
>gi|359485187|ref|XP_002279096.2| PREDICTED: putative methyltransferase NSUN6-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  786 bits (2031), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/493 (76%), Positives = 422/493 (85%), Gaps = 2/493 (0%)

Query: 1   MDLSGRYSYSPLLRWNPQVEEYFIRAYGADHFSRISKALTRPSCYSCIRVNTLKTTTDDV 60
           MD S RY Y+P+LRWNPQVE YF +AYG  HFSRI++AL RPSCYSCIRVNTLK+T+D V
Sbjct: 26  MDPSDRYCYNPVLRWNPQVEAYFSKAYGPHHFSRITQALARPSCYSCIRVNTLKSTSDAV 85

Query: 61  IQKLLAIIQNSGSSEADVASSVKGRLQNGTISESQIPGLEYVVFVKGSGPHTIDYGYEPD 120
           I+KLLAIIQ +     +   S K  L+ G+IS+ Q+PGL+YVVFV+GSGPHTI+YGYE D
Sbjct: 86  IEKLLAIIQET--ELGNTLDSQKKSLETGSISKCQLPGLDYVVFVRGSGPHTIEYGYEID 143

Query: 121 KPPKEVIVSRKCAEAVLRGAQVYVPGVMACSSHVEKGDVVAVSVAVEQPTLDGGWGLGIT 180
           +PPKEVIVSRKCAEAVLRGAQVYVPGV+ACSSHVEKGDVVAVSVAVEQP  DGGWG+GIT
Sbjct: 144 RPPKEVIVSRKCAEAVLRGAQVYVPGVLACSSHVEKGDVVAVSVAVEQPGTDGGWGVGIT 203

Query: 181 RGTVLQGSQTDPYYFERSGLYIGQGTAMMSRAGIFRASEGIAVDMHNRIFQLPSFYDVLE 240
           RGTVLQG QTDPY+FER+ LYIGQG  MMSRAGIFRAS GIAVDM+NR+F+LPSF+DVLE
Sbjct: 204 RGTVLQGQQTDPYHFERNALYIGQGATMMSRAGIFRASGGIAVDMNNRVFKLPSFHDVLE 263

Query: 241 GEIFLQNLPSIVTAHALDPQKGERILDMCAAPGGKTTAIASLLRDEGEVVAVDRSHNKVM 300
           GEIFLQNLPSIVTAHALDPQ+ ERILDMCAAPGGKTTAIA L++D+GEV+AVDRSHNKVM
Sbjct: 264 GEIFLQNLPSIVTAHALDPQQDERILDMCAAPGGKTTAIAILMKDQGEVIAVDRSHNKVM 323

Query: 301 DIQKLAAEMGLKCITTYKLDALKAVRRKNESNDEPNMCNSKDNNYITSQTSDSMKLHKEV 360
           DIQKLAAEMGL CITTYKLDALKAV R NESND       KD   +T Q+SDS +L  E 
Sbjct: 324 DIQKLAAEMGLHCITTYKLDALKAVCRSNESNDMTTPSCRKDAEGVTLQSSDSPRLQMEK 383

Query: 361 PSIAAEGLNGDKSCKEKVSNEKGVERTYVSKADTRKNMRRMRNGPGRNQCLGGRAENSKG 420
              + E    D +C+E V N +G +RTY SKAD RKN+RRMRNGPGRNQ +GGR E SKG
Sbjct: 384 NQCSTEAFAADFACQENVINGEGNQRTYTSKADIRKNIRRMRNGPGRNQGMGGRVEKSKG 443

Query: 421 FSPNSFDRVLLDAPCSALGLRPRLFAAEETIQSLRNHGKYQRRMFDQAVQLVRPGGIIVY 480
           FSPNSFDRVLLDAPCSALGLRPRLFA EETI+SLRNH KYQRRMFDQAVQLVRPGG+IVY
Sbjct: 444 FSPNSFDRVLLDAPCSALGLRPRLFAGEETIESLRNHAKYQRRMFDQAVQLVRPGGVIVY 503

Query: 481 STCTINPGENEAL 493
           STCTINPGENEAL
Sbjct: 504 STCTINPGENEAL 516

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|302143528|emb|CBI22089.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255574263|ref|XP_002528046.1| RNA binding protein, putative [Ricinus communis] gi|223532576|gb|EEF34364.1| RNA binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449453870|ref|XP_004144679.1| PREDICTED: putative methyltransferase NSUN6-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449504229|ref|XP_004162289.1| PREDICTED: LOW QUALITY PROTEIN: putative methyltransferase NSUN6-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356553761|ref|XP_003545221.1| PREDICTED: putative methyltransferase NSUN6-like [Glycine max] Back     alignment and taxonomy information
>gi|357494215|ref|XP_003617396.1| Ribosomal RNA small subunit methyltransferase B [Medicago truncatula] gi|355518731|gb|AET00355.1| Ribosomal RNA small subunit methyltransferase B [Medicago truncatula] Back     alignment and taxonomy information
>gi|297843456|ref|XP_002889609.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297335451|gb|EFH65868.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|226495531|ref|NP_001145845.1| hypothetical protein [Zea mays] gi|219884681|gb|ACL52715.1| unknown [Zea mays] gi|413920972|gb|AFW60904.1| hypothetical protein ZEAMMB73_425055 [Zea mays] Back     alignment and taxonomy information
>gi|115476098|ref|NP_001061645.1| Os08g0365900 [Oryza sativa Japonica Group] gi|38636850|dbj|BAD03090.1| putative nucleolar protein [Oryza sativa Japonica Group] gi|113623614|dbj|BAF23559.1| Os08g0365900 [Oryza sativa Japonica Group] gi|215717005|dbj|BAG95368.1| unnamed protein product [Oryza sativa Japonica Group] gi|222640447|gb|EEE68579.1| hypothetical protein OsJ_27075 [Oryza sativa Japonica Group] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query495
TAIR|locus:2009170599 AT1G06560 [Arabidopsis thalian 0.973 0.804 0.629 2.9e-158
UNIPROTKB|E1BQJ7469 NSUN6 "Uncharacterized protein 0.397 0.420 0.418 1.5e-59
UNIPROTKB|F1RWA0472 NSUN6 "Uncharacterized protein 0.389 0.408 0.415 2.5e-59
RGD|1309535476 Nsun6 "NOP2/Sun domain family, 0.371 0.386 0.443 4.1e-59
UNIPROTKB|E2RDT7469 NSUN6 "Uncharacterized protein 0.371 0.392 0.409 1.9e-57
MGI|MGI:1921705476 Nsun6 "NOL1/NOP2/Sun domain fa 0.371 0.386 0.424 1.7e-56
UNIPROTKB|F1MC44408 NSUN6 "Uncharacterized protein 0.389 0.473 0.398 1.9e-55
UNIPROTKB|Q8TEA1469 NSUN6 "Putative methyltransfer 0.371 0.392 0.395 1.9e-55
FB|FBgn0037200439 CG11109 [Drosophila melanogast 0.377 0.425 0.393 1.7e-54
DICTYBASE|DDB_G0290553501 DDB_G0290553 "PUA domain-conta 0.618 0.610 0.293 1.7e-52
TAIR|locus:2009170 AT1G06560 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1542 (547.9 bits), Expect = 2.9e-158, P = 2.9e-158
 Identities = 309/491 (62%), Positives = 370/491 (75%)

Query:     4 SGRYSYSPLLRWNPQVEEYFIRAYGADHFSRISKALTRPSCYSCIRVNTLKTTTDDVIQK 63
             S RY Y P+LRWNP+VE+YF +AYG DHF+RISKALTRPS YSCIRVNT+KTT+D VI+K
Sbjct:    44 SERYCYDPVLRWNPEVEDYFTKAYGPDHFARISKALTRPSSYSCIRVNTVKTTSDAVIEK 103

Query:    64 LLAIIQNSGSSEADVASSVKGRLQNGTISESQIPGLEYVVFVKGSGPHTIDYGYEPDKPP 123
             L  I+ +S   E        G   +  +++ QIPGL+YVVFV GSGPH I+Y    + PP
Sbjct:   104 LTKILNDS--EEGLKLVQPDG---SSPVTKCQIPGLDYVVFVNGSGPHKIEYDSGLENPP 158

Query:   124 KEVIVSRKCAEAVLRGAQVYVPGVMACSSHVEKGDVVAVSVAVEQPTLDGGWGLGITRGT 183
             KEV+VSRKCAEAVLRGAQVYVPGV+AC++HVEKGD VAV VA+EQP  +G W + +TRGT
Sbjct:   159 KEVLVSRKCAEAVLRGAQVYVPGVLACTAHVEKGDAVAVCVAMEQPGDEGDWSVNMTRGT 218

Query:   184 VLQGSQTDPYYFERSGLYIGQGTAMMSRAGIFRASEGIAVDMHNRIFQLPSFYDVLEGEI 243
              LQG  TDPYY ERSGLYIG GTAM+SRAG+FR   GIAVD+++R+F+LPS +++LEGEI
Sbjct:   219 TLQGLPTDPYYRERSGLYIGMGTAMLSRAGMFRVPNGIAVDLNHRVFRLPSLHNILEGEI 278

Query:   244 FLQNLPSIVTAHALDPQKGERILDMCAAPGGKTTAIASLLRDEGEVVAVDRSHNKVMDIQ 303
             FLQNLPSI+ AHALDPQKGERILDMCAAPGGKTTAIA L+ DEGE+VA DRSHNKV+ +Q
Sbjct:   279 FLQNLPSIIVAHALDPQKGERILDMCAAPGGKTTAIAILMNDEGEIVAADRSHNKVLVVQ 338

Query:   304 KLAAEMGLKCITTYKLDALKAVRRKNESNDEPNMCNSKDNNYITSQTSDS-MKLHKEVPS 362
              L+AEMG  CITT KLDALK+V      N+   + N  DN+  +S TS S +  ++E+ S
Sbjct:   339 NLSAEMGFTCITTCKLDALKSVCLPTTLNESTILING-DNS--SSMTSHSELSSNEEMTS 395

Query:   363 IAAEGLNGDKSCKEKVSNEKGVERTYVSKADTXXXXXXXXXXXXXXQCLGGRAENSKGFS 422
             + +     DKSC++  S E+      VS+A                QC GGRA  S+GF 
Sbjct:   396 VTSRRSEADKSCEKNDSTEQPNGGDNVSQAYIRKNKGRLKNGRGRTQCQGGRAGKSQGFP 455

Query:   423 PNSFDRVLLDAPCSALGLRPRLFAAEETIQSLRNHGKYQRRMFDQAVQLVRPGGIIVYST 482
             PNSFDRVLLDAPCSALGLRPRLFA  ET+ SLRNHG YQR+M DQAVQLVR GGI+VYST
Sbjct:   456 PNSFDRVLLDAPCSALGLRPRLFAGLETVVSLRNHGWYQRKMLDQAVQLVRVGGILVYST 515

Query:   483 CTINPGENEAL 493
             CTINP ENEA+
Sbjct:   516 CTINPSENEAV 526
GO:0003723 "RNA binding" evidence=IEA
GO:0008168 "methyltransferase activity" evidence=IEA
UNIPROTKB|E1BQJ7 NSUN6 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
UNIPROTKB|F1RWA0 NSUN6 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|1309535 Nsun6 "NOP2/Sun domain family, member 6" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|E2RDT7 NSUN6 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
MGI|MGI:1921705 Nsun6 "NOL1/NOP2/Sun domain family member 6" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|F1MC44 NSUN6 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|Q8TEA1 NSUN6 "Putative methyltransferase NSUN6" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
FB|FBgn0037200 CG11109 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
DICTYBASE|DDB_G0290553 DDB_G0290553 "PUA domain-containing protein" [Dictyostelium discoideum (taxid:44689)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.1.10.691
4th Layer2.1.1.29LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00018872001
SubName- Full=Chromosome chr12 scaffold_18, whole genome shotgun sequence; (587 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query495
COG0144355 COG0144, Sun, tRNA and rRNA cytosine-C5-methylases 3e-25
PRK14902444 PRK14902, PRK14902, 16S rRNA methyltransferase B; 1e-24
COG0144355 COG0144, Sun, tRNA and rRNA cytosine-C5-methylases 1e-21
PRK14901434 PRK14901, PRK14901, 16S rRNA methyltransferase B; 3e-21
PRK14904445 PRK14904, PRK14904, 16S rRNA methyltransferase B; 6e-19
PRK14901434 PRK14901, PRK14901, 16S rRNA methyltransferase B; 8e-18
PRK14902444 PRK14902, PRK14902, 16S rRNA methyltransferase B; 1e-17
TIGR00446264 TIGR00446, nop2p, NOL1/NOP2/sun family putative RN 5e-14
TIGR00446264 TIGR00446, nop2p, NOL1/NOP2/sun family putative RN 2e-13
pfam01189277 pfam01189, Nol1_Nop2_Fmu, NOL1/NOP2/sun family 6e-13
PRK14904445 PRK14904, PRK14904, 16S rRNA methyltransferase B; 1e-12
TIGR00563426 TIGR00563, rsmB, ribosomal RNA small subunit methy 2e-12
PRK10901427 PRK10901, PRK10901, 16S rRNA methyltransferase B; 5e-12
PRK11933 470 PRK11933, yebU, rRNA (cytosine-C(5)-)-methyltransf 4e-11
PRK14903431 PRK14903, PRK14903, 16S rRNA methyltransferase B; 6e-11
PRK14903431 PRK14903, PRK14903, 16S rRNA methyltransferase B; 7e-11
TIGR00563426 TIGR00563, rsmB, ribosomal RNA small subunit methy 2e-10
pfam01189277 pfam01189, Nol1_Nop2_Fmu, NOL1/NOP2/sun family 4e-10
PRK10901427 PRK10901, PRK10901, 16S rRNA methyltransferase B; 4e-10
PRK04270300 PRK04270, PRK04270, H/ACA RNA-protein complex comp 3e-06
PRK11933 470 PRK11933, yebU, rRNA (cytosine-C(5)-)-methyltransf 4e-06
pfam13847151 pfam13847, Methyltransf_31, Methyltransferase doma 7e-05
pfam0147274 pfam01472, PUA, PUA domain 1e-04
PRK14902444 PRK14902, PRK14902, 16S rRNA methyltransferase B; 3e-04
smart0035976 smart00359, PUA, Putative RNA-binding Domain in Ps 6e-04
PRK08317241 PRK08317, PRK08317, hypothetical protein; Provisio 7e-04
pfam13659117 pfam13659, Methyltransf_26, Methyltransferase doma 0.002
COG0293205 COG0293, FtsJ, 23S rRNA methylase [Translation, ri 0.004
>gnl|CDD|223222 COG0144, Sun, tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information 
 Score =  105 bits (265), Expect = 3e-25
 Identities = 40/100 (40%), Positives = 61/100 (61%), Gaps = 4/100 (4%)

Query: 229 IFQLPSFYDVLEGEIFLQNLPSIVTAHALDPQKGERILDMCAAPGGKTTAIASLLRDEGE 288
           I +LP F    EG I++Q+  S + A  LDP+ GER+LD+CAAPGGKTT +A L+ +EG 
Sbjct: 127 IGRLPEF---AEGLIYVQDEASQLPALVLDPKPGERVLDLCAAPGGKTTHLAELMENEGA 183

Query: 289 -VVAVDRSHNKVMDIQKLAAEMGLKCITTYKLDALKAVRR 327
            VVAVD S  ++  +++    +G++ +     DA +    
Sbjct: 184 IVVAVDVSPKRLKRLRENLKRLGVRNVIVVNKDARRLAEL 223

Length = 355
>gnl|CDD|237857 PRK14902, PRK14902, 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>gnl|CDD|223222 COG0144, Sun, tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>gnl|CDD|237856 PRK14901, PRK14901, 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>gnl|CDD|237858 PRK14904, PRK14904, 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>gnl|CDD|237856 PRK14901, PRK14901, 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>gnl|CDD|237857 PRK14902, PRK14902, 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>gnl|CDD|188051 TIGR00446, nop2p, NOL1/NOP2/sun family putative RNA methylase Back     alignment and domain information
>gnl|CDD|188051 TIGR00446, nop2p, NOL1/NOP2/sun family putative RNA methylase Back     alignment and domain information
>gnl|CDD|201649 pfam01189, Nol1_Nop2_Fmu, NOL1/NOP2/sun family Back     alignment and domain information
>gnl|CDD|237858 PRK14904, PRK14904, 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>gnl|CDD|233025 TIGR00563, rsmB, ribosomal RNA small subunit methyltransferase RsmB Back     alignment and domain information
>gnl|CDD|236790 PRK10901, PRK10901, 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>gnl|CDD|183387 PRK11933, yebU, rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed Back     alignment and domain information
>gnl|CDD|184896 PRK14903, PRK14903, 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>gnl|CDD|184896 PRK14903, PRK14903, 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>gnl|CDD|233025 TIGR00563, rsmB, ribosomal RNA small subunit methyltransferase RsmB Back     alignment and domain information
>gnl|CDD|201649 pfam01189, Nol1_Nop2_Fmu, NOL1/NOP2/sun family Back     alignment and domain information
>gnl|CDD|236790 PRK10901, PRK10901, 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>gnl|CDD|179806 PRK04270, PRK04270, H/ACA RNA-protein complex component Cbf5p; Reviewed Back     alignment and domain information
>gnl|CDD|183387 PRK11933, yebU, rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed Back     alignment and domain information
>gnl|CDD|222415 pfam13847, Methyltransf_31, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|201816 pfam01472, PUA, PUA domain Back     alignment and domain information
>gnl|CDD|237857 PRK14902, PRK14902, 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>gnl|CDD|214635 smart00359, PUA, Putative RNA-binding Domain in PseudoUridine synthase and Archaeosine transglycosylase Back     alignment and domain information
>gnl|CDD|181382 PRK08317, PRK08317, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|222295 pfam13659, Methyltransf_26, Methyltransferase domain Back     alignment and domain information
>gnl|CDD|223370 COG0293, FtsJ, 23S rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 495
KOG1122460 consensus tRNA and rRNA cytosine-C5-methylase (nuc 100.0
COG0144355 Sun tRNA and rRNA cytosine-C5-methylases [Translat 100.0
PRK11933 470 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; 100.0
PF01189283 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR 100.0
PRK14903431 16S rRNA methyltransferase B; Provisional 100.0
PRK14901434 16S rRNA methyltransferase B; Provisional 100.0
TIGR00563426 rsmB ribosomal RNA small subunit methyltransferase 100.0
TIGR00446264 nop2p NOL1/NOP2/sun family putative RNA methylase. 100.0
PRK14904445 16S rRNA methyltransferase B; Provisional 100.0
PRK10901427 16S rRNA methyltransferase B; Provisional 100.0
PRK14902444 16S rRNA methyltransferase B; Provisional 100.0
KOG2198375 consensus tRNA cytosine-5-methylases and related e 100.0
KOG2360413 consensus Proliferation-associated nucleolar prote 99.91
PRK15128396 23S rRNA m(5)C1962 methyltransferase; Provisional 99.72
COG1092393 Predicted SAM-dependent methyltransferases [Genera 99.71
PF10672286 Methyltrans_SAM: S-adenosylmethionine-dependent me 99.64
PRK11783702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 99.57
COG2226238 UbiE Methylase involved in ubiquinone/menaquinone 99.41
PRK00377198 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; 99.4
PF13659117 Methyltransf_26: Methyltransferase domain; PDB: 3G 99.38
PF01209233 Ubie_methyltran: ubiE/COQ5 methyltransferase famil 99.38
TIGR01177329 conserved hypothetical protein TIGR01177. This fam 99.38
PTZ00146293 fibrillarin; Provisional 99.34
PF12847112 Methyltransf_18: Methyltransferase domain; PDB: 3G 99.33
PRK14967223 putative methyltransferase; Provisional 99.31
TIGR00080215 pimt protein-L-isoaspartate(D-aspartate) O-methylt 99.31
TIGR00537179 hemK_rel_arch HemK-related putative methylase. The 99.31
COG2242187 CobL Precorrin-6B methylase 2 [Coenzyme metabolism 99.3
PF05175170 MTS: Methyltransferase small domain; InterPro: IPR 99.29
PRK07402196 precorrin-6B methylase; Provisional 99.29
TIGR03704251 PrmC_rel_meth putative protein-(glutamine-N5) meth 99.29
PRK04266226 fibrillarin; Provisional 99.29
TIGR03533284 L3_gln_methyl protein-(glutamine-N5) methyltransfe 99.28
TIGR02469124 CbiT precorrin-6Y C5,15-methyltransferase (decarbo 99.26
PRK03522315 rumB 23S rRNA methyluridine methyltransferase; Rev 99.21
PRK14968188 putative methyltransferase; Provisional 99.2
TIGR02752231 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone me 99.2
TIGR00536284 hemK_fam HemK family putative methylases. The gene 99.2
PRK11805307 N5-glutamine S-adenosyl-L-methionine-dependent met 99.18
PRK13944205 protein-L-isoaspartate O-methyltransferase; Provis 99.18
PRK13942212 protein-L-isoaspartate O-methyltransferase; Provis 99.18
PRK09328275 N5-glutamine S-adenosyl-L-methionine-dependent met 99.18
TIGR03534251 RF_mod_PrmC protein-(glutamine-N5) methyltransfera 99.18
PRK13168443 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewe 99.16
PF13847152 Methyltransf_31: Methyltransferase domain; PDB: 3T 99.15
PLN02233261 ubiquinone biosynthesis methyltransferase 99.14
PRK11873272 arsM arsenite S-adenosylmethyltransferase; Reviewe 99.13
PRK00121202 trmB tRNA (guanine-N(7)-)-methyltransferase; Revie 99.12
TIGR00479431 rumA 23S rRNA (uracil-5-)-methyltransferase RumA. 99.12
TIGR00438188 rrmJ cell division protein FtsJ. 99.12
PRK00312212 pcm protein-L-isoaspartate O-methyltransferase; Re 99.11
PF08704247 GCD14: tRNA methyltransferase complex GCD14 subuni 99.11
PRK08287187 cobalt-precorrin-6Y C(15)-methyltransferase; Valid 99.1
COG2265432 TrmA SAM-dependent methyltransferases related to t 99.08
PLN02244340 tocopherol O-methyltransferase 99.05
PLN02781234 Probable caffeoyl-CoA O-methyltransferase 99.04
PRK00107187 gidB 16S rRNA methyltransferase GidB; Reviewed 99.04
PF01135209 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyl 99.02
PF0147274 PUA: PUA domain; InterPro: IPR002478 The PUA (Pseu 99.01
COG2519256 GCD14 tRNA(1-methyladenosine) methyltransferase an 99.0
PRK11188209 rrmJ 23S rRNA methyltransferase J; Provisional 99.0
PRK15001378 SAM-dependent 23S ribosomal RNA mG1835 methyltrans 99.0
PLN02476278 O-methyltransferase 98.99
COG4123248 Predicted O-methyltransferase [General function pr 98.99
COG1041347 Predicted DNA modification methylase [DNA replicat 98.98
PRK13943322 protein-L-isoaspartate O-methyltransferase; Provis 98.97
PF02475200 Met_10: Met-10+ like-protein; InterPro: IPR003402 98.96
PRK09489342 rsmC 16S ribosomal RNA m2G1207 methyltransferase; 98.96
TIGR00451107 unchar_dom_2 uncharacterized domain 2. This unchar 98.96
PRK14966423 unknown domain/N5-glutamine S-adenosyl-L-methionin 98.96
TIGR02085374 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransfer 98.95
PRK11207197 tellurite resistance protein TehB; Provisional 98.95
PRK08317241 hypothetical protein; Provisional 98.95
KOG1540296 consensus Ubiquinone biosynthesis methyltransferas 98.94
COG2518209 Pcm Protein-L-isoaspartate carboxylmethyltransfera 98.94
PRK14121390 tRNA (guanine-N(7)-)-methyltransferase; Provisiona 98.93
PRK01544 506 bifunctional N5-glutamine S-adenosyl-L-methionine- 98.93
TIGR00138181 gidB 16S rRNA methyltransferase GidB. GidB (glucos 98.93
TIGR00091194 tRNA (guanine-N(7)-)-methyltransferase. In E. coli 98.92
PRK14560160 putative RNA-binding protein; Provisional 98.92
PF03602183 Cons_hypoth95: Conserved hypothetical protein 95; 98.91
PF05958352 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferas 98.91
COG2016161 Predicted RNA-binding protein (contains PUA domain 98.9
PRK04338382 N(2),N(2)-dimethylguanosine tRNA methyltransferase 98.88
PTZ00098263 phosphoethanolamine N-methyltransferase; Provision 98.88
PF0824195 Methyltransf_11: Methyltransferase domain; InterPr 98.86
PRK15451247 tRNA cmo(5)U34 methyltransferase; Provisional 98.86
PF01170179 UPF0020: Putative RNA methylase family UPF0020; In 98.86
COG2890280 HemK Methylase of polypeptide chain release factor 98.86
PRK05031362 tRNA (uracil-5-)-methyltransferase; Validated 98.85
PRK10909199 rsmD 16S rRNA m(2)G966-methyltransferase; Provisio 98.84
PRK11036255 putative S-adenosyl-L-methionine-dependent methylt 98.83
PRK01683258 trans-aconitate 2-methyltransferase; Provisional 98.83
PF02353273 CMAS: Mycolic acid cyclopropane synthetase; InterP 98.82
TIGR03684150 arCOG00985 arCOG04150 universal archaeal PUA-domai 98.81
cd02440107 AdoMet_MTases S-adenosylmethionine-dependent methy 98.81
PLN02396322 hexaprenyldihydroxybenzoate methyltransferase 98.81
TIGR00308374 TRM1 tRNA(guanine-26,N2-N2) methyltransferase. Thi 98.79
PRK14103255 trans-aconitate 2-methyltransferase; Provisional 98.78
COG0742187 N6-adenine-specific methylase [DNA replication, re 98.77
TIGR02143353 trmA_only tRNA (uracil-5-)-methyltransferase. This 98.77
TIGR00095189 RNA methyltransferase, RsmD family. This model rep 98.76
COG4122219 Predicted O-methyltransferase [General function pr 98.75
TIGR00477195 tehB tellurite resistance protein TehB. Part of a 98.75
PRK10258251 biotin biosynthesis protein BioC; Provisional 98.75
COG2520341 Predicted methyltransferase [General function pred 98.74
TIGR00406288 prmA ribosomal protein L11 methyltransferase. Ribo 98.73
PF13649101 Methyltransf_25: Methyltransferase domain; PDB: 3B 98.71
PRK00216239 ubiE ubiquinone/menaquinone biosynthesis methyltra 98.7
PRK11705383 cyclopropane fatty acyl phospholipid synthase; Pro 98.69
COG2813300 RsmC 16S RNA G1207 methylase RsmC [Translation, ri 98.69
PF01596205 Methyltransf_3: O-methyltransferase; InterPro: IPR 98.69
PLN02336475 phosphoethanolamine N-methyltransferase 98.69
PHA03412241 putative methyltransferase; Provisional 98.67
PHA03411279 putative methyltransferase; Provisional 98.67
COG2227243 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4- 98.66
PF01728181 FtsJ: FtsJ-like methyltransferase; InterPro: IPR00 98.66
COG2230283 Cfa Cyclopropane fatty acid synthase and related m 98.65
TIGR00740239 methyltransferase, putative. A simple BLAST search 98.63
PRK12335287 tellurite resistance protein TehB; Provisional 98.61
PRK06922677 hypothetical protein; Provisional 98.59
PRK00517250 prmA ribosomal protein L11 methyltransferase; Revi 98.58
PRK13795 636 hypothetical protein; Provisional 98.58
TIGR01934223 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis 98.58
smart00828224 PKS_MT Methyltransferase in polyketide synthase (P 98.57
COG0293205 FtsJ 23S rRNA methylase [Translation, ribosomal st 98.57
KOG2915314 consensus tRNA(1-methyladenosine) methyltransferas 98.55
PRK15068322 tRNA mo(5)U34 methyltransferase; Provisional 98.54
PLN03075296 nicotianamine synthase; Provisional 98.54
PLN02490340 MPBQ/MSBQ methyltransferase 98.51
PLN02672 1082 methionine S-methyltransferase 98.49
PLN02589247 caffeoyl-CoA O-methyltransferase 98.48
TIGR00452314 methyltransferase, putative. Known examples to dat 98.47
smart00650169 rADc Ribosomal RNA adenine dimethylases. 98.46
KOG2904328 consensus Predicted methyltransferase [General fun 98.46
PF09445163 Methyltransf_15: RNA cap guanine-N2 methyltransfer 98.46
PRK04457262 spermidine synthase; Provisional 98.46
COG2263198 Predicted RNA methylase [Translation, ribosomal st 98.46
TIGR01983224 UbiG ubiquinone biosynthesis O-methyltransferase. 98.46
PRK05134233 bifunctional 3-demethylubiquinone-9 3-methyltransf 98.45
COG2521287 Predicted archaeal methyltransferase [General func 98.44
PRK13534639 7-cyano-7-deazaguanine tRNA-ribosyltransferase; Pr 98.44
PRK00050296 16S rRNA m(4)C1402 methyltranserfase; Provisional 98.43
TIGR02072240 BioC biotin biosynthesis protein BioC. This enzyme 98.42
TIGR02716306 C20_methyl_CrtF C-20 methyltransferase BchU. Membe 98.41
PLN02336 475 phosphoethanolamine N-methyltransferase 98.41
KOG1271227 consensus Methyltransferases [General function pre 98.4
KOG1663237 consensus O-methyltransferase [Secondary metabolit 98.39
PRK13794479 hypothetical protein; Provisional 98.38
TIGR03438301 probable methyltransferase. This model represents 98.36
TIGR00417270 speE spermidine synthase. the SpeE subunit of sper 98.36
TIGR02021219 BchM-ChlM magnesium protoporphyrin O-methyltransfe 98.35
COG2264300 PrmA Ribosomal protein L11 methylase [Translation, 98.34
PRK11088272 rrmA 23S rRNA methyltransferase A; Provisional 98.3
PF03848192 TehB: Tellurite resistance protein TehB; InterPro: 98.3
PF02384311 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 T 98.29
PF02390195 Methyltransf_4: Putative methyltransferase ; Inter 98.28
PF0824299 Methyltransf_12: Methyltransferase domain; InterPr 98.26
PRK00811283 spermidine synthase; Provisional 98.24
smart00138264 MeTrc Methyltransferase, chemotaxis proteins. Meth 98.21
PF06325295 PrmA: Ribosomal protein L11 methyltransferase (Prm 98.21
TIGR03840213 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te d 98.2
PF05401201 NodS: Nodulation protein S (NodS); InterPro: IPR00 98.18
PF13489161 Methyltransf_23: Methyltransferase domain; PDB: 3J 98.17
PRK10742250 putative methyltransferase; Provisional 98.15
PF01269229 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibr 98.14
PRK01581374 speE spermidine synthase; Validated 98.14
COG0220227 Predicted S-adenosylmethionine-dependent methyltra 98.13
PRK03612521 spermidine synthase; Provisional 98.11
KOG1270282 consensus Methyltransferases [Coenzyme transport a 98.07
PRK06202232 hypothetical protein; Provisional 98.07
PLN02366308 spermidine synthase 98.06
PRK05785226 hypothetical protein; Provisional 98.06
TIGR03587204 Pse_Me-ase pseudaminic acid biosynthesis-associate 98.01
PTZ00338294 dimethyladenosine transferase-like protein; Provis 97.94
KOG2187534 consensus tRNA uracil-5-methyltransferase and rela 97.92
smart0035977 PUA Putative RNA-binding Domain in PseudoUridine s 97.92
PRK07580230 Mg-protoporphyrin IX methyl transferase; Validated 97.91
COG4106257 Tam Trans-aconitate methyltransferase [General fun 97.89
KOG0024354 consensus Sorbitol dehydrogenase [Secondary metabo 97.87
PF07021193 MetW: Methionine biosynthesis protein MetW; InterP 97.86
PRK14896258 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 97.86
PRK13255218 thiopurine S-methyltransferase; Reviewed 97.86
COG5270202 PUA domain (predicted RNA-binding domain) [Transla 97.83
PLN02585315 magnesium protoporphyrin IX methyltransferase 97.82
PF03291331 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 97.81
PRK11727321 23S rRNA mA1618 methyltransferase; Provisional 97.81
TIGR02987 524 met_A_Alw26 type II restriction m6 adenine DNA met 97.79
COG0116381 Predicted N6-adenine-specific DNA methylase [DNA r 97.77
PRK00274272 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 97.77
PRK01544506 bifunctional N5-glutamine S-adenosyl-L-methionine- 97.76
KOG4589232 consensus Cell division protein FtsJ [Cell cycle c 97.75
TIGR00006305 S-adenosyl-methyltransferase MraW. Genetics paper 97.74
PF02527184 GidB: rRNA small subunit methyltransferase G; Inte 97.7
PF01861243 DUF43: Protein of unknown function DUF43; InterPro 97.61
KOG1098 780 consensus Putative SAM-dependent rRNA methyltransf 97.58
PF12147311 Methyltransf_20: Putative methyltransferase; Inter 97.48
KOG1099294 consensus SAM-dependent methyltransferase/cell div 97.46
PF08003315 Methyltransf_9: Protein of unknown function (DUF16 97.43
KOG1596317 consensus Fibrillarin and related nucleolar RNA-bi 97.42
TIGR00755253 ksgA dimethyladenosine transferase. Alternate name 97.41
PRK11783 702 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisi 97.4
KOG3420185 consensus Predicted RNA methylase [Translation, ri 97.39
KOG3191209 consensus Predicted N6-DNA-methyltransferase [Tran 97.38
PLN02823336 spermine synthase 97.38
KOG2899288 consensus Predicted methyltransferase [General fun 97.37
COG0357215 GidB Predicted S-adenosylmethionine-dependent meth 97.33
TIGR02081194 metW methionine biosynthesis protein MetW. This pr 97.27
COG1889231 NOP1 Fibrillarin-like rRNA methylase [Translation, 97.23
TIGR00432540 arcsn_tRNA_tgt tRNA-guanine transglycosylase, arch 97.2
PF02005377 TRM: N2,N2-dimethylguanosine tRNA methyltransferas 97.2
PRK13256226 thiopurine S-methyltransferase; Reviewed 97.15
PRK05429372 gamma-glutamyl kinase; Provisional 97.15
KOG1253 525 consensus tRNA methyltransferase [Translation, rib 97.09
KOG1975389 consensus mRNA cap methyltransferase [RNA processi 97.08
PF13578106 Methyltransf_24: Methyltransferase domain; PDB: 3S 97.01
PF01564246 Spermine_synth: Spermine/spermidine synthase; Inte 96.97
PF05185448 PRMT5: PRMT5 arginine-N-methyltransferase; InterPr 96.95
COG0286489 HsdM Type I restriction-modification system methyl 96.93
PF01795310 Methyltransf_5: MraW methylase family; InterPro: I 96.92
PLN02232160 ubiquinone biosynthesis methyltransferase 96.89
COG0030259 KsgA Dimethyladenosine transferase (rRNA methylati 96.86
KOG2523181 consensus Predicted RNA-binding protein with PUA d 96.84
KOG1661237 consensus Protein-L-isoaspartate(D-aspartate) O-me 96.84
KOG2671421 consensus Putative RNA methylase [Replication, rec 96.81
KOG1541270 consensus Predicted protein carboxyl methylase [Ge 96.79
PRK04270300 H/ACA RNA-protein complex component Cbf5p; Reviewe 96.78
KOG2361264 consensus Predicted methyltransferase [General fun 96.77
COG0275314 Predicted S-adenosylmethionine-dependent methyltra 96.74
PRK11760357 putative 23S rRNA C2498 ribose 2'-O-ribose methylt 96.74
PF05219265 DREV: DREV methyltransferase; InterPro: IPR007884 96.72
PF00891241 Methyltransf_2: O-methyltransferase; InterPro: IPR 96.57
KOG2730263 consensus Methylase [General function prediction o 96.51
TIGR00425322 CBF5 rRNA pseudouridine synthase, putative. This f 96.51
PF06080204 DUF938: Protein of unknown function (DUF938); Inte 96.48
PF10294173 Methyltransf_16: Putative methyltransferase; Inter 96.45
TIGR00478228 tly hemolysin TlyA family protein. Hemolysins are 96.44
TIGR01027363 proB glutamate 5-kinase. Bacterial ProB proteins h 96.33
COG3963194 Phospholipid N-methyltransferase [Lipid metabolism 96.33
COG1370155 Prefoldin, molecular chaperone implicated in de no 96.24
COG1064339 AdhP Zn-dependent alcohol dehydrogenases [General 96.22
COG0421282 SpeE Spermidine synthase [Amino acid transport and 96.18
COG1867380 TRM1 N2,N2-dimethylguanosine tRNA methyltransferas 96.17
COG3897218 Predicted methyltransferase [General function pred 96.12
TIGR01444143 fkbM_fam methyltransferase, FkbM family. Members o 96.11
COG4976287 Predicted methyltransferase (contains TPR repeat) 96.08
PF00398262 RrnaAD: Ribosomal RNA adenine dimethylase; InterPr 96.05
TIGR03439319 methyl_EasF probable methyltransferase domain, Eas 96.03
COG1549519 Queuine tRNA-ribosyltransferases, contain PUA doma 95.94
KOG1499346 consensus Protein arginine N-methyltransferase PRM 95.8
PRK10611287 chemotaxis methyltransferase CheR; Provisional 95.61
COG4076252 Predicted RNA methylase [General function predicti 95.59
PF05724218 TPMT: Thiopurine S-methyltransferase (TPMT); Inter 95.54
PF13679141 Methyltransf_32: Methyltransferase domain 95.5
COG0500257 SmtA SAM-dependent methyltransferases [Secondary m 95.48
PF01234256 NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: I 95.47
cd00315275 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA meth 95.39
PF04445234 SAM_MT: Putative SAM-dependent methyltransferase; 95.38
KOG3010261 consensus Methyltransferase [General function pred 95.36
TIGR00497501 hsdM type I restriction system adenine methylase ( 95.29
KOG2782303 consensus Putative SAM dependent methyltransferase 94.77
KOG0820315 consensus Ribosomal RNA adenine dimethylase [RNA p 94.56
PRK04148134 hypothetical protein; Provisional 94.34
KOG4300252 consensus Predicted methyltransferase [General fun 94.25
COG1189245 Predicted rRNA methylase [Translation, ribosomal s 94.24
PF01739196 CheR: CheR methyltransferase, SAM binding domain; 94.15
PF10354166 DUF2431: Domain of unknown function (DUF2431); Int 93.81
PRK11524 284 putative methyltransferase; Provisional 93.74
PF00107130 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: 93.71
COG1063350 Tdh Threonine dehydrogenase and related Zn-depende 93.54
COG1568354 Predicted methyltransferases [General function pre 93.44
PF06962140 rRNA_methylase: Putative rRNA methylase; InterPro: 93.28
KOG1227351 consensus Putative methyltransferase [General func 93.22
PF09243274 Rsm22: Mitochondrial small ribosomal subunit Rsm22 93.13
PRK00536262 speE spermidine synthase; Provisional 92.8
PRK13402368 gamma-glutamyl kinase; Provisional 92.7
PRK09880343 L-idonate 5-dehydrogenase; Provisional 92.37
KOG1500 517 consensus Protein arginine N-methyltransferase CAR 92.33
PRK13699 227 putative methylase; Provisional 92.12
TIGR02822329 adh_fam_2 zinc-binding alcohol dehydrogenase famil 92.04
PF08123205 DOT1: Histone methylation protein DOT1 ; InterPro: 91.59
PF05148219 Methyltransf_8: Hypothetical methyltransferase; In 91.39
PF04816205 DUF633: Family of unknown function (DUF633) ; Inte 91.11
PF00145 335 DNA_methylase: C-5 cytosine-specific DNA methylase 91.04
COG4798238 Predicted methyltransferase [General function pred 91.0
cd08283386 FDH_like_1 Glutathione-dependent formaldehyde dehy 90.92
PF01555231 N6_N4_Mtase: DNA methylase; InterPro: IPR002941 Th 90.8
PF05891218 Methyltransf_PK: AdoMet dependent proline di-methy 90.78
COG1352268 CheR Methylase of chemotaxis methyl-accepting prot 90.61
TIGR03451358 mycoS_dep_FDH mycothiol-dependent formaldehyde deh 90.61
KOG1709271 consensus Guanidinoacetate methyltransferase and r 90.39
PRK12939250 short chain dehydrogenase; Provisional 90.19
PF11599246 AviRa: RRNA methyltransferase AviRa; InterPro: IPR 89.54
PRK11524284 putative methyltransferase; Provisional 89.28
PF04989206 CmcI: Cephalosporin hydroxylase; InterPro: IPR0070 89.12
PRK07102243 short chain dehydrogenase; Provisional 89.02
TIGR03366280 HpnZ_proposed putative phosphonate catabolism asso 88.8
TIGR02825325 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15 88.77
cd08239339 THR_DH_like L-threonine dehydrogenase (TDH)-like. 88.62
KOG2078495 consensus tRNA modification enzyme [RNA processing 88.46
cd08281371 liver_ADH_like1 Zinc-dependent alcohol dehydrogena 88.26
PRK10309347 galactitol-1-phosphate dehydrogenase; Provisional 87.99
PF03141 506 Methyltransf_29: Putative S-adenosyl-L-methionine- 87.83
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 87.63
PRK07533258 enoyl-(acyl carrier protein) reductase; Provisiona 87.56
TIGR03201349 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-Co 87.55
PRK06914280 short chain dehydrogenase; Provisional 87.28
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 87.21
PF03059276 NAS: Nicotianamine synthase protein; InterPro: IPR 87.13
PRK13699227 putative methylase; Provisional 87.04
PRK07326237 short chain dehydrogenase; Provisional 86.3
KOG1197336 consensus Predicted quinone oxidoreductase [Energy 85.82
cd08230355 glucose_DH Glucose dehydrogenase. Glucose dehydrog 85.55
PRK07576264 short chain dehydrogenase; Provisional 85.52
cd08294329 leukotriene_B4_DH_like 13-PGR is a bifunctional en 85.3
PRK09424 509 pntA NAD(P) transhydrogenase subunit alpha; Provis 85.25
PRK07523255 gluconate 5-dehydrogenase; Provisional 85.18
PRK07677252 short chain dehydrogenase; Provisional 85.14
PHA01634156 hypothetical protein 84.98
PRK08945247 putative oxoacyl-(acyl carrier protein) reductase; 84.93
PRK06101240 short chain dehydrogenase; Provisional 84.85
PRK08594257 enoyl-(acyl carrier protein) reductase; Provisiona 84.34
PRK01747 662 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltrans 84.17
PRK07831262 short chain dehydrogenase; Provisional 84.17
PLN02740381 Alcohol dehydrogenase-like 84.11
PF05971299 Methyltransf_10: Protein of unknown function (DUF8 83.7
cd08295338 double_bond_reductase_like Arabidopsis alkenal dou 83.56
PRK06949258 short chain dehydrogenase; Provisional 83.41
PRK06139330 short chain dehydrogenase; Provisional 83.32
PLN02827378 Alcohol dehydrogenase-like 83.06
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 83.0
PRK05867253 short chain dehydrogenase; Provisional 82.72
KOG0023360 consensus Alcohol dehydrogenase, class V [Secondar 82.67
KOG1331293 consensus Predicted methyltransferase [General fun 82.45
PRK08324681 short chain dehydrogenase; Validated 82.36
COG0263369 ProB Glutamate 5-kinase [Amino acid transport and 82.35
PRK07666239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 82.27
PRK08085254 gluconate 5-dehydrogenase; Provisional 82.05
KOG3115249 consensus Methyltransferase-like protein [General 81.83
PRK08063250 enoyl-(acyl carrier protein) reductase; Provisiona 81.55
KOG1269364 consensus SAM-dependent methyltransferases [Lipid 81.48
PRK08251248 short chain dehydrogenase; Provisional 81.43
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 81.1
PRK12937245 short chain dehydrogenase; Provisional 81.1
PRK08643256 acetoin reductase; Validated 80.94
PF10237162 N6-adenineMlase: Probable N6-adenine methyltransfe 80.86
PRK06124256 gluconate 5-dehydrogenase; Provisional 80.46
PRK06197306 short chain dehydrogenase; Provisional 80.38
cd08254338 hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carbo 80.24
PRK07890258 short chain dehydrogenase; Provisional 80.21
>KOG1122 consensus tRNA and rRNA cytosine-C5-methylase (nucleolar protein NOL1/NOP2) [RNA processing and modification] Back     alignment and domain information 
Probab=100.00  E-value=4.8e-67  Score=537.92  Aligned_cols=371  Identities=27%  Similarity=0.396  Sum_probs=305.9

Q ss_pred             CCCCcccccccccCHHHHHHHHHhhchhhHHHHHHHhcCCCCccEEEeecCCCCHHHHHHHHHHHHHhcCCCcccccccc
Q 011036            3 LSGRYSYSPLLRWNPQVEEYFIRAYGADHFSRISKALTRPSCYSCIRVNTLKTTTDDVIQKLLAIIQNSGSSEADVASSV   82 (495)
Q Consensus         3 ~~~~~~~~~~~~~~~~v~~~l~~~~~~~~~~~~~~~l~~pp~~~~iRVNTl~~s~~~~~~~L~~~~~~~~~~~~~~~~~~   82 (495)
                      ++++ +|+|.++|++++++|+...|+.++++++...+ .+-.+.++|.++-+...+..++.+.....+.    ....++.
T Consensus         7 ~~e~-~~~~~~~~~~e~~~~~~d~~~~~d~~~~~~~~-~e~~~~~l~~~~~~~~~~~~~e~~~~~~~~~----~~l~lp~   80 (460)
T KOG1122|consen    7 DSEE-EYLPGSGSNPEVEDYFTDDFRDDDLDDIDLKL-IERKSRKLRKRESLEASEAEEELNTNTFEEG----DPLLLPT   80 (460)
T ss_pred             cccc-ccCcCCCCCccchhhhccccCccchhhhhhhh-hhhHHHHHHHhhcccchhhHHHHhhcccccc----ccccCcc
Confidence            5677 99999999999999999999999999999999 9999999999999888877777766332211    0111222


Q ss_pred             cc-ccCCCccccccCCCCCceEEEeCCCCccccCCCCCCCCCCeEEEccchHHHHHcccccccCceeeccCCccCCCeEE
Q 011036           83 KG-RLQNGTISESQIPGLEYVVFVKGSGPHTIDYGYEPDKPPKEVIVSRKCAEAVLRGAQVYVPGVMACSSHVEKGDVVA  161 (495)
Q Consensus        83 ~~-~~~~~~~~~~~~~~l~~~l~i~~~gp~~~~~~~~~~~~~k~ViVd~~~~eAVLrGA~v~aPGIl~~~~~i~~Gd~Va  161 (495)
                      .+ ......++..++..+-.+-++++.|+++--     ....+  +++..|+.++++||++|+||++.+.++++.++.+.
T Consensus        81 ~~~~~~~~~~P~L~~v~~~~~~~~~~l~dfk~l-----~~~~~--~~~~~~~~l~~~~~~~y~y~~~l~~~~~e~~~~~e  153 (460)
T KOG1122|consen   81 LEEEEEKDSVPDLQNVDLRIVELVPVLGDFKNL-----KEPGR--LRSEYCGQLKKDGAHYYAYGVFLAEKLMELFPLVE  153 (460)
T ss_pred             cccccccccCCccchhhHHhhhhhhhhcchhcc-----ccccc--chhhHHHHHHhcccceechHHHHHHHhcccccHHH
Confidence            22 111122223334444445566677777521     11222  89999999999999999999999999999999999


Q ss_pred             EEEcccCCcCCCCCccccccccccccCCCCCCcccCCCceEeecccccccccccccccc----eeeecCCcccccCCccc
Q 011036          162 VSVAVEQPTLDGGWGLGITRGTVLQGSQTDPYYFERSGLYIGQGTAMMSRAGIFRASEG----IAVDMHNRIFQLPSFYD  237 (495)
Q Consensus       162 V~~~l~~~~~~~~w~~~~~rg~~l~~~~~~~~~~~r~~l~Vg~GialmSr~elf~~p~G----IaVe~~~~v~~lp~~~~  237 (495)
                      |+.++++.++.+..        .+.        .+..+++.|.+...+++.+++..+-|    +.+.+...++.+|.+.+
T Consensus       154 v~~~~e~~~~~rp~--------tir--------~ntlk~~rrd~~~~L~nrgv~~~pl~~ws~vgl~v~~s~vpigat~e  217 (460)
T KOG1122|consen  154 VYEFLEANEKPRPV--------TIR--------TNTLKTRRRDLAVELSNRGVNLDPLGKWSKVGLVVFDSVVPIGATPE  217 (460)
T ss_pred             HHHHHHhhcCCCCe--------eEE--------ecccchhhhhHHHHHHhcccCcccccccccceEEEecCccccCCchh
Confidence            99999999986322        211        12236777888888888888876655    78888899999999999


Q ss_pred             cccccEEEccccHHHHHhhcCCCCCCeEEEecCCCChHHHHHHHhcCCCcEEEEEeCChHHHHHHHHHHHHhCCCceEEE
Q 011036          238 VLEGEIFLQNLPSIVTAHALDPQKGERILDMCAAPGGKTTAIASLLRDEGEVVAVDRSHNKVMDIQKLAAEMGLKCITTY  317 (495)
Q Consensus       238 ~~~G~i~lQ~l~S~v~~~~LdpqpGerVLDmCAaPGgKT~~iA~lm~~~G~ViA~D~s~~kv~~i~~~a~~~gl~~i~~~  317 (495)
                      ++.|.+++|++||++++++|+||||||||||||||||||+|||+||+++|.|+|.|.+++|+..++.++.+||+++..+.
T Consensus       218 ~lag~~~LQ~~sS~Lpv~aL~Pq~gERIlDmcAAPGGKTt~IAalMkn~G~I~AnD~n~~r~~~l~~n~~rlGv~ntiv~  297 (460)
T KOG1122|consen  218 YLAGHYMLQNASSFLPVMALDPQPGERILDMCAAPGGKTTHIAALMKNTGVIFANDSNENRLKSLKANLHRLGVTNTIVS  297 (460)
T ss_pred             hcccceeeccCcccceeeecCCCCCCeecchhcCCCchHHHHHHHHcCCceEEecccchHHHHHHHHHHHHhCCCceEEE
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999988888


Q ss_pred             EcchhHHHHhhCCCCCCCCccCCCCCccccccccccccccccccchhccCCCCCCcccccccccccccccccchhhhhhh
Q 011036          318 KLDALKAVRRKNESNDEPNMCNSKDNNYITSQTSDSMKLHKEVPSIAAEGLNGDKSCKEKVSNEKGVERTYVSKADTRKN  397 (495)
Q Consensus       318 ~~Da~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~k~  397 (495)
                      ++|..+..                                                                        
T Consensus       298 n~D~~ef~------------------------------------------------------------------------  305 (460)
T KOG1122|consen  298 NYDGREFP------------------------------------------------------------------------  305 (460)
T ss_pred             ccCccccc------------------------------------------------------------------------
Confidence            88875420                                                                        


Q ss_pred             hhhccCCCCCCccCCCCccCCCCCCCCCccEEEEcCCCCCCCC--cccchhhhhcHHHHHHhHHHHHHHHHHHHhcCCCC
Q 011036          398 MRRMRNGPGRNQCLGGRAENSKGFSPNSFDRVLLDAPCSALGL--RPRLFAAEETIQSLRNHGKYQRRMFDQAVQLVRPG  475 (495)
Q Consensus       398 ~~~~~~~~~~~~~~~g~~~~~~~f~~~sFDrVLlDaPCSglG~--rp~l~~~~~t~~~l~~~a~~Qrrll~~A~~lLkpG  475 (495)
                                          .+-|++ +||||||||||||+|+  +|.....+++.+++.+++.+||+||.+|+++||+|
T Consensus       306 --------------------~~~~~~-~fDRVLLDAPCSGtgvi~K~~~vkt~k~~~di~~~~~LQr~LllsAi~lv~~G  364 (460)
T KOG1122|consen  306 --------------------EKEFPG-SFDRVLLDAPCSGTGVISKDQSVKTNKTVKDILRYAHLQRELLLSAIDLVKAG  364 (460)
T ss_pred             --------------------ccccCc-ccceeeecCCCCCCcccccccccccchhHHHHHHhHHHHHHHHHHHHhhccCC
Confidence                                013455 9999999999999775  78877768899999999999999999999999999


Q ss_pred             CEEEEEeCCCCCcCcccccC
Q 011036          476 GIIVYSTCTINPGENEALCA  495 (495)
Q Consensus       476 G~LVYSTCTi~p~ENE~vV~  495 (495)
                      |+||||||||+++|||+||+
T Consensus       365 GvLVYSTCSI~~~ENE~vV~  384 (460)
T KOG1122|consen  365 GVLVYSTCSITVEENEAVVD  384 (460)
T ss_pred             cEEEEEeeecchhhhHHHHH
Confidence            99999999999999999984

>COG0144 Sun tRNA and rRNA cytosine-C5-methylases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK11933 yebU rRNA (cytosine-C(5)-)-methyltransferase RsmF; Reviewed Back     alignment and domain information
>PF01189 Nol1_Nop2_Fmu: NOL1/NOP2/sun family; InterPro: IPR001678 This domain is found in archaeal, bacterial and eukaryotic proteins Back     alignment and domain information
>PRK14903 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK14901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>TIGR00563 rsmB ribosomal RNA small subunit methyltransferase RsmB Back     alignment and domain information
>TIGR00446 nop2p NOL1/NOP2/sun family putative RNA methylase Back     alignment and domain information
>PRK14904 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK10901 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>PRK14902 16S rRNA methyltransferase B; Provisional Back     alignment and domain information
>KOG2198 consensus tRNA cytosine-5-methylases and related enzymes of the NOL1/NOP2/sun superfamily [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2360 consensus Proliferation-associated nucleolar protein (NOL1) [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PRK15128 23S rRNA m(5)C1962 methyltransferase; Provisional Back     alignment and domain information
>COG1092 Predicted SAM-dependent methyltransferases [General function prediction only] Back     alignment and domain information
>PF10672 Methyltrans_SAM: S-adenosylmethionine-dependent methyltransferase; InterPro: IPR019614 Members of this entry are S-adenosylmethionine-dependent methyltransferases from gamma-proteobacterial species Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>COG2226 UbiE Methylase involved in ubiquinone/menaquinone biosynthesis [Coenzyme metabolism] Back     alignment and domain information
>PRK00377 cbiT cobalt-precorrin-6Y C(15)-methyltransferase; Provisional Back     alignment and domain information
>PF13659 Methyltransf_26: Methyltransferase domain; PDB: 3GJY_A 3LPM_B 2NP6_D 1AQI_B 2ADM_B 2IH2_A 2JG3_A 2IBS_D 2NP7_A 2IBT_A Back     alignment and domain information
>PF01209 Ubie_methyltran: ubiE/COQ5 methyltransferase family; InterPro: IPR004033 A number of methyltransferases have been shown to share regions of similarities [] Back     alignment and domain information
>TIGR01177 conserved hypothetical protein TIGR01177 Back     alignment and domain information
>PTZ00146 fibrillarin; Provisional Back     alignment and domain information
>PF12847 Methyltransf_18: Methyltransferase domain; PDB: 3G2Q_A 3G2O_A 3G2M_B 3G2P_B 3D2L_B 1IM8_B 3NJR_A 3E05_H 3EVZ_A 3HM2_A Back     alignment and domain information
>PRK14967 putative methyltransferase; Provisional Back     alignment and domain information
>TIGR00080 pimt protein-L-isoaspartate(D-aspartate) O-methyltransferase Back     alignment and domain information
>TIGR00537 hemK_rel_arch HemK-related putative methylase Back     alignment and domain information
>COG2242 CobL Precorrin-6B methylase 2 [Coenzyme metabolism] Back     alignment and domain information
>PF05175 MTS: Methyltransferase small domain; InterPro: IPR007848 This domain is found in ribosomal RNA small subunit methyltransferase C and in other methyltransferases Back     alignment and domain information
>PRK07402 precorrin-6B methylase; Provisional Back     alignment and domain information
>TIGR03704 PrmC_rel_meth putative protein-(glutamine-N5) methyltransferase, unknown substrate-specific Back     alignment and domain information
>PRK04266 fibrillarin; Provisional Back     alignment and domain information
>TIGR03533 L3_gln_methyl protein-(glutamine-N5) methyltransferase, ribosomal protein L3-specific Back     alignment and domain information
>TIGR02469 CbiT precorrin-6Y C5,15-methyltransferase (decarboxylating), CbiT subunit Back     alignment and domain information
>PRK03522 rumB 23S rRNA methyluridine methyltransferase; Reviewed Back     alignment and domain information
>PRK14968 putative methyltransferase; Provisional Back     alignment and domain information
>TIGR02752 MenG_heptapren 2-heptaprenyl-1,4-naphthoquinone methyltransferase Back     alignment and domain information
>TIGR00536 hemK_fam HemK family putative methylases Back     alignment and domain information
>PRK11805 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK13944 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK13942 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PRK09328 N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>TIGR03534 RF_mod_PrmC protein-(glutamine-N5) methyltransferase, release factor-specific Back     alignment and domain information
>PRK13168 rumA 23S rRNA m(5)U1939 methyltransferase; Reviewed Back     alignment and domain information
>PF13847 Methyltransf_31: Methyltransferase domain; PDB: 3T0I_B 3SVZ_B 3SXJ_A 3F4K_A 3GU3_B 2GH1_A 1R8Y_E 1R8X_B 2B3T_A 1T43_A Back     alignment and domain information
>PLN02233 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>PRK11873 arsM arsenite S-adenosylmethyltransferase; Reviewed Back     alignment and domain information
>PRK00121 trmB tRNA (guanine-N(7)-)-methyltransferase; Reviewed Back     alignment and domain information
>TIGR00479 rumA 23S rRNA (uracil-5-)-methyltransferase RumA Back     alignment and domain information
>TIGR00438 rrmJ cell division protein FtsJ Back     alignment and domain information
>PRK00312 pcm protein-L-isoaspartate O-methyltransferase; Reviewed Back     alignment and domain information
>PF08704 GCD14: tRNA methyltransferase complex GCD14 subunit; InterPro: IPR014816 GCD14 is a subunit of the tRNA methyltransferase complex and is required for 1-methyladenosine modification and maturation of initiator methionyl-tRNA [] Back     alignment and domain information
>PRK08287 cobalt-precorrin-6Y C(15)-methyltransferase; Validated Back     alignment and domain information
>COG2265 TrmA SAM-dependent methyltransferases related to tRNA (uracil-5-)-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02244 tocopherol O-methyltransferase Back     alignment and domain information
>PLN02781 Probable caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>PRK00107 gidB 16S rRNA methyltransferase GidB; Reviewed Back     alignment and domain information
>PF01135 PCMT: Protein-L-isoaspartate(D-aspartate) O-methyltransferase (PCMT); InterPro: IPR000682 Protein-L-isoaspartate(D-aspartate) O-methyltransferase (2 Back     alignment and domain information
>PF01472 PUA: PUA domain; InterPro: IPR002478 The PUA (PseudoUridine synthase and Archaeosine transglycosylase) domain was named after the proteins in which it was first found [] Back     alignment and domain information
>COG2519 GCD14 tRNA(1-methyladenosine) methyltransferase and related methyltransferases [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK11188 rrmJ 23S rRNA methyltransferase J; Provisional Back     alignment and domain information
>PRK15001 SAM-dependent 23S ribosomal RNA mG1835 methyltransferase; Provisional Back     alignment and domain information
>PLN02476 O-methyltransferase Back     alignment and domain information
>COG4123 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>COG1041 Predicted DNA modification methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK13943 protein-L-isoaspartate O-methyltransferase; Provisional Back     alignment and domain information
>PF02475 Met_10: Met-10+ like-protein; InterPro: IPR003402 This entry represents the Trm5 family Back     alignment and domain information
>PRK09489 rsmC 16S ribosomal RNA m2G1207 methyltransferase; Provisional Back     alignment and domain information
>TIGR00451 unchar_dom_2 uncharacterized domain 2 Back     alignment and domain information
>PRK14966 unknown domain/N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase fusion protein; Provisional Back     alignment and domain information
>TIGR02085 meth_trns_rumB 23S rRNA (uracil-5-)-methyltransferase RumB Back     alignment and domain information
>PRK11207 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PRK08317 hypothetical protein; Provisional Back     alignment and domain information
>KOG1540 consensus Ubiquinone biosynthesis methyltransferase COQ5 [Coenzyme transport and metabolism] Back     alignment and domain information
>COG2518 Pcm Protein-L-isoaspartate carboxylmethyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK14121 tRNA (guanine-N(7)-)-methyltransferase; Provisional Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>TIGR00138 gidB 16S rRNA methyltransferase GidB Back     alignment and domain information
>TIGR00091 tRNA (guanine-N(7)-)-methyltransferase Back     alignment and domain information
>PRK14560 putative RNA-binding protein; Provisional Back     alignment and domain information
>PF03602 Cons_hypoth95: Conserved hypothetical protein 95; InterPro: IPR004398 This entry contains Ribosomal RNA small subunit methyltransferase D as well as the putative rRNA methyltransferase YlbH Back     alignment and domain information
>PF05958 tRNA_U5-meth_tr: tRNA (Uracil-5-)-methyltransferase; InterPro: IPR010280 This family consists of (uracil-5-)-methyltransferases 2 Back     alignment and domain information
>COG2016 Predicted RNA-binding protein (contains PUA domain) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK04338 N(2),N(2)-dimethylguanosine tRNA methyltransferase; Provisional Back     alignment and domain information
>PTZ00098 phosphoethanolamine N-methyltransferase; Provisional Back     alignment and domain information
>PF08241 Methyltransf_11: Methyltransferase domain; InterPro: IPR013216 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK15451 tRNA cmo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PF01170 UPF0020: Putative RNA methylase family UPF0020; InterPro: IPR000241 This domain is probably a methylase Back     alignment and domain information
>COG2890 HemK Methylase of polypeptide chain release factors [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK05031 tRNA (uracil-5-)-methyltransferase; Validated Back     alignment and domain information
>PRK10909 rsmD 16S rRNA m(2)G966-methyltransferase; Provisional Back     alignment and domain information
>PRK11036 putative S-adenosyl-L-methionine-dependent methyltransferase; Provisional Back     alignment and domain information
>PRK01683 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>PF02353 CMAS: Mycolic acid cyclopropane synthetase; InterPro: IPR003333 This entry represents mycolic acid cyclopropane synthases and related enzymes, including CmaA1, CmaA2 (cyclopropane mycolic acid synthase A1 and A2) and MmaA1-4 (methoxymycolic acid synthase A1-4) Back     alignment and domain information
>TIGR03684 arCOG00985 arCOG04150 universal archaeal PUA-domain protein Back     alignment and domain information
>cd02440 AdoMet_MTases S-adenosylmethionine-dependent methyltransferases (SAM or AdoMet-MTase), class I; AdoMet-MTases are enzymes that use S-adenosyl-L-methionine (SAM or AdoMet) as a substrate for methyltransfer, creating the product S-adenosyl-L-homocysteine (AdoHcy) Back     alignment and domain information
>PLN02396 hexaprenyldihydroxybenzoate methyltransferase Back     alignment and domain information
>TIGR00308 TRM1 tRNA(guanine-26,N2-N2) methyltransferase Back     alignment and domain information
>PRK14103 trans-aconitate 2-methyltransferase; Provisional Back     alignment and domain information
>COG0742 N6-adenine-specific methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>TIGR02143 trmA_only tRNA (uracil-5-)-methyltransferase Back     alignment and domain information
>TIGR00095 RNA methyltransferase, RsmD family Back     alignment and domain information
>COG4122 Predicted O-methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR00477 tehB tellurite resistance protein TehB Back     alignment and domain information
>PRK10258 biotin biosynthesis protein BioC; Provisional Back     alignment and domain information
>COG2520 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR00406 prmA ribosomal protein L11 methyltransferase Back     alignment and domain information
>PF13649 Methyltransf_25: Methyltransferase domain; PDB: 3BXO_B 3GGD_A 3PX2_A 3PX3_A 3PFH_D 3PFG_A 1Y8C_A Back     alignment and domain information
>PRK00216 ubiE ubiquinone/menaquinone biosynthesis methyltransferase; Reviewed Back     alignment and domain information
>PRK11705 cyclopropane fatty acyl phospholipid synthase; Provisional Back     alignment and domain information
>COG2813 RsmC 16S RNA G1207 methylase RsmC [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF01596 Methyltransf_3: O-methyltransferase; InterPro: IPR002935 Members of this family are O-methyltransferases Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>PHA03412 putative methyltransferase; Provisional Back     alignment and domain information
>PHA03411 putative methyltransferase; Provisional Back     alignment and domain information
>COG2227 UbiG 2-polyprenyl-3-methyl-5-hydroxy-6-metoxy-1,4-benzoquinol methylase [Coenzyme metabolism] Back     alignment and domain information
>PF01728 FtsJ: FtsJ-like methyltransferase; InterPro: IPR002877 RrmJ (FtsJ) is a well conserved heat shock protein present in prokaryotes, archaea, and eukaryotes Back     alignment and domain information
>COG2230 Cfa Cyclopropane fatty acid synthase and related methyltransferases [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR00740 methyltransferase, putative Back     alignment and domain information
>PRK12335 tellurite resistance protein TehB; Provisional Back     alignment and domain information
>PRK06922 hypothetical protein; Provisional Back     alignment and domain information
>PRK00517 prmA ribosomal protein L11 methyltransferase; Reviewed Back     alignment and domain information
>PRK13795 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01934 MenG_MenH_UbiE ubiquinone/menaquinone biosynthesis methyltransferases Back     alignment and domain information
>smart00828 PKS_MT Methyltransferase in polyketide synthase (PKS) enzymes Back     alignment and domain information
>COG0293 FtsJ 23S rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2915 consensus tRNA(1-methyladenosine) methyltransferase, subunit GCD14 [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK15068 tRNA mo(5)U34 methyltransferase; Provisional Back     alignment and domain information
>PLN03075 nicotianamine synthase; Provisional Back     alignment and domain information
>PLN02490 MPBQ/MSBQ methyltransferase Back     alignment and domain information
>PLN02672 methionine S-methyltransferase Back     alignment and domain information
>PLN02589 caffeoyl-CoA O-methyltransferase Back     alignment and domain information
>TIGR00452 methyltransferase, putative Back     alignment and domain information
>smart00650 rADc Ribosomal RNA adenine dimethylases Back     alignment and domain information
>KOG2904 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PF09445 Methyltransf_15: RNA cap guanine-N2 methyltransferase; InterPro: IPR019012 RNA cap guanine-N2 methyltransferases such as Schizosaccharomyces pombe (Fission yeast) trimethylguanosine synthase (Tgs1) and Giardia lamblia (Giardia intestinalis) Tgs2, catalyse the methylation step(s) for the conversion of the 7-monomethylguanosine (m(7)G) caps of snRNAs and snoRNAs to a 2,2,7-trimethylguanosine (m(2,2,7)G) cap structure [, , ] Back     alignment and domain information
>PRK04457 spermidine synthase; Provisional Back     alignment and domain information
>COG2263 Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR01983 UbiG ubiquinone biosynthesis O-methyltransferase Back     alignment and domain information
>PRK05134 bifunctional 3-demethylubiquinone-9 3-methyltransferase/ 2-octaprenyl-6-hydroxy phenol methylase; Provisional Back     alignment and domain information
>COG2521 Predicted archaeal methyltransferase [General function prediction only] Back     alignment and domain information
>PRK13534 7-cyano-7-deazaguanine tRNA-ribosyltransferase; Provisional Back     alignment and domain information
>PRK00050 16S rRNA m(4)C1402 methyltranserfase; Provisional Back     alignment and domain information
>TIGR02072 BioC biotin biosynthesis protein BioC Back     alignment and domain information
>TIGR02716 C20_methyl_CrtF C-20 methyltransferase BchU Back     alignment and domain information
>PLN02336 phosphoethanolamine N-methyltransferase Back     alignment and domain information
>KOG1271 consensus Methyltransferases [General function prediction only] Back     alignment and domain information
>KOG1663 consensus O-methyltransferase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK13794 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03438 probable methyltransferase Back     alignment and domain information
>TIGR00417 speE spermidine synthase Back     alignment and domain information
>TIGR02021 BchM-ChlM magnesium protoporphyrin O-methyltransferase Back     alignment and domain information
>COG2264 PrmA Ribosomal protein L11 methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK11088 rrmA 23S rRNA methyltransferase A; Provisional Back     alignment and domain information
>PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB Back     alignment and domain information
>PF02384 N6_Mtase: N-6 DNA Methylase; InterPro: IPR003356 This domain is fpound in N-6 adenine-specific DNA methylase (2 Back     alignment and domain information
>PF02390 Methyltransf_4: Putative methyltransferase ; InterPro: IPR003358 This entry represents tRNA (guanine-N-7) methyltransferase (2 Back     alignment and domain information
>PF08242 Methyltransf_12: Methyltransferase domain; InterPro: IPR013217 Methyl transfer from the ubiquitous donor S-adenosyl-L-methionine (SAM) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PRK00811 spermidine synthase; Provisional Back     alignment and domain information
>smart00138 MeTrc Methyltransferase, chemotaxis proteins Back     alignment and domain information
>PF06325 PrmA: Ribosomal protein L11 methyltransferase (PrmA); InterPro: IPR010456 This family consists of several Ribosomal protein L11 methyltransferase sequences Back     alignment and domain information
>TIGR03840 TMPT_Se_Te thiopurine S-methyltransferase, Se/Te detoxification family Back     alignment and domain information
>PF05401 NodS: Nodulation protein S (NodS); InterPro: IPR008715 This entry consists of nodulation S (NodS) proteins Back     alignment and domain information
>PF13489 Methyltransf_23: Methyltransferase domain; PDB: 3JWJ_A 3JWH_B 2AOV_B 2AOT_A 1JQD_B 2AOX_A 1JQE_A 2AOU_B 2AOW_A 3DLI_C Back     alignment and domain information
>PRK10742 putative methyltransferase; Provisional Back     alignment and domain information
>PF01269 Fibrillarin: Fibrillarin; InterPro: IPR000692 Fibrillarin is a component of a nucleolar small nuclear ribonucleoprotein (SnRNP), functioning in vivo in ribosomal RNA processing [, ] Back     alignment and domain information
>PRK01581 speE spermidine synthase; Validated Back     alignment and domain information
>COG0220 Predicted S-adenosylmethionine-dependent methyltransferase [General function prediction only] Back     alignment and domain information
>PRK03612 spermidine synthase; Provisional Back     alignment and domain information
>KOG1270 consensus Methyltransferases [Coenzyme transport and metabolism] Back     alignment and domain information
>PRK06202 hypothetical protein; Provisional Back     alignment and domain information
>PLN02366 spermidine synthase Back     alignment and domain information
>PRK05785 hypothetical protein; Provisional Back     alignment and domain information
>TIGR03587 Pse_Me-ase pseudaminic acid biosynthesis-associated methylase Back     alignment and domain information
>PTZ00338 dimethyladenosine transferase-like protein; Provisional Back     alignment and domain information
>KOG2187 consensus tRNA uracil-5-methyltransferase and related tRNA-modifying enzymes [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>smart00359 PUA Putative RNA-binding Domain in PseudoUridine synthase and Archaeosine transglycosylase Back     alignment and domain information
>PRK07580 Mg-protoporphyrin IX methyl transferase; Validated Back     alignment and domain information
>COG4106 Tam Trans-aconitate methyltransferase [General function prediction only] Back     alignment and domain information
>KOG0024 consensus Sorbitol dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PF07021 MetW: Methionine biosynthesis protein MetW; InterPro: IPR010743 This family consists of several bacterial and one archaeal methionine biosynthesis MetW proteins Back     alignment and domain information
>PRK14896 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Provisional Back     alignment and domain information
>PRK13255 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>COG5270 PUA domain (predicted RNA-binding domain) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02585 magnesium protoporphyrin IX methyltransferase Back     alignment and domain information
>PF03291 Pox_MCEL: mRNA capping enzyme; InterPro: IPR004971 This is a family of viral mRNA capping enzymes Back     alignment and domain information
>PRK11727 23S rRNA mA1618 methyltransferase; Provisional Back     alignment and domain information
>TIGR02987 met_A_Alw26 type II restriction m6 adenine DNA methyltransferase, Alw26I/Eco31I/Esp3I family Back     alignment and domain information
>COG0116 Predicted N6-adenine-specific DNA methylase [DNA replication, recombination, and repair] Back     alignment and domain information
>PRK00274 ksgA 16S ribosomal RNA methyltransferase KsgA/Dim1 family protein; Reviewed Back     alignment and domain information
>PRK01544 bifunctional N5-glutamine S-adenosyl-L-methionine-dependent methyltransferase/tRNA (m7G46) methyltransferase; Reviewed Back     alignment and domain information
>KOG4589 consensus Cell division protein FtsJ [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR00006 S-adenosyl-methyltransferase MraW Back     alignment and domain information
>PF02527 GidB: rRNA small subunit methyltransferase G; InterPro: IPR003682 This entry represents a rRNA small subunit methyltransferase G Back     alignment and domain information
>PF01861 DUF43: Protein of unknown function DUF43; InterPro: IPR002723 This family of prokaryotic proteins have not been characterised Back     alignment and domain information
>KOG1098 consensus Putative SAM-dependent rRNA methyltransferase SPB1 [RNA processing and modification; General function prediction only] Back     alignment and domain information
>PF12147 Methyltransf_20: Putative methyltransferase; InterPro: IPR022744 This C-terminal region is found in bacteria and eukaryotes and is approximately 110 amino acids in length Back     alignment and domain information
>KOG1099 consensus SAM-dependent methyltransferase/cell division protein FtsJ [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>PF08003 Methyltransf_9: Protein of unknown function (DUF1698); InterPro: IPR010017 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>KOG1596 consensus Fibrillarin and related nucleolar RNA-binding proteins [RNA processing and modification] Back     alignment and domain information
>TIGR00755 ksgA dimethyladenosine transferase Back     alignment and domain information
>PRK11783 rlmL 23S rRNA m(2)G2445 methyltransferase; Provisional Back     alignment and domain information
>KOG3420 consensus Predicted RNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG3191 consensus Predicted N6-DNA-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PLN02823 spermine synthase Back     alignment and domain information
>KOG2899 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>COG0357 GidB Predicted S-adenosylmethionine-dependent methyltransferase involved in bacterial cell division [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR02081 metW methionine biosynthesis protein MetW Back     alignment and domain information
>COG1889 NOP1 Fibrillarin-like rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>TIGR00432 arcsn_tRNA_tgt tRNA-guanine transglycosylase, archaeosine-15-forming Back     alignment and domain information
>PF02005 TRM: N2,N2-dimethylguanosine tRNA methyltransferase; InterPro: IPR002905 This enzyme 2 Back     alignment and domain information
>PRK13256 thiopurine S-methyltransferase; Reviewed Back     alignment and domain information
>PRK05429 gamma-glutamyl kinase; Provisional Back     alignment and domain information
>KOG1253 consensus tRNA methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1975 consensus mRNA cap methyltransferase [RNA processing and modification] Back     alignment and domain information
>PF13578 Methyltransf_24: Methyltransferase domain; PDB: 3SSO_A 3SSN_C 3SSM_D Back     alignment and domain information
>PF01564 Spermine_synth: Spermine/spermidine synthase; InterPro: IPR001045 Synonym(s): Spermidine aminopropyltransferase A group of polyamine biosynthetic enzymes involved in the fifth (last) step in the biosynthesis of spermidine from arginine and methionine which includes; spermidine synthase (2 Back     alignment and domain information
>PF05185 PRMT5: PRMT5 arginine-N-methyltransferase; InterPro: IPR007857 The human homologue of Saccharomyces cerevisiae Skb1 (Shk1 kinase-binding protein 1) is a protein methyltransferase [] Back     alignment and domain information
>COG0286 HsdM Type I restriction-modification system methyltransferase subunit [Defense mechanisms] Back     alignment and domain information
>PF01795 Methyltransf_5: MraW methylase family; InterPro: IPR002903 This is a family of S-adenosyl-L-methionine-dependent methyltransferases, which are found primarily, though not exclusively, in bacteria Back     alignment and domain information
>PLN02232 ubiquinone biosynthesis methyltransferase Back     alignment and domain information
>COG0030 KsgA Dimethyladenosine transferase (rRNA methylation) [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG2523 consensus Predicted RNA-binding protein with PUA domain [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1661 consensus Protein-L-isoaspartate(D-aspartate) O-methyltransferase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2671 consensus Putative RNA methylase [Replication, recombination and repair] Back     alignment and domain information
>KOG1541 consensus Predicted protein carboxyl methylase [General function prediction only] Back     alignment and domain information
>PRK04270 H/ACA RNA-protein complex component Cbf5p; Reviewed Back     alignment and domain information
>KOG2361 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>COG0275 Predicted S-adenosylmethionine-dependent methyltransferase involved in cell envelope biogenesis [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK11760 putative 23S rRNA C2498 ribose 2'-O-ribose methyltransferase; Provisional Back     alignment and domain information
>PF05219 DREV: DREV methyltransferase; InterPro: IPR007884 This family contains DREV protein homologues from several eukaryotes Back     alignment and domain information
>PF00891 Methyltransf_2: O-methyltransferase; InterPro: IPR001077 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>KOG2730 consensus Methylase [General function prediction only] Back     alignment and domain information
>TIGR00425 CBF5 rRNA pseudouridine synthase, putative Back     alignment and domain information
>PF06080 DUF938: Protein of unknown function (DUF938); InterPro: IPR010342 This family consists of several hypothetical proteins from both prokaryotes and eukaryotes Back     alignment and domain information
>PF10294 Methyltransf_16: Putative methyltransferase; InterPro: IPR019410 There are a number of unidentified genes that have a high probability of coding for methyltransferases Back     alignment and domain information
>TIGR00478 tly hemolysin TlyA family protein Back     alignment and domain information
>TIGR01027 proB glutamate 5-kinase Back     alignment and domain information
>COG3963 Phospholipid N-methyltransferase [Lipid metabolism] Back     alignment and domain information
>COG1370 Prefoldin, molecular chaperone implicated in de novo protein folding, alpha subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG1064 AdhP Zn-dependent alcohol dehydrogenases [General function prediction only] Back     alignment and domain information
>COG0421 SpeE Spermidine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>COG1867 TRM1 N2,N2-dimethylguanosine tRNA methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>COG3897 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR01444 fkbM_fam methyltransferase, FkbM family Back     alignment and domain information
>COG4976 Predicted methyltransferase (contains TPR repeat) [General function prediction only] Back     alignment and domain information
>PF00398 RrnaAD: Ribosomal RNA adenine dimethylase; InterPro: IPR001737 This family of proteins include rRNA adenine dimethylases (e Back     alignment and domain information
>TIGR03439 methyl_EasF probable methyltransferase domain, EasF family Back     alignment and domain information
>COG1549 Queuine tRNA-ribosyltransferases, contain PUA domain [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1499 consensus Protein arginine N-methyltransferase PRMT1 and related enzymes [Posttranslational modification, protein turnover, chaperones; Transcription; Signal transduction mechanisms] Back     alignment and domain information
>PRK10611 chemotaxis methyltransferase CheR; Provisional Back     alignment and domain information
>COG4076 Predicted RNA methylase [General function prediction only] Back     alignment and domain information
>PF05724 TPMT: Thiopurine S-methyltransferase (TPMT); InterPro: IPR008854 This family consists of thiopurine S-methyltransferase proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>PF13679 Methyltransf_32: Methyltransferase domain Back     alignment and domain information
>COG0500 SmtA SAM-dependent methyltransferases [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>PF01234 NNMT_PNMT_TEMT: NNMT/PNMT/TEMT family; InterPro: IPR000940 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>cd00315 Cyt_C5_DNA_methylase Cytosine-C5 specific DNA methylases; Methyl transfer reactions play an important role in many aspects of biology Back     alignment and domain information
>PF04445 SAM_MT: Putative SAM-dependent methyltransferase; InterPro: IPR007536 This family of proteins is functionally uncharacterised Back     alignment and domain information
>KOG3010 consensus Methyltransferase [General function prediction only] Back     alignment and domain information
>TIGR00497 hsdM type I restriction system adenine methylase (hsdM) Back     alignment and domain information
>KOG2782 consensus Putative SAM dependent methyltransferases [General function prediction only] Back     alignment and domain information
>KOG0820 consensus Ribosomal RNA adenine dimethylase [RNA processing and modification] Back     alignment and domain information
>PRK04148 hypothetical protein; Provisional Back     alignment and domain information
>KOG4300 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>COG1189 Predicted rRNA methylase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF01739 CheR: CheR methyltransferase, SAM binding domain; InterPro: IPR022642 Methyl transfer from the ubiquitous S-adenosyl-L-methionine (AdoMet) to either nitrogen, oxygen or carbon atoms is frequently employed in diverse organisms ranging from bacteria to plants and mammals Back     alignment and domain information
>PF10354 DUF2431: Domain of unknown function (DUF2431); InterPro: IPR019446 This entry represents the N-terminal domain of a family of proteins whose function is not known Back     alignment and domain information
>PRK11524 putative methyltransferase; Provisional Back     alignment and domain information
>PF00107 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: IPR013149 Alcohol dehydrogenase (1 Back     alignment and domain information
>COG1063 Tdh Threonine dehydrogenase and related Zn-dependent dehydrogenases [Amino acid transport and metabolism / General function prediction only] Back     alignment and domain information
>COG1568 Predicted methyltransferases [General function prediction only] Back     alignment and domain information
>PF06962 rRNA_methylase: Putative rRNA methylase; InterPro: IPR010719 This family contains a number of putative rRNA methylases Back     alignment and domain information
>KOG1227 consensus Putative methyltransferase [General function prediction only] Back     alignment and domain information
>PF09243 Rsm22: Mitochondrial small ribosomal subunit Rsm22; InterPro: IPR015324 Ribosomes are the particles that catalyse mRNA-directed protein synthesis in all organisms Back     alignment and domain information
>PRK00536 speE spermidine synthase; Provisional Back     alignment and domain information
>PRK13402 gamma-glutamyl kinase; Provisional Back     alignment and domain information
>PRK09880 L-idonate 5-dehydrogenase; Provisional Back     alignment and domain information
>KOG1500 consensus Protein arginine N-methyltransferase CARM1 [Posttranslational modification, protein turnover, chaperones; Transcription] Back     alignment and domain information
>PRK13699 putative methylase; Provisional Back     alignment and domain information
>TIGR02822 adh_fam_2 zinc-binding alcohol dehydrogenase family protein Back     alignment and domain information
>PF08123 DOT1: Histone methylation protein DOT1 ; InterPro: IPR013110 The DOT1 domain regulates gene expression by methylating histone H3 [] Back     alignment and domain information
>PF05148 Methyltransf_8: Hypothetical methyltransferase; InterPro: IPR007823 This family consists of uncharacterised eukaryotic proteins which are related to S-adenosyl-L-methionine-dependent methyltransferases Back     alignment and domain information
>PF04816 DUF633: Family of unknown function (DUF633) ; InterPro: IPR006901 This is a family of uncharacterised bacterial proteins Back     alignment and domain information
>PF00145 DNA_methylase: C-5 cytosine-specific DNA methylase; InterPro: IPR001525 C-5 cytosine-specific DNA methylases (2 Back     alignment and domain information
>COG4798 Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>cd08283 FDH_like_1 Glutathione-dependent formaldehyde dehydrogenase related proteins, child 1 Back     alignment and domain information
>PF01555 N6_N4_Mtase: DNA methylase; InterPro: IPR002941 This domain is found in DNA methylases Back     alignment and domain information
>PF05891 Methyltransf_PK: AdoMet dependent proline di-methyltransferase; InterPro: IPR008576 This family consists of several eukaryotic proteins of unknown function that are S-adenosyl-L-methionine-dependent methyltransferase-like Back     alignment and domain information
>COG1352 CheR Methylase of chemotaxis methyl-accepting proteins [Cell motility and secretion / Signal transduction mechanisms] Back     alignment and domain information
>TIGR03451 mycoS_dep_FDH mycothiol-dependent formaldehyde dehydrogenase Back     alignment and domain information
>KOG1709 consensus Guanidinoacetate methyltransferase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF11599 AviRa: RRNA methyltransferase AviRa; InterPro: IPR024268 This family of proteins includes the methyltransferase AviRa from Streptomyces viridochromogenes Back     alignment and domain information
>PRK11524 putative methyltransferase; Provisional Back     alignment and domain information
>PF04989 CmcI: Cephalosporin hydroxylase; InterPro: IPR007072 This entry contains Rhamnosyl O-methyltransferase which catalyses the O-methylation of the hydroxyl group located on C-2 of the first rhamnosyl residue linked to the phenolic group of glycosylated phenolphthiocerol dimycocerosates (PGL) and p-hydroxybenzoic acid derivatives (p-HBAD) [] Back     alignment and domain information
>PRK07102 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03366 HpnZ_proposed putative phosphonate catabolism associated alcohol dehydrogenase Back     alignment and domain information
>TIGR02825 B4_12hDH leukotriene B4 12-hydroxydehydrogenase/15-oxo-prostaglandin 13-reductase Back     alignment and domain information
>cd08239 THR_DH_like L-threonine dehydrogenase (TDH)-like Back     alignment and domain information
>KOG2078 consensus tRNA modification enzyme [RNA processing and modification] Back     alignment and domain information
>cd08281 liver_ADH_like1 Zinc-dependent alcohol dehydrogenases (ADH) and class III ADG (AKA formaldehyde dehydrogenase) Back     alignment and domain information
>PRK10309 galactitol-1-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PF03141 Methyltransf_29: Putative S-adenosyl-L-methionine-dependent methyltransferase; InterPro: IPR004159 Members of this family of hypothetical plant proteins are putative methyltransferases Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>TIGR03201 dearomat_had 6-hydroxycyclohex-1-ene-1-carbonyl-CoA dehydrogenase Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PF03059 NAS: Nicotianamine synthase protein; InterPro: IPR004298 Nicotianamine synthase 2 Back     alignment and domain information
>PRK13699 putative methylase; Provisional Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1197 consensus Predicted quinone oxidoreductase [Energy production and conversion; General function prediction only] Back     alignment and domain information
>cd08230 glucose_DH Glucose dehydrogenase Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd08294 leukotriene_B4_DH_like 13-PGR is a bifunctional enzyme with delta-13 15-prostaglandin reductase and leukotriene B4 12 hydroxydehydrogenase activity Back     alignment and domain information
>PRK09424 pntA NAD(P) transhydrogenase subunit alpha; Provisional Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK07677 short chain dehydrogenase; Provisional Back     alignment and domain information
>PHA01634 hypothetical protein Back     alignment and domain information
>PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06101 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK01747 mnmC bifunctional tRNA (mnm(5)s(2)U34)-methyltransferase/FAD-dependent cmnm(5)s(2)U34 oxidoreductase; Reviewed Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02740 Alcohol dehydrogenase-like Back     alignment and domain information
>PF05971 Methyltransf_10: Protein of unknown function (DUF890); InterPro: IPR010286 This family consists of several conserved hypothetical proteins from both eukaryotes and prokaryotes Back     alignment and domain information
>cd08295 double_bond_reductase_like Arabidopsis alkenal double bond reductase and leukotriene B4 12-hydroxydehydrogenase Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02827 Alcohol dehydrogenase-like Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG0023 consensus Alcohol dehydrogenase, class V [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG1331 consensus Predicted methyltransferase [General function prediction only] Back     alignment and domain information
>PRK08324 short chain dehydrogenase; Validated Back     alignment and domain information
>COG0263 ProB Glutamate 5-kinase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08085 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>KOG3115 consensus Methyltransferase-like protein [General function prediction only] Back     alignment and domain information
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>KOG1269 consensus SAM-dependent methyltransferases [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>PRK08251 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>PRK12937 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08643 acetoin reductase; Validated Back     alignment and domain information
>PF10237 N6-adenineMlase: Probable N6-adenine methyltransferase; InterPro: IPR019369 This family of proteins, which are of approximately 200 residues in length, contain a highly conserved Glu-Phe-Trp (QFW) motif close to the N terminus and an Asp/Asn-Pro-Pro-Tyr/Phe motif in the centre Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>cd08254 hydroxyacyl_CoA_DH 6-hydroxycyclohex-1-ene-1-carboxyl-CoA dehydrogenase, N-benzyl-3-pyrrolidinol dehydrogenase, and other MDR family members Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query495
2yxl_A450 Crystal Structure Of Ph0851 Length = 450 2e-11
2yxl_A450 Crystal Structure Of Ph0851 Length = 450 3e-07
2b9e_A309 Human Nsun5 Protein Length = 309 1e-10
2frx_A 479 Crystal Structure Of Yebu, A M5c Rna Methyltransfer 2e-10
3a4t_A274 Crystal Structure Of Atrm4 From M.Jannaschii With S 6e-09
3a4t_A274 Crystal Structure Of Atrm4 From M.Jannaschii With S 4e-05
3m6w_A 464 Multi-Site-Specific 16s Rrna Methyltransferase Rsmf 8e-09
3m6u_A 464 Multi-Site-Specific 16s Rrna Methyltransferase Rsmf 9e-09
3m6x_A 464 Multi-Site-Specific 16s Rrna Methyltransferase Rsmf 2e-08
1ixk_A315 Crystal Structure Analysis Of Methyltransferase Hom 3e-08
1ixk_A315 Crystal Structure Analysis Of Methyltransferase Hom 1e-07
1sqf_A429 The Crystal Structure Of E. Coli Fmu Binary Complex 7e-07
1sqf_A429 The Crystal Structure Of E. Coli Fmu Binary Complex 1e-05
3m4x_A 456 Structure Of A Ribosomal Methyltransferase Length = 2e-05
>pdb|2YXL|A Chain A, Crystal Structure Of Ph0851 Length = 450 Back     alignment and structure 
Iteration: 1

 Score = 67.0 bits (162), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 32/85 (37%), Positives = 52/85 (61%)
Query: 240 EGEIFLQNLPSIVTAHALDPQKGERILDMCAAPGGKTTAIASLLRDEGEVVAVDRSHNKV 299
           EG+I +Q   S V +  LDP+ GE ++D+ AAPGGKTT +A L++++G++ A D    ++
Sbjct: 238 EGKIIVQEEASAVASIVLDPKPGETVVDLAAAPGGKTTHLAELMKNKGKIYAFDVDKMRM 297
Query: 300 MDIQKLAAEMGLKCITTYKLDALKA 324
             ++     MG+K +     DA KA
Sbjct: 298 KRLKDFVKRMGIKIVKPLVKDARKA 322
>pdb|2YXL|A Chain A, Crystal Structure Of Ph0851 Length = 450 Back     alignment and structure
>pdb|2B9E|A Chain A, Human Nsun5 Protein Length = 309 Back     alignment and structure
>pdb|2FRX|A Chain A, Crystal Structure Of Yebu, A M5c Rna Methyltransferase From E.Coli Length = 479 Back     alignment and structure
>pdb|3A4T|A Chain A, Crystal Structure Of Atrm4 From M.Jannaschii With Sinefungin Length = 274 Back     alignment and structure
>pdb|3A4T|A Chain A, Crystal Structure Of Atrm4 From M.Jannaschii With Sinefungin Length = 274 Back     alignment and structure
>pdb|3M6W|A Chain A, Multi-Site-Specific 16s Rrna Methyltransferase Rsmf From Thermus Thermophilus In Space Group P21212 In Complex With S-Adenosyl-L- Methionine Length = 464 Back     alignment and structure
>pdb|3M6U|A Chain A, Multi-Site-Specific 16s Rrna Methyltransferase Rsmf From Thermus Thermophilus In Space Group 43 Length = 464 Back     alignment and structure
>pdb|3M6X|A Chain A, Multi-Site-Specific 16s Rrna Methyltransferase Rsmf From Thermus Thermophilus In Space Group P21212 Length = 464 Back     alignment and structure
>pdb|1IXK|A Chain A, Crystal Structure Analysis Of Methyltransferase Homolog Protein From Pyrococcus Horikoshii Length = 315 Back     alignment and structure
>pdb|1IXK|A Chain A, Crystal Structure Analysis Of Methyltransferase Homolog Protein From Pyrococcus Horikoshii Length = 315 Back     alignment and structure
>pdb|1SQF|A Chain A, The Crystal Structure Of E. Coli Fmu Binary Complex With S- Adenosylmethionine At 2.1 A Resolution Length = 429 Back     alignment and structure
>pdb|1SQF|A Chain A, The Crystal Structure Of E. Coli Fmu Binary Complex With S- Adenosylmethionine At 2.1 A Resolution Length = 429 Back     alignment and structure
>pdb|3M4X|A Chain A, Structure Of A Ribosomal Methyltransferase Length = 456 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query495
2b9e_A309 NOL1/NOP2/SUN domain family, member 5 isoform 2; m 2e-29
2b9e_A309 NOL1/NOP2/SUN domain family, member 5 isoform 2; m 2e-16
2yxl_A450 PH0851 protein, 450AA long hypothetical FMU protei 3e-29
2yxl_A450 PH0851 protein, 450AA long hypothetical FMU protei 7e-22
2yxl_A450 PH0851 protein, 450AA long hypothetical FMU protei 6e-05
3ajd_A274 Putative methyltransferase MJ0026; tRNA, M5C, ross 3e-26
3ajd_A274 Putative methyltransferase MJ0026; tRNA, M5C, ross 3e-21
1ixk_A315 Methyltransferase; open beta sheet; 1.90A {Pyrococ 6e-25
1ixk_A315 Methyltransferase; open beta sheet; 1.90A {Pyrococ 2e-20
1ixk_A315 Methyltransferase; open beta sheet; 1.90A {Pyrococ 4e-05
3m6w_A 464 RRNA methylase; rRNA methyltransferase, 5-methylcy 6e-24
3m6w_A 464 RRNA methylase; rRNA methyltransferase, 5-methylcy 4e-20
1sqg_A429 SUN protein, FMU protein; rossmann-fold, mixed bet 2e-23
1sqg_A429 SUN protein, FMU protein; rossmann-fold, mixed bet 1e-21
3m4x_A 456 NOL1/NOP2/SUN family protein; mtase domain, PUA do 5e-23
3m4x_A 456 NOL1/NOP2/SUN family protein; mtase domain, PUA do 5e-20
2frx_A 479 Hypothetical protein YEBU; rossmann-type S-adenosy 8e-22
2frx_A 479 Hypothetical protein YEBU; rossmann-type S-adenosy 5e-20
3zv0_C195 H/ACA ribonucleoprotein complex subunit 4; cell cy 1e-08
3d79_A179 PUA domain, putative uncharacterized protein PH073 1e-06
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 4e-06
3gu3_A284 Methyltransferase; alpha-beta protein, structural 5e-06
3bkx_A275 SAM-dependent methyltransferase; YP_807781.1, cycl 7e-06
1q7h_A153 Conserved hypothetical protein; structural genomic 9e-06
3mgg_A276 Methyltransferase; NYSGXRC, PSI-II, protein struct 2e-05
3dh0_A219 SAM dependent methyltransferase; cystal structure, 1e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
3ocj_A305 Putative exported protein; structural genomics, PS 2e-04
1xxl_A239 YCGJ protein; structural genomics, protein structu 3e-04
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 5e-04
>2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38 Length = 309 Back     alignment and structure
 Score =  116 bits (293), Expect = 2e-29
 Identities = 33/154 (21%), Positives = 62/154 (40%), Gaps = 5/154 (3%)

Query: 179 ITRGTVLQGSQTDPYYFERSGLYIGQGTAM--MSRAGIFRASEGIAVDMHNRIFQLPSFY 236
                V+   +   + ++     +    A+            E +       + + P + 
Sbjct: 21  TCSDDVVDYFKRQGFSYQGRASSLDDLRALKGKHFLLDPLMPELLVFPAQTDLHEHPLY- 79

Query: 237 DVLEGEIFLQNLPSIVTAHALDPQKGERILDMCAAPGGKTTAIASLLRDEGEVVAVDRSH 296
               G + LQ+  S + A  LDP  G  ++D CAAPG KT+ +A+LL+++G++ A D   
Sbjct: 80  --RAGHLILQDRASCLPAMLLDPPPGSHVIDACAAPGNKTSHLAALLKNQGKIFAFDLDA 137

Query: 297 NKVMDIQKLAAEMGLKCITTYKLDALKAVRRKNE 330
            ++  +  L A  G+ C    + D L        
Sbjct: 138 KRLASMATLLARAGVSCCELAEEDFLAVSPSDPR 171
>2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38 Length = 309 Back     alignment and structure
>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} Length = 450 Back     alignment and structure
>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} Length = 450 Back     alignment and structure
>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} Length = 450 Back     alignment and structure
>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A Length = 274 Back     alignment and structure
>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A Length = 274 Back     alignment and structure
>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 Length = 315 Back     alignment and structure
>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 Length = 315 Back     alignment and structure
>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 Length = 315 Back     alignment and structure
>3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* Length = 464 Back     alignment and structure
>3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* Length = 464 Back     alignment and structure
>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A Length = 429 Back     alignment and structure
>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A Length = 429 Back     alignment and structure
>3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} Length = 456 Back     alignment and structure
>3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} Length = 456 Back     alignment and structure
>2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} Length = 479 Back     alignment and structure
>2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} Length = 479 Back     alignment and structure
>3zv0_C H/ACA ribonucleoprotein complex subunit 4; cell cycle, RNP assembly, X-linked dyskeratosis congenita; 2.80A {Saccharomyces cerevisiae} Length = 195 Back     alignment and structure
>3d79_A PUA domain, putative uncharacterized protein PH0734; unknown function; 1.73A {Pyrococcus horikoshii} Length = 179 Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Length = 178 Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} PDB: 2gh1_A Length = 284 Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Length = 275 Back     alignment and structure
>1q7h_A Conserved hypothetical protein; structural genomics, MCSG, PSI, PR structure initiative; 2.10A {Thermoplasma acidophilum dsm 1728} SCOP: b.122.1.1 d.17.6.2 Length = 153 Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Length = 276 Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Length = 219 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Length = 305 Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Length = 239 Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Length = 197 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query495
4fzv_A359 Putative methyltransferase NSUN4; mterf fold, meth 100.0
3m4x_A 456 NOL1/NOP2/SUN family protein; mtase domain, PUA do 100.0
2frx_A 479 Hypothetical protein YEBU; rossmann-type S-adenosy 100.0
3m6w_A 464 RRNA methylase; rRNA methyltransferase, 5-methylcy 100.0
1ixk_A315 Methyltransferase; open beta sheet; 1.90A {Pyrococ 100.0
2b9e_A309 NOL1/NOP2/SUN domain family, member 5 isoform 2; m 100.0
2yxl_A450 PH0851 protein, 450AA long hypothetical FMU protei 100.0
1sqg_A429 SUN protein, FMU protein; rossmann-fold, mixed bet 100.0
3ajd_A274 Putative methyltransferase MJ0026; tRNA, M5C, ross 100.0
4dmg_A393 Putative uncharacterized protein TTHA1493; rRNA, m 99.76
1wxx_A382 TT1595, hypothetical protein TTHA1280; thermus the 99.71
3id6_C232 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 99.7
2as0_A396 Hypothetical protein PH1915; RNA methyltransferase 99.7
3v97_A703 Ribosomal RNA large subunit methyltransferase L; Y 99.69
3c0k_A396 UPF0064 protein YCCW; PUA domain, adoMet dependent 99.67
2b78_A385 Hypothetical protein SMU.776; structure genomics, 99.64
2igt_A332 SAM dependent methyltransferase; alpha-beta sandwi 99.62
3axs_A 392 Probable N(2),N(2)-dimethylguanosine tRNA methylt 99.58
1i1n_A226 Protein-L-isoaspartate O-methyltransferase; S-aden 99.54
2dul_A378 N(2),N(2)-dimethylguanosine tRNA methyltransferas; 99.53
3tma_A354 Methyltransferase; thump domain; 2.05A {Thermus th 99.5
3lpm_A259 Putative methyltransferase; structural genomics, p 99.48
2b3t_A276 Protein methyltransferase HEMK; translation termin 99.45
2frn_A278 Hypothetical protein PH0793; structural genomics, 99.45
1yb2_A275 Hypothetical protein TA0852; structural genomics, 99.45
1o54_A277 SAM-dependent O-methyltransferase; TM0748, structu 99.44
3mti_A185 RRNA methylase; SAM-dependent, PSI, MCSG, structur 99.44
3u81_A221 Catechol O-methyltransferase; neurotransmitter deg 99.44
3eey_A197 Putative rRNA methylase; rRNA methylation, S-adeno 99.42
3tfw_A248 Putative O-methyltransferase; PSI-biology, nysgrc, 99.42
4df3_A233 Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; 99.41
3p9n_A189 Possible methyltransferase (methylase); RV2966C, a 99.38
3evz_A230 Methyltransferase; NYSGXRC, NEW YORK SGX research 99.38
3e05_A204 Precorrin-6Y C5,15-methyltransferase (decarboxyla; 99.37
1i9g_A280 Hypothetical protein RV2118C; mtase, adoMet, cryst 99.37
3duw_A223 OMT, O-methyltransferase, putative; alternating of 99.37
3njr_A204 Precorrin-6Y methylase; methyltransferase, decarbo 99.36
3bt7_A369 TRNA (uracil-5-)-methyltransferase; methyluridine, 99.35
2gpy_A233 O-methyltransferase; structural genomics, PSI, pro 99.35
3mb5_A255 SAM-dependent methyltransferase; RNA methyltransfe 99.35
3k6r_A278 Putative transferase PH0793; structural genomics, 99.34
3a27_A272 TYW2, uncharacterized protein MJ1557; wybutosine m 99.33
3dou_A191 Ribosomal RNA large subunit methyltransferase J; c 99.32
3dr5_A221 Putative O-methyltransferase; Q8NRD3, CGL1119, PF0 99.32
3tr6_A225 O-methyltransferase; cellular processes; HET: SAH; 99.31
2ift_A201 Putative methylase HI0767; NESG, Y767_haein, struc 99.31
3c3y_A237 Pfomt, O-methyltransferase; plant secondary metabo 99.3
3hm2_A178 Precorrin-6Y C5,15-methyltransferase; alpha-beta-s 99.3
2fpo_A202 Methylase YHHF; structural genomics, putative meth 99.29
2b25_A336 Hypothetical protein; structural genomics, methyl 99.29
3lbf_A210 Protein-L-isoaspartate O-methyltransferase; modifi 99.28
4dzr_A215 Protein-(glutamine-N5) methyltransferase, release 99.28
1nt2_A210 Fibrillarin-like PRE-rRNA processing protein; adeM 99.28
2qm3_A373 Predicted methyltransferase; putative methyltransf 99.27
1nv8_A284 HEMK protein; class I adoMet-dependent methyltrans 99.27
2pwy_A258 TRNA (adenine-N(1)-)-methyltransferase; mtase, ado 99.27
3r3h_A242 O-methyltransferase, SAM-dependent; structural gen 99.27
2yx1_A336 Hypothetical protein MJ0883; methyl transferase, t 99.27
1dus_A194 MJ0882; hypothetical protein, methanococcus jannas 99.26
2yvl_A248 TRMI protein, hypothetical protein; tRNA, methyltr 99.25
2ozv_A260 Hypothetical protein ATU0636; structural genomics, 99.24
3ntv_A232 MW1564 protein; rossmann fold, putative methyltran 99.23
2esr_A177 Methyltransferase; structural genomics, hypothetic 99.22
1dl5_A317 Protein-L-isoaspartate O-methyltransferase; isoasp 99.22
3gdh_A241 Trimethylguanosine synthase homolog; M7G, CAP, dim 99.22
3c3p_A210 Methyltransferase; NP_951602.1, structural genomic 99.22
2plw_A201 Ribosomal RNA methyltransferase, putative; malaria 99.2
2fhp_A187 Methylase, putative; alpha-beta-alpha sandwich, st 99.19
3dh0_A219 SAM dependent methyltransferase; cystal structure, 99.19
2fca_A213 TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bac 99.19
1sui_A247 Caffeoyl-COA O-methyltransferase; rossmann fold, p 99.19
1yzh_A214 TRNA (guanine-N(7)-)-methyltransferase; alpha-beta 99.18
1inl_A296 Spermidine synthase; beta-barrel, rossman fold, st 99.18
2ipx_A233 RRNA 2'-O-methyltransferase fibrillarin; FBL, stru 99.18
1r18_A227 Protein-L-isoaspartate(D-aspartate)-O-methyltrans; 99.18
3tm4_A373 TRNA (guanine N2-)-methyltransferase TRM14; rossma 99.18
3vc1_A312 Geranyl diphosphate 2-C-methyltransferase; rossman 99.18
3dxy_A218 TRNA (guanine-N(7)-)-methyltransferase; rossmann f 99.17
2pbf_A227 Protein-L-isoaspartate O-methyltransferase beta-A 99.17
4dcm_A375 Ribosomal RNA large subunit methyltransferase G; 2 99.17
2yxe_A215 Protein-L-isoaspartate O-methyltransferase; rossma 99.17
1xdz_A240 Methyltransferase GIDB; MCSG, protein structure in 99.16
3fpf_A298 Mtnas, putative uncharacterized protein; thermonic 99.16
3grz_A205 L11 mtase, ribosomal protein L11 methyltransferase 99.16
1g8a_A227 Fibrillarin-like PRE-rRNA processing protein; rRNA 99.16
1o9g_A250 RRNA methyltransferase; antibiotic resistance, Se- 99.16
3kkz_A267 Uncharacterized protein Q5LES9; putative methyltra 99.16
1l3i_A192 Precorrin-6Y methyltransferase/putative decarboxyl 99.16
3f4k_A257 Putative methyltransferase; structural genomics, P 99.15
3hem_A302 Cyclopropane-fatty-acyl-phospholipid synthase 2; p 99.15
2yxd_A183 Probable cobalt-precorrin-6Y C(15)-methyltransfer 99.15
1vl5_A260 Unknown conserved protein BH2331; putative methylt 99.15
1xxl_A239 YCGJ protein; structural genomics, protein structu 99.14
3g89_A249 Ribosomal RNA small subunit methyltransferase G; 1 99.14
2avd_A229 Catechol-O-methyltransferase; structural genomics, 99.13
1ws6_A171 Methyltransferase; structural genomics, riken stru 99.12
4gek_A261 TRNA (CMO5U34)-methyltransferase; structural genom 99.12
3cbg_A232 O-methyltransferase; cyanobacterium; HET: SAH FER 99.12
1ej0_A180 FTSJ; methyltransferase, adoMet, adenosyl methioni 99.12
1jg1_A235 PIMT;, protein-L-isoaspartate O-methyltransferase; 99.11
2h1r_A299 Dimethyladenosine transferase, putative; SGC toron 99.1
2f8l_A344 Hypothetical protein LMO1582; structural genomics, 99.1
1nkv_A256 Hypothetical protein YJHP; structural genomics, PS 99.09
2hnk_A239 SAM-dependent O-methyltransferase; modified rossma 99.09
2nyu_A196 Putative ribosomal RNA methyltransferase 2; SAM, s 99.09
1uwv_A433 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA m 99.09
2jjq_A425 Uncharacterized RNA methyltransferase pyrab10780; 99.07
1zx0_A236 Guanidinoacetate N-methyltransferase; structural g 99.07
2vdv_E246 TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl 99.06
1fbn_A230 MJ fibrillarin homologue; MJ proteins, ribosomal R 99.06
2xvm_A199 Tellurite resistance protein TEHB; antibiotic resi 99.06
3dmg_A381 Probable ribosomal RNA small subunit methyltransf; 99.05
1wy7_A207 Hypothetical protein PH1948; seven-stranded beta s 99.05
1vbf_A231 231AA long hypothetical protein-L-isoaspartate O- 99.05
3orh_A236 Guanidinoacetate N-methyltransferase; structura ge 99.04
2p41_A305 Type II methyltransferase; vizier, viral enzymes i 99.04
3bus_A273 REBM, methyltransferase; rebeccamycin synthesis; H 99.02
3mgg_A276 Methyltransferase; NYSGXRC, PSI-II, protein struct 99.01
3dlc_A219 Putative S-adenosyl-L-methionine-dependent methylt 99.01
3jwh_A217 HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena 99.0
2o57_A297 Putative sarcosine dimethylglycine methyltransfera 98.99
1ri5_A298 MRNA capping enzyme; methyltransferase, M7G, messe 98.98
3ckk_A235 TRNA (guanine-N(7)-)-methyltransferase; mettl1, S- 98.98
3gu3_A284 Methyltransferase; alpha-beta protein, structural 98.98
2fk8_A318 Methoxy mycolic acid synthase 4; S-adenosylmethion 98.98
3ocj_A305 Putative exported protein; structural genomics, PS 98.97
2pjd_A343 Ribosomal RNA small subunit methyltransferase C; g 98.97
2ih2_A 421 Modification methylase TAQI; DNA, DNA methyltransf 98.97
3ujc_A266 Phosphoethanolamine N-methyltransferase; parasite; 98.97
1jsx_A207 Glucose-inhibited division protein B; methyltransf 98.96
2pxx_A215 Uncharacterized protein MGC2408; structural genomi 98.96
2okc_A445 Type I restriction enzyme stysji M protein; NP_813 98.95
2nxc_A254 L11 mtase, ribosomal protein L11 methyltransferase 98.95
3kr9_A225 SAM-dependent methyltransferase; class I rossmann- 98.95
3dtn_A234 Putative methyltransferase MM_2633; structural gen 98.95
1kpg_A287 CFA synthase;, cyclopropane-fatty-acyl-phospholipi 98.94
3mq2_A218 16S rRNA methyltransferase; methyltranferase, ribo 98.94
3jwg_A219 HEN1, methyltransferase type 12; 1.90A {Clostridiu 98.94
1ve3_A227 Hypothetical protein PH0226; dimer, riken structur 98.93
3m70_A286 Tellurite resistance protein TEHB homolog; structu 98.92
2kw5_A202 SLR1183 protein; structural genomics, northeast st 98.92
3g5t_A299 Trans-aconitate 3-methyltransferase; structural ge 98.91
4fsd_A383 Arsenic methyltransferase; rossmann fold; 1.75A {C 98.91
3ou2_A218 SAM-dependent methyltransferase; O-methyltransfera 98.91
1m6y_A301 S-adenosyl-methyltransferase MRAW; SAM-dependent m 98.91
3sm3_A235 SAM-dependent methyltransferases; NESG, structural 98.9
1zq9_A285 Probable dimethyladenosine transferase; SGC, struc 98.9
3ofk_A216 Nodulation protein S; NODS, N-methyltransferase, S 98.9
1pjz_A203 Thiopurine S-methyltransferase; polymorphism, S-ad 98.89
3bkx_A275 SAM-dependent methyltransferase; YP_807781.1, cycl 98.89
1xtp_A254 LMAJ004091AAA; SGPP, structural genomics, PSI, pro 98.88
2p8j_A209 S-adenosylmethionine-dependent methyltransferase; 98.88
2h00_A254 Methyltransferase 10 domain containing protein; st 98.88
2fyt_A340 Protein arginine N-methyltransferase 3; structural 98.87
3g07_A292 7SK snRNA methylphosphate capping enzyme; structur 98.87
3q7e_A349 Protein arginine N-methyltransferase 1; HET: SAH; 98.87
3gnl_A244 Uncharacterized protein, DUF633, LMOF2365_1472; st 98.87
2bm8_A236 Cephalosporin hydroxylase CMCI; cephamycin biosynt 98.87
3lec_A230 NADB-rossmann superfamily protein; PSI, MCSG, stru 98.87
2xyq_A290 Putative 2'-O-methyl transferase; transferase-vira 98.86
4htf_A285 S-adenosylmethionine-dependent methyltransferase; 98.86
2ex4_A241 Adrenal gland protein AD-003; methyltransferase, s 98.86
2vdw_A302 Vaccinia virus capping enzyme D1 subunit; nucleoti 98.85
1mjf_A281 Spermidine synthase; spermidine synthetase, struct 98.85
3g5l_A253 Putative S-adenosylmethionine dependent methyltran 98.85
2ar0_A 541 M.ecoki, type I restriction enzyme ecoki M protein 98.84
3thr_A293 Glycine N-methyltransferase; GNMT, folate, methylt 98.82
3g2m_A299 PCZA361.24; SAM-dependent methyltransferase, glyco 98.82
2p35_A259 Trans-aconitate 2-methyltransferase; SAM dependent 98.81
3r0q_C376 Probable protein arginine N-methyltransferase 4.2; 98.81
3hnr_A220 Probable methyltransferase BT9727_4108; structural 98.8
1g6q_1328 HnRNP arginine N-methyltransferase; SAM-binding do 98.8
3d2l_A243 SAM-dependent methyltransferase; ZP_00538691.1, st 98.79
3bkw_A243 MLL3908 protein, S-adenosylmethionine dependent me 98.79
2yqz_A263 Hypothetical protein TTHA0223; RNA methyltransfera 98.79
2y1w_A348 Histone-arginine methyltransferase CARM1; histone 98.79
3adn_A294 Spermidine synthase; aminopropyltransferase, polya 98.77
1ne2_A200 Hypothetical protein TA1320; structural genomics, 98.77
1wzn_A252 SAM-dependent methyltransferase; structural genomi 98.77
3q87_B170 N6 adenine specific DNA methylase; SAM-methyltrans 98.76
1xj5_A334 Spermidine synthase 1; structural genomics, protei 98.76
3uwp_A438 Histone-lysine N-methyltransferase, H3 lysine-79; 98.75
2oxt_A265 Nucleoside-2'-O-methyltransferase; flavivirus, vir 98.75
2gb4_A252 Thiopurine S-methyltransferase; 18204406, thiopuri 98.75
3cgg_A195 SAM-dependent methyltransferase; NP_600671.1, meth 98.74
1y8c_A246 S-adenosylmethionine-dependent methyltransferase; 98.74
2wa2_A276 Non-structural protein 5; transferase, S-adenosyl- 98.73
3p2e_A225 16S rRNA methylase; methyltransferase, transferase 98.73
3e23_A211 Uncharacterized protein RPA2492; alpha-beta protei 98.73
2r6z_A258 UPF0341 protein in RSP 3' region; alpha-beta prote 98.73
1iy9_A275 Spermidine synthase; rossmann fold, structural gen 98.72
3bgv_A313 MRNA CAP guanine-N7 methyltransferase; alternative 98.72
3dli_A240 Methyltransferase; PSI-II, NYSGXRC, structural gen 98.72
2o07_A304 Spermidine synthase; structural genomics, structur 98.72
3ccf_A279 Cyclopropane-fatty-acyl-phospholipid synthase; YP_ 98.71
3i9f_A170 Putative type 11 methyltransferase; structural gen 98.71
2a14_A263 Indolethylamine N-methyltransferase; SGC,INMT, str 98.7
3m33_A226 Uncharacterized protein; structural genomics, PSI- 98.7
3ldu_A385 Putative methylase; structural genomics, PSI-2, pr 98.7
3l8d_A242 Methyltransferase; structural genomics, PSI, nysgr 98.69
3bwc_A304 Spermidine synthase; SAM, SGPP, structura genomics 98.69
2i7c_A283 Spermidine synthase; transferase, structural genom 98.69
3iv6_A261 Putative Zn-dependent alcohol dehydrogenase; alpha 98.68
2pt6_A321 Spermidine synthase; transferase, structural genom 98.68
2p7i_A250 Hypothetical protein; putative methyltransferase, 98.68
1q7h_A153 Conserved hypothetical protein; structural genomic 98.67
3k0b_A393 Predicted N6-adenine-specific DNA methylase; methy 98.67
2i62_A265 Nicotinamide N-methyltransferase; structural genom 98.66
1u2z_A433 Histone-lysine N-methyltransferase, H3 lysine-79 s 98.66
3h2b_A203 SAM-dependent methyltransferase; alpha-beta protei 98.66
3r90_A188 Malignant T cell-amplified sequence 1; structural 98.65
3lkd_A542 Type I restriction-modification system methyltrans 98.65
3ege_A261 Putative methyltransferase from antibiotic biosyn 98.64
1uir_A314 Polyamine aminopropyltransferase; spermidien synth 98.63
3htx_A950 HEN1; HEN1, small RNA methyltransferase, protein-R 98.63
3d79_A179 PUA domain, putative uncharacterized protein PH073 98.63
3b3j_A480 Histone-arginine methyltransferase CARM1; protein 98.62
3ldg_A384 Putative uncharacterized protein SMU.472; YPSC, me 98.62
2aot_A292 HMT, histamine N-methyltransferase; classic methyl 98.6
3bzb_A281 Uncharacterized protein; RED ALGA, protein structu 98.6
3lcc_A235 Putative methyl chloride transferase; halide methy 98.6
3ll7_A410 Putative methyltransferase; methytransferase, stru 98.6
2b2c_A314 Spermidine synthase; beta-alpha, transferase; 2.50 98.59
3zv0_C195 H/ACA ribonucleoprotein complex subunit 4; cell cy 98.58
3fzg_A200 16S rRNA methylase; methyltransferase, plasmid, tr 98.57
2qfm_A364 Spermine synthase; spermidine aminopropyltransfera 98.57
2gs9_A211 Hypothetical protein TT1324; methyl transferase, s 98.57
3bxo_A239 N,N-dimethyltransferase; desosamine, sugar, carboh 98.57
3gjy_A317 Spermidine synthase; APC62791, structural genomics 98.55
3khk_A544 Type I restriction-modification system methylation 98.53
2g72_A289 Phenylethanolamine N-methyltransferase; HET: SAM F 98.53
2avn_A260 Ubiquinone/menaquinone biosynthesis methyltransfe 98.53
3e8s_A227 Putative SAM dependent methyltransferase; NP_74470 98.52
4hg2_A257 Methyltransferase type 11; structural genomics, PS 98.52
3pfg_A263 N-methyltransferase; N,N-dimethyltransferase, SAM 98.52
1p91_A269 Ribosomal RNA large subunit methyltransferase A; R 98.51
3ggd_A245 SAM-dependent methyltransferase; YP_325210.1, stru 98.5
2r3s_A335 Uncharacterized protein; methyltransferase domain, 98.5
1yub_A245 Ermam, rRNA methyltransferase; MLS antibiotics; NM 98.5
1qzz_A374 RDMB, aclacinomycin-10-hydroxylase; anthracycline, 98.48
1tw3_A360 COMT, carminomycin 4-O-methyltransferase; anthracy 98.43
1x19_A359 CRTF-related protein; methyltransferase, bacterioc 98.43
3cc8_A230 Putative methyltransferase; structural genomics, j 98.42
2oyr_A258 UPF0341 protein YHIQ; alpha-beta protein, structur 98.41
4hc4_A376 Protein arginine N-methyltransferase 6; HRMT1L6, S 98.4
3i53_A332 O-methyltransferase; CO-complex, rossmann-like fol 98.39
3gwz_A369 MMCR; methyltransferase, mitomycin, S-adenosyl met 98.39
3v97_A 703 Ribosomal RNA large subunit methyltransferase L; Y 98.37
3gru_A295 Dimethyladenosine transferase; rossman fold, ribos 98.36
2ip2_A334 Probable phenazine-specific methyltransferase; pyo 98.35
2px2_A269 Genome polyprotein [contains: capsid protein C (co 98.35
3mcz_A352 O-methyltransferase; adomet_mtases, S-adenosylmeth 98.33
2cx0_A187 Hypothetical protein APE0525; PUA domain, structur 98.32
3sso_A419 Methyltransferase; macrolide, natural product, ros 98.32
1qam_A244 ERMC' methyltransferase; rRNA methyltransferase ER 98.31
3s1s_A 878 Restriction endonuclease bpusi; PD--(D/E)XK cataly 98.3
3ufb_A530 Type I restriction-modification system methyltran 98.3
3dp7_A363 SAM-dependent methyltransferase; structural genomi 98.28
3hp7_A291 Hemolysin, putative; structural genomics, APC64019 98.26
1iq8_A582 Archaeosine tRNA-guanine transglycosylase; (alpha/ 98.25
2cmg_A262 Spermidine synthase; transferase, putrescine amino 98.25
2qe6_A274 Uncharacterized protein TFU_2867; putative methylt 98.23
1vlm_A219 SAM-dependent methyltransferase; possible histamin 98.2
3opn_A232 Putative hemolysin; structural genomics, PSI-2, pr 98.16
3frh_A253 16S rRNA methylase; methyltransferase domain, heli 98.13
1af7_A274 Chemotaxis receptor methyltransferase CHER; chemot 98.11
2zfu_A215 Nucleomethylin, cerebral protein 1; nucleolar prot 98.11
4e2x_A416 TCAB9; kijanose, tetronitrose, tetradeoxy sugar, s 98.11
1wg8_A285 Predicted S-adenosylmethionine-dependent methyltra 98.08
3tqs_A255 Ribosomal RNA small subunit methyltransferase A; p 98.06
3tka_A347 Ribosomal RNA small subunit methyltransferase H; H 98.05
3cvo_A202 Methyltransferase-like protein of unknown functio; 98.05
3eld_A300 Methyltransferase; flavivirus, RNA capping, guanyl 98.04
3lst_A348 CALO1 methyltransferase; calicheamicin, enediyne, 98.03
3evf_A277 RNA-directed RNA polymerase NS5; NS5 methyltransfe 97.97
3giw_A277 Protein of unknown function DUF574; rossmann-fold 97.95
3lcv_B281 Sisomicin-gentamicin resistance methylase SGM; ant 97.95
2qy6_A257 UPF0209 protein YFCK; structural genomics, unknown 97.9
3gcz_A282 Polyprotein; flavivirus, RNA capping, methyltransf 97.88
3fut_A271 Dimethyladenosine transferase; methyltransferase, 97.81
3uzu_A279 Ribosomal RNA small subunit methyltransferase A; s 97.8
2q07_A306 Uncharacterized protein AF0587; monomer, structura 97.73
2ld4_A176 Anamorsin; methyltransferase-like fold, alpha/beta 97.71
4a6d_A353 Hydroxyindole O-methyltransferase; melatonin, circ 97.67
3reo_A368 (ISO)eugenol O-methyltransferase; directed evoluti 97.67
4azs_A 569 Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15 97.65
3p9c_A364 Caffeic acid O-methyltransferase; S-adenosylmethio 97.64
2wk1_A282 NOVP; transferase, O-methyltransferase, novobiocin 97.64
4auk_A375 Ribosomal RNA large subunit methyltransferase M; Y 97.62
1fp1_D372 Isoliquiritigenin 2'-O-methyltransferase; protein- 97.59
1fp2_A352 Isoflavone O-methyltransferase; protein-product co 97.48
1qyr_A252 KSGA, high level kasugamycin resistance protein, S 97.44
3ftd_A249 Dimethyladenosine transferase; KSGA, rossmann-like 97.43
3p8z_A267 Mtase, non-structural protein 5; methyltransferase 97.41
2p38_A166 Protein involved in ribosomal biogenesis; two alph 97.19
2oo3_A283 Protein involved in catabolism of external DNA; st 97.11
1zg3_A358 Isoflavanone 4'-O-methyltransferase; rossman fold, 97.08
3r24_A344 NSP16, 2'-O-methyl transferase; methyltransferase, 97.03
3lkz_A321 Non-structural protein 5; flavivirus, methyltransf 96.97
3u28_A400 H/ACA ribonucleoprotein complex subunit 4; pseudou 96.97
3o4f_A294 Spermidine synthase; aminopropyltransferase, polya 96.94
3c6k_A381 Spermine synthase; spermidine aminopropyltransfera 96.89
3ua3_A745 Protein arginine N-methyltransferase 5; TIM-barrel 96.73
4gqb_A637 Protein arginine N-methyltransferase 5; TIM barrel 96.63
3g7u_A 376 Cytosine-specific methyltransferase; DNA-binding, 96.31
2j5v_A367 Glutamate 5-kinase; proline biosynthesis, gamma gl 96.24
1g55_A 343 DNA cytosine methyltransferase DNMT2; human DNA me 96.1
1pl8_A356 Human sorbitol dehydrogenase; NAD, oxidoreductase; 95.95
2zig_A297 TTHA0409, putative modification methylase; methylt 95.69
2zig_A 297 TTHA0409, putative modification methylase; methylt 95.67
2c7p_A327 Modification methylase HHAI; DNA methyltransferase 95.57
3s2e_A340 Zinc-containing alcohol dehydrogenase superfamily; 95.51
2py6_A409 Methyltransferase FKBM; YP_546752.1, structural ge 95.4
3jv7_A345 ADH-A; dehydrogenase, nucleotide binding, rossmann 95.39
2dph_A398 Formaldehyde dismutase; dismutation of aldehydes, 95.27
1sqw_A188 Saccharomyces cerevisiae NIP7P homolog; PUA, unkno 95.27
4eez_A348 Alcohol dehydrogenase 1; site-saturation mutagenes 95.08
1e3j_A352 NADP(H)-dependent ketose reductase; oxidoreductase 95.05
4ej6_A370 Putative zinc-binding dehydrogenase; structural ge 95.02
3m6i_A363 L-arabinitol 4-dehydrogenase; medium chain dehydro 94.9
3fpc_A352 NADP-dependent alcohol dehydrogenase; oxydoreducta 94.88
3b5i_A 374 S-adenosyl-L-methionine:salicylic acid carboxyl me 94.81
1kol_A398 Formaldehyde dehydrogenase; oxidoreductase; HET: N 94.79
4a2c_A346 Galactitol-1-phosphate 5-dehydrogenase; oxidoreduc 94.75
2aus_C334 Pseudouridine synthase; isomerase, structural prot 94.71
1f8f_A371 Benzyl alcohol dehydrogenase; rossmann fold, oxido 94.66
1p0f_A373 NADP-dependent alcohol dehydrogenase; ADH topology 94.64
1cdo_A374 Alcohol dehydrogenase; oxidoreductase, oxidoreduct 94.55
1e3i_A376 Alcohol dehydrogenase, class II; HET: NAD; 2.08A { 94.54
2jhf_A374 Alcohol dehydrogenase E chain; oxidoreductase, met 94.47
2fzw_A373 Alcohol dehydrogenase class III CHI chain; S-nitro 94.47
2qrv_A295 DNA (cytosine-5)-methyltransferase 3A; DNA methylt 94.42
1vj0_A380 Alcohol dehydrogenase, zinc-containing; TM0436, st 94.34
2apo_A357 Probable tRNA pseudouridine synthase B; protein-pr 94.24
3uko_A378 Alcohol dehydrogenase class-3; alcohol dehydrogena 94.21
1g60_A260 Adenine-specific methyltransferase MBOIIA; structu 94.2
3uog_A363 Alcohol dehydrogenase; structural genomics, protei 94.04
1i4w_A353 Mitochondrial replication protein MTF1; mitochondr 93.96
3two_A348 Mannitol dehydrogenase; cinnamyl-alcohol dehydroge 93.76
1wma_A276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 93.54
4dvj_A363 Putative zinc-dependent alcohol dehydrogenase Pro; 93.52
4fs3_A256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 93.4
4h0n_A333 DNMT2; SAH binding, transferase; HET: SAH; 2.71A { 93.4
3oig_A266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 92.83
4eye_A342 Probable oxidoreductase; structural genomics, niai 92.81
3qv2_A327 5-cytosine DNA methyltransferase; DNMT2, ehmeth; H 92.54
1boo_A 323 Protein (N-4 cytosine-specific methyltransferase P 92.4
2k4m_A153 TR8_protein, UPF0146 protein MTH_1000; alpha+beta, 92.29
1g60_A 260 Adenine-specific methyltransferase MBOIIA; structu 92.22
3fbg_A346 Putative arginate lyase; structural genomics, unkn 92.19
3ip1_A404 Alcohol dehydrogenase, zinc-containing; structural 92.04
3jyn_A325 Quinone oxidoreductase; rossmann fold, protein-NAD 91.87
3grk_A293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 91.71
2d8a_A348 PH0655, probable L-threonine 3-dehydrogenase; pyro 91.69
3qwb_A334 Probable quinone oxidoreductase; rossmann fold, qu 91.15
1ja9_A274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 90.96
3gms_A340 Putative NADPH:quinone reductase; structural genom 90.44
1eg2_A 319 Modification methylase RSRI; rossmann fold, exocyc 90.35
3pxx_A287 Carveol dehydrogenase; structural genomics, seattl 90.18
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 89.99
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 89.87
3k31_A296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 89.8
2b5w_A357 Glucose dehydrogenase; nucleotide binding motif, o 89.77
3gaz_A343 Alcohol dehydrogenase superfamily protein; oxidore 89.27
3vyw_A308 MNMC2; tRNA wobble uridine, modification enzyme, g 89.13
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 89.08
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 88.95
2efj_A 384 3,7-dimethylxanthine methyltransferase; SAM-depend 88.79
4b7c_A336 Probable oxidoreductase; NADP cofactor, rossmann f 88.77
3krt_A456 Crotonyl COA reductase; structural genomics, prote 88.69
3ek2_A271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 88.65
4a0s_A447 Octenoyl-COA reductase/carboxylase; oxidoreductase 88.13
3ubt_Y331 Modification methylase HAEIII; protein-DNA complex 88.03
4eso_A255 Putative oxidoreductase; NADP, structural genomics 87.76
3tjr_A301 Short chain dehydrogenase; structural genomics, se 87.68
1m6e_X 359 S-adenosyl-L-methionnine:salicylic acid carboxyl m 87.6
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 87.54
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 87.35
1gu7_A364 Enoyl-[acyl-carrier-protein] reductase [NADPH, B-s 87.11
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 86.86
2c0c_A362 Zinc binding alcohol dehydrogenase, domain contain 86.76
3ioy_A319 Short-chain dehydrogenase/reductase SDR; structura 86.27
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 86.24
3rih_A293 Short chain dehydrogenase or reductase; structural 86.17
3ksu_A262 3-oxoacyl-acyl carrier protein reductase; structur 86.17
3tos_A257 CALS11; methyltransferase, calicheamicin, structur 86.03
1gee_A261 Glucose 1-dehydrogenase; short-chain dehydrogenase 85.78
3tqh_A321 Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella 85.37
3me5_A 482 Cytosine-specific methyltransferase; structural ge 85.32
3pgx_A280 Carveol dehydrogenase; structural genomics, seattl 85.2
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 85.05
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 84.98
1edo_A244 Beta-keto acyl carrier protein reductase; nucleoti 84.94
1boo_A323 Protein (N-4 cytosine-specific methyltransferase P 84.93
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 84.57
1w6u_A302 2,4-dienoyl-COA reductase, mitochondrial precursor 84.53
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 84.38
1eg2_A319 Modification methylase RSRI; rossmann fold, exocyc 84.34
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 84.33
2a4k_A263 3-oxoacyl-[acyl carrier protein] reductase; reduct 84.22
2p91_A285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 84.12
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 84.11
2pd4_A275 Enoyl-[acyl-carrier-protein] reductase [NADH]; ant 83.91
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 83.67
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 83.58
3is3_A270 17BETA-hydroxysteroid dehydrogenase; short chain d 83.5
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 83.47
1yxm_A303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 83.41
2bd0_A244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 83.37
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 83.36
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 83.33
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 83.16
3oid_A258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 82.93
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 82.86
2uvd_A246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 82.78
3pi7_A349 NADH oxidoreductase; groes-like fold, NAD(P)-bindi 82.71
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 82.61
3s55_A281 Putative short-chain dehydrogenase/reductase; stru 82.31
3pvc_A 689 TRNA 5-methylaminomethyl-2-thiouridine biosynthes 82.28
1geg_A256 Acetoin reductase; SDR family, oxidoreductase; HET 82.28
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 82.19
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 82.12
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 82.03
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 81.86
1xhl_A297 Short-chain dehydrogenase/reductase family member 81.69
2ph3_A245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 81.49
3rku_A287 Oxidoreductase YMR226C; substrate fingerprint, sho 81.44
3tfo_A264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 81.43
3r3s_A294 Oxidoreductase; structural genomics, csgid, center 81.23
1zem_A262 Xylitol dehydrogenase; rossmann fold, dinucleotide 81.21
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 81.14
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 81.06
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 80.94
3v2g_A271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 80.93
3imf_A257 Short chain dehydrogenase; structural genomics, in 80.93
2wyu_A261 Enoyl-[acyl carrier protein] reductase; oxidoreduc 80.85
1qsg_A265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 80.72
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 80.52
1zsy_A357 Mitochondrial 2-enoyl thioester reductase; medium- 80.28
1uuf_A369 YAHK, zinc-type alcohol dehydrogenase-like protein 80.27
4fc7_A277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 80.11
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 80.11
>4fzv_A Putative methyltransferase NSUN4; mterf fold, methyltransferase fold, rRNA methyltransferase, mitochondria, transferase; HET: MSE SAM; 2.00A {Homo sapiens} PDB: 4fp9_A* Back     alignment and structure
Probab=100.00  E-value=1.7e-44  Score=373.42  Aligned_cols=170  Identities=27%  Similarity=0.412  Sum_probs=144.2

Q ss_pred             cccCCccc--cccccEEEccccHHHHHhhcCCCCCCeEEEecCCCChHHHHHHHhcCCCcEEEEEeCChHHHHHHHHHHH
Q 011036          230 FQLPSFYD--VLEGEIFLQNLPSIVTAHALDPQKGERILDMCAAPGGKTTAIASLLRDEGEVVAVDRSHNKVMDIQKLAA  307 (495)
Q Consensus       230 ~~lp~~~~--~~~G~i~lQ~l~S~v~~~~LdpqpGerVLDmCAaPGgKT~~iA~lm~~~G~ViA~D~s~~kv~~i~~~a~  307 (495)
                      ..+|+|..  +.-+.|++||.+||+++++|+|+||++||||||||||||+|||++|. .|.|+|+|+|.+|+..++++++
T Consensus       115 ~~~p~~~~g~~~vqd~~iQd~aS~l~~~~L~~~pg~~VLD~CAaPGGKT~~la~~~~-~~~l~A~D~~~~R~~~l~~~l~  193 (359)
T 4fzv_A          115 SRFPPARPGSLGVMEYYLMDAASLLPVLALGLQPGDIVLDLCAAPGGKTLALLQTGC-CRNLAANDLSPSRIARLQKILH  193 (359)
T ss_dssp             CCCCCCCBCTTSSBSEEEECGGGHHHHHHHCCCTTEEEEESSCTTCHHHHHHHHTTC-EEEEEEECSCHHHHHHHHHHHH
T ss_pred             hcCCCcccCceeccchhhhCHHHHHHHHHhCCCCCCEEEEecCCccHHHHHHHHhcC-CCcEEEEcCCHHHHHHHHHHHH
Confidence            34455432  23567999999999999999999999999999999999999999774 5899999999999999999999


Q ss_pred             HhCCC------ceEEEEcchhHHHHhhCCCCCCCCccCCCCCccccccccccccccccccchhccCCCCCCccccccccc
Q 011036          308 EMGLK------CITTYKLDALKAVRRKNESNDEPNMCNSKDNNYITSQTSDSMKLHKEVPSIAAEGLNGDKSCKEKVSNE  381 (495)
Q Consensus       308 ~~gl~------~i~~~~~Da~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  381 (495)
                      ++|..      ++.+...|+.+.-                                                        
T Consensus       194 r~~~~~~~~~~~v~v~~~D~~~~~--------------------------------------------------------  217 (359)
T 4fzv_A          194 SYVPEEIRDGNQVRVTSWDGRKWG--------------------------------------------------------  217 (359)
T ss_dssp             HHSCTTTTTSSSEEEECCCGGGHH--------------------------------------------------------
T ss_pred             HhhhhhhccCCceEEEeCchhhcc--------------------------------------------------------
Confidence            99874      4666666664421                                                        


Q ss_pred             ccccccccchhhhhhhhhhccCCCCCCccCCCCccCCCCCCCCCccEEEEcCCCCCC--CC---cccchhhhhcHHHHHH
Q 011036          382 KGVERTYVSKADTRKNMRRMRNGPGRNQCLGGRAENSKGFSPNSFDRVLLDAPCSAL--GL---RPRLFAAEETIQSLRN  456 (495)
Q Consensus       382 ~~~~~~~~~~~~~~k~~~~~~~~~~~~~~~~g~~~~~~~f~~~sFDrVLlDaPCSgl--G~---rp~l~~~~~t~~~l~~  456 (495)
                                                            .+.+++||+||+||||||+  |+   .|++++ .++.+++..
T Consensus       218 --------------------------------------~~~~~~fD~VLlDaPCSg~g~g~~r~~~~~~~-~~~~~~~~~  258 (359)
T 4fzv_A          218 --------------------------------------ELEGDTYDRVLVDVPCTTDRHSLHEEENNIFK-RSRKKERQI  258 (359)
T ss_dssp             --------------------------------------HHSTTCEEEEEEECCCCCHHHHTTCCTTCTTS-GGGHHHHHT
T ss_pred             --------------------------------------hhccccCCEEEECCccCCCCCcccccChhhhh-hCCHHHHHH
Confidence                                                  1124689999999999997  44   255666 778999999


Q ss_pred             hHHHHHHHHHHHHhcCCCCCEEEEEeCCCCCcCcccccC
Q 011036          457 HGKYQRRMFDQAVQLVRPGGIIVYSTCTINPGENEALCA  495 (495)
Q Consensus       457 ~a~~Qrrll~~A~~lLkpGG~LVYSTCTi~p~ENE~vV~  495 (495)
                      ++.+|++||.+|+++|||||+|||||||++|+|||+||+
T Consensus       259 l~~lQ~~iL~~a~~~lkpGG~LVYsTCSl~~~ENE~vV~  297 (359)
T 4fzv_A          259 LPVLQVQLLAAGLLATKPGGHVVYSTCSLSHLQNEYVVQ  297 (359)
T ss_dssp             HHHHHHHHHHHHHHTEEEEEEEEEEESCCCTTTTHHHHH
T ss_pred             HHHHHHHHHHHHHhcCCCCcEEEEEeCCCchhhCHHHHH
Confidence            999999999999999999999999999999999999984
>3m4x_A NOL1/NOP2/SUN family protein; mtase domain, PUA domain, RRM motif, transferase; 2.28A {Enterococcus faecium} Back     alignment and structure
>2frx_A Hypothetical protein YEBU; rossmann-type S-adenosylmethionine-dependent methyltransfera domain; 2.90A {Escherichia coli} Back     alignment and structure
>3m6w_A RRNA methylase; rRNA methyltransferase, 5-methylcytidine, RSMF, adoMet, MULT specific, methyltransferase, transferase; HET: CXM SAM; 1.30A {Thermus thermophilus} PDB: 3m6v_A* 3m6u_A* 3m6x_A* Back     alignment and structure
>1ixk_A Methyltransferase; open beta sheet; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.38 Back     alignment and structure
>2b9e_A NOL1/NOP2/SUN domain family, member 5 isoform 2; methytransferase, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.65A {Homo sapiens} SCOP: c.66.1.38 Back     alignment and structure
>2yxl_A PH0851 protein, 450AA long hypothetical FMU protein; FMU-homolog, methyltransferase, structural genomics, NPPSFA; HET: SFG; 2.55A {Pyrococcus horikoshii} Back     alignment and structure
>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A Back     alignment and structure
>3ajd_A Putative methyltransferase MJ0026; tRNA, M5C, rossmann fold, structural genomics, riken structu genomics/proteomics initiative; 1.27A {Methanocaldococcus jannaschii} PDB: 3a4t_A Back     alignment and structure
>4dmg_A Putative uncharacterized protein TTHA1493; rRNA, methyltransferase, S-adenosyl-methionine, 23S ribosoma transferase; HET: SAM; 1.70A {Thermus thermophilus} Back     alignment and structure
>1wxx_A TT1595, hypothetical protein TTHA1280; thermus thermophillus, methyltransferase, adoMet, structural genomics; 1.80A {Thermus thermophilus} SCOP: b.122.1.9 c.66.1.51 PDB: 1wxw_A 2cww_A* Back     alignment and structure
>3id6_C Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; C/D guide RNA, 2'-O-methylation, coiled-coil, methyltransfer binding, rRNA processing; HET: SAM; 2.60A {Sulfolobus solfataricus} SCOP: c.66.1.0 PDB: 3id5_B* 3pla_E* Back     alignment and structure
>2as0_A Hypothetical protein PH1915; RNA methyltransferase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus horikoshii} SCOP: b.122.1.9 c.66.1.51 Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>3c0k_A UPF0064 protein YCCW; PUA domain, adoMet dependent methyltransferase fold; 2.00A {Escherichia coli K12} Back     alignment and structure
>2b78_A Hypothetical protein SMU.776; structure genomics, methyltransferase, caries, structural genomics, unknown function; 2.00A {Streptococcus mutans} SCOP: b.122.1.9 c.66.1.51 PDB: 3ldf_A* Back     alignment and structure
>2igt_A SAM dependent methyltransferase; alpha-beta sandwich, beta-barrel, structural genomics, PSI-2 structure initiative; HET: MSE SAM GOL; 1.89A {Agrobacterium tumefaciens str} SCOP: c.66.1.51 Back     alignment and structure
>3axs_A Probable N(2),N(2)-dimethylguanosine tRNA methylt TRM1; structural genomics, riken structural genomics/proteomics in RSGI; HET: SFG; 2.16A {Aquifex aeolicus} PDB: 3axt_A* Back     alignment and structure
>1i1n_A Protein-L-isoaspartate O-methyltransferase; S-adenosyl homocysteine, protein repair; HET: SAH; 1.50A {Homo sapiens} SCOP: c.66.1.7 PDB: 1kr5_A* Back     alignment and structure
>2dul_A N(2),N(2)-dimethylguanosine tRNA methyltransferas; tRNA modification enzyme, guanine 26, N(2),N(2)-dimethyltran structural genomics; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.58 PDB: 2ejt_A* 2eju_A* 2ytz_A* Back     alignment and structure
>3tma_A Methyltransferase; thump domain; 2.05A {Thermus thermophilus} Back     alignment and structure
>3lpm_A Putative methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium, nysgxrc; 2.40A {Listeria monocytogenes} Back     alignment and structure
>2b3t_A Protein methyltransferase HEMK; translation termination, methylation, conformational changes; HET: SAH; 3.10A {Escherichia coli} SCOP: c.66.1.30 PDB: 1t43_A* Back     alignment and structure
>2frn_A Hypothetical protein PH0793; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG; 2.10A {Pyrococcus horikoshii OT3} PDB: 3k6r_A 3a25_A* 3a26_A* Back     alignment and structure
>1yb2_A Hypothetical protein TA0852; structural genomics, methyltransferase, thermoplasma acidoph midwest center for structural genomics, MCSG; 2.01A {Thermoplasma acidophilum} SCOP: c.66.1.13 Back     alignment and structure
>1o54_A SAM-dependent O-methyltransferase; TM0748, structural genomi PSI, protein structure initiative, joint center for structu genomics; 1.65A {Thermotoga maritima} SCOP: c.66.1.13 Back     alignment and structure
>3mti_A RRNA methylase; SAM-dependent, PSI, MCSG, structural genomics, midwest cente structural genomics, protein structure initiative; 1.95A {Streptococcus thermophilus} PDB: 3lby_A* Back     alignment and structure
>3u81_A Catechol O-methyltransferase; neurotransmitter degradation, transferase transferase inhibitor complex; HET: SAH; 1.13A {Rattus norvegicus} SCOP: c.66.1.1 PDB: 3nwe_A* 3oe5_A* 3ozr_A* 3oe4_A* 3ozt_A* 3ozs_A* 3r6t_A* 3hvi_A* 1jr4_A* 1vid_A* 1h1d_A* 2cl5_A* 3hvh_A* 3hvj_A* 3hvk_A* 3nw9_A* 3nwb_A* 3s68_A* 2zlb_A 2zth_A* ... Back     alignment and structure
>3eey_A Putative rRNA methylase; rRNA methylation, S-adenosyl-methionine, structural genomics structure initiative, PSI; HET: SAM; 2.20A {Clostridium thermocellum atcc 27405} Back     alignment and structure
>3tfw_A Putative O-methyltransferase; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium; 1.88A {Klebsiella pneumoniae subsp} Back     alignment and structure
>4df3_A Fibrillarin-like rRNA/TRNA 2'-O-methyltransferase; NADP rossmann superfamily, S-adenosyl-L-M (SAM) binding, nucleolus; HET: SAM; 1.73A {Aeropyrum pernix} Back     alignment and structure
>3p9n_A Possible methyltransferase (methylase); RV2966C, adoMet binding, RNA methylase, RSMD, SAM-fold, RNA methyltransferase; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>3evz_A Methyltransferase; NYSGXRC, NEW YORK SGX research CE structural genomics, protein structure initiative, pyrococc furiosus, PSI-2; 2.20A {Pyrococcus furiosus} Back     alignment and structure
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxyla; porphyrin metabolism, S-adenosyl-methionine; 1.80A {Geobacter metallireducens} SCOP: c.66.1.0 Back     alignment and structure
>1i9g_A Hypothetical protein RV2118C; mtase, adoMet, crystal, structural genomics, protein structure initiative; HET: SAM; 1.98A {Mycobacterium tuberculosis} SCOP: c.66.1.13 Back     alignment and structure
>3duw_A OMT, O-methyltransferase, putative; alternating of alpha and beta with complex SAH; HET: SAH; 1.20A {Bacillus cereus} PDB: 3dul_A* Back     alignment and structure
>3njr_A Precorrin-6Y methylase; methyltransferase, decarboxylase, transferase; HET: SAH PG4; 2.70A {Rhodobacter capsulatus} Back     alignment and structure
>3bt7_A TRNA (uracil-5-)-methyltransferase; methyluridine, methyltransferase, TRMA, RUMT; HET: 5MU; 2.43A {Escherichia coli} Back     alignment and structure
>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW research center for structural genomics, nysgxrc; HET: MSE; 1.90A {Bacillus halodurans} Back     alignment and structure
>3mb5_A SAM-dependent methyltransferase; RNA methyltransferase, M1A, TRMI, intermolecular contacts, R specificity, tetramer, disulfide bond; HET: SAM; 1.60A {Pyrococcus abyssi} PDB: 3lga_A* 3lhd_C* Back     alignment and structure
>3k6r_A Putative transferase PH0793; structural genomics, PSI structure initiative, midwest center for structural genomic unknown function; 2.10A {Pyrococcus horikoshii} PDB: 3a25_A* 3a26_A* Back     alignment and structure
>3a27_A TYW2, uncharacterized protein MJ1557; wybutosine modification, transferase; HET: SAM; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>3dou_A Ribosomal RNA large subunit methyltransferase J; cell division, structural genomics, protein structure initiative, PSI; HET: SAM; 1.45A {Thermoplasma volcanium} SCOP: c.66.1.0 Back     alignment and structure
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum} Back     alignment and structure
>3tr6_A O-methyltransferase; cellular processes; HET: SAH; 2.70A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46 Back     alignment and structure
>3c3y_A Pfomt, O-methyltransferase; plant secondary metabolism; HET: SAH; 1.37A {Mesembryanthemum crystallinum} Back     alignment and structure
>3hm2_A Precorrin-6Y C5,15-methyltransferase; alpha-beta-sandwich, structural genomics, PSI-2, protein structure initiative; 2.21A {Corynebacterium diphtheriae} Back     alignment and structure
>2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protei structure initiative; HET: MSE; 2.05A {Escherichia coli} SCOP: c.66.1.46 Back     alignment and structure
>2b25_A Hypothetical protein; structural genomics, methyl transferase, SAM, structural GEN consortium, SGC, transferase; HET: SAM; 2.50A {Homo sapiens} SCOP: c.66.1.13 Back     alignment and structure
>3lbf_A Protein-L-isoaspartate O-methyltransferase; modified rossman-type fold, S-adenosyl-L- methionine; HET: SAH; 1.80A {Escherichia coli} Back     alignment and structure
>4dzr_A Protein-(glutamine-N5) methyltransferase, release specific; structural genomics, PSI-biology; 2.55A {Alicyclobacillus acidocaldarius subsp} Back     alignment and structure
>1nt2_A Fibrillarin-like PRE-rRNA processing protein; adeMet, binding motif, RNA binding protein; HET: SAM; 2.90A {Archaeoglobus fulgidus} SCOP: c.66.1.3 Back     alignment and structure
>2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, pyrococcus PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638} Back     alignment and structure
>1nv8_A HEMK protein; class I adoMet-dependent methyltransferase; HET: SAM MEQ; 2.20A {Thermotoga maritima} SCOP: c.66.1.30 PDB: 1nv9_A* 1vq1_A* 1sg9_A* Back     alignment and structure
>2pwy_A TRNA (adenine-N(1)-)-methyltransferase; mtase, adoMet, TRMI, tRNA-M1A58; HET: SAH; 1.70A {Thermus thermophilus} Back     alignment and structure
>3r3h_A O-methyltransferase, SAM-dependent; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.65A {Legionella pneumophila subsp} Back     alignment and structure
>2yx1_A Hypothetical protein MJ0883; methyl transferase, tRNA modification enzyme, transferase; HET: SFG; 2.20A {Methanocaldococcus jannaschii} PDB: 2zzn_A* 3ay0_A* 2zzm_A* Back     alignment and structure
>1dus_A MJ0882; hypothetical protein, methanococcus jannaschii, structural genomics, BSGC structure funded by NIH; 1.80A {Methanocaldococcus jannaschii} SCOP: c.66.1.4 Back     alignment and structure
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural GE NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus} Back     alignment and structure
>2ozv_A Hypothetical protein ATU0636; structural genomics, predicted transferase, predicted O-methyltransferase, PFAM PF05175; HET: MSE; 1.70A {Agrobacterium tumefaciens str} Back     alignment and structure
>3ntv_A MW1564 protein; rossmann fold, putative methyltransferase, transferase; HET: MSE; 1.55A {Staphylococcus aureus} Back     alignment and structure
>2esr_A Methyltransferase; structural genomics, hypothetical protein, streptococcus PYO PSI, protein structure initiative; HET: GLC; 1.80A {Streptococcus pyogenes} SCOP: c.66.1.46 Back     alignment and structure
>1dl5_A Protein-L-isoaspartate O-methyltransferase; isoaspartyl residues, protein repair, deamidation, post-translational modification; HET: SAH; 1.80A {Thermotoga maritima} SCOP: c.66.1.7 d.197.1.1 Back     alignment and structure
>3gdh_A Trimethylguanosine synthase homolog; M7G, CAP, dimethyltransferase, usnRNA, snoRNA, telomerase, cytoplasm, methyltransferase, nucleus; HET: MGP SAH; 2.00A {Homo sapiens} PDB: 3egi_A* Back     alignment and structure
>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint for structural genomics, JCSG, protein structure initiative transferase; 1.90A {Geobacter sulfurreducens pca} Back     alignment and structure
>2plw_A Ribosomal RNA methyltransferase, putative; malaria, SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Plasmodium falciparum} Back     alignment and structure
>2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis} SCOP: c.66.1.46 Back     alignment and structure
>3dh0_A SAM dependent methyltransferase; cystal structure, PSI-2, NYSGXRC, structural genomics, protein structure initiative; HET: SAM; 2.72A {Aquifex aeolicus} Back     alignment and structure
>2fca_A TRNA (guanine-N(7)-)-methyltransferase; 2.10A {Bacillus subtilis} SCOP: c.66.1.53 Back     alignment and structure
>1sui_A Caffeoyl-COA O-methyltransferase; rossmann fold, protein-cofactor-substrate complex; HET: SAH FRE; 2.70A {Medicago sativa} SCOP: c.66.1.1 PDB: 1sus_A* Back     alignment and structure
>1yzh_A TRNA (guanine-N(7)-)-methyltransferase; alpha-beta-alpha sandwich, S-adenosylmeth dependent, structural genomics, PSI; 2.02A {Streptococcus pneumoniae} SCOP: c.66.1.53 Back     alignment and structure
>1inl_A Spermidine synthase; beta-barrel, rossman fold, structural genomics, PSI, protein structure initiative; 1.50A {Thermotoga maritima} SCOP: c.66.1.17 PDB: 1jq3_A* Back     alignment and structure
>2ipx_A RRNA 2'-O-methyltransferase fibrillarin; FBL, structural genomics, structural genomics consortium, SGC; HET: MTA; 1.82A {Homo sapiens} Back     alignment and structure
>1r18_A Protein-L-isoaspartate(D-aspartate)-O-methyltrans; methyltransferase, isomerization, protein repair, S-adenosyl homocysteine; HET: SAH; 2.20A {Drosophila melanogaster} SCOP: c.66.1.7 Back     alignment and structure
>3tm4_A TRNA (guanine N2-)-methyltransferase TRM14; rossmann fold, thump domain, tRNA methyltransferase; HET: SAM; 1.95A {Pyrococcus furiosus} PDB: 3tlj_A* 3tm5_A* Back     alignment and structure
>3vc1_A Geranyl diphosphate 2-C-methyltransferase; rossmann fold, methyltransferase fold, SAM-dependent methyltransferase; HET: SAH GST GOL; 1.82A {Streptomyces coelicolor} PDB: 3vc2_A* 4f84_A* 4f85_A 4f86_A* Back     alignment and structure
>3dxy_A TRNA (guanine-N(7)-)-methyltransferase; rossmann fold methyltransferase, tRNA modification, S-adenosyl-L-methionine, TR processing; HET: SAM; 1.50A {Escherichia coli} PDB: 3dxx_A* 3dxz_A* Back     alignment and structure
>2pbf_A Protein-L-isoaspartate O-methyltransferase beta-A methyltransferase; protein repair, isoaspartyl formation, P. falciparum; HET: SAH; 2.00A {Plasmodium falciparum} Back     alignment and structure
>4dcm_A Ribosomal RNA large subunit methyltransferase G; 23S rRNA (guanine1835-N2)-methyltransferase; HET: SAM; 2.30A {Escherichia coli} Back     alignment and structure
>2yxe_A Protein-L-isoaspartate O-methyltransferase; rossman-type fold, alpha/beta/alpha sandwich structure, STRU genomics, NPPSFA; 2.00A {Methanocaldococcus jannaschii} Back     alignment and structure
>1xdz_A Methyltransferase GIDB; MCSG, protein structure initiative, structural genomics, methyltransferase fold, PSI; 1.60A {Bacillus subtilis} SCOP: c.66.1.20 Back     alignment and structure
>3fpf_A Mtnas, putative uncharacterized protein; thermonicotianamine, nicotianamine, biosynthetic protein; HET: TNA MTA; 1.66A {Methanothermobacter thermautotrophicusorganism_taxid} PDB: 3fpe_A* 3fph_A* 3fpg_A* 3fpj_A* 3o31_A* Back     alignment and structure
>3grz_A L11 mtase, ribosomal protein L11 methyltransferase; methylase, SAM-binding domain, PSI-2, nysgxrc; 2.00A {Lactobacillus delbrueckii subsp} Back     alignment and structure
>1g8a_A Fibrillarin-like PRE-rRNA processing protein; rRNA binding, RNA binding, structural genomics, BSGC structure funded by NIH; 1.40A {Pyrococcus horikoshii} SCOP: c.66.1.3 PDB: 2nnw_B 3nmu_F* 3nvk_I* 3nvm_B 1pry_A Back     alignment and structure
>1o9g_A RRNA methyltransferase; antibiotic resistance, Se-MAD; 1.5A {Streptomyces viridochromogenes} SCOP: c.66.1.29 PDB: 1o9h_A Back     alignment and structure
>3kkz_A Uncharacterized protein Q5LES9; putative methyltransferase, BFR250, NESG, structural genomics, PSI-2; HET: SAM; 1.68A {Bacteroides fragilis nctc 9343} PDB: 3e7p_A 3t7s_A* 3t7r_A* 3t7t_A* Back     alignment and structure
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A* Back     alignment and structure
>3f4k_A Putative methyltransferase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacteroides thetaiotaomicron} PDB: 3t0i_A* 3svz_A* 3sxj_A* Back     alignment and structure
>3hem_A Cyclopropane-fatty-acyl-phospholipid synthase 2; protein-ligand complex, cytoplasm, lipid synthesis, methyltransferase; HET: D22; 2.39A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kpi_A* Back     alignment and structure
>2yxd_A Probable cobalt-precorrin-6Y C(15)-methyltransfer [decarboxylating]; alpha and beta protein (A/B) class; HET: MES; 2.30A {Methanocaldococcus jannaschii} Back     alignment and structure
>1vl5_A Unknown conserved protein BH2331; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: MSE; 1.95A {Bacillus halodurans} SCOP: c.66.1.41 Back     alignment and structure
>1xxl_A YCGJ protein; structural genomics, protein structure initiative, PSI, NEW YORK SGX research center for structural genomics, nysgxrc; 2.10A {Bacillus subtilis} SCOP: c.66.1.41 PDB: 2glu_A* Back     alignment and structure
>3g89_A Ribosomal RNA small subunit methyltransferase G; 16S rRNA methyltransferase, translation, cytoplasm, rRNA processing; HET: HIC SAM AMP; 1.50A {Thermus thermophilus} PDB: 3g88_A* 3g8a_A* 3g8b_A* Back     alignment and structure
>2avd_A Catechol-O-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAM; 1.70A {Homo sapiens} SCOP: c.66.1.1 Back     alignment and structure
>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus} SCOP: c.66.1.46 Back     alignment and structure
>4gek_A TRNA (CMO5U34)-methyltransferase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, rossmann fold; HET: GEK; 1.50A {Escherichia coli} PDB: 1im8_A* Back     alignment and structure
>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP} Back     alignment and structure
>1ej0_A FTSJ; methyltransferase, adoMet, adenosyl methionine, heat shock proteins, 23S ribosomal RNA; HET: SAM; 1.50A {Escherichia coli} SCOP: c.66.1.2 PDB: 1eiz_A* Back     alignment and structure
>1jg1_A PIMT;, protein-L-isoaspartate O-methyltransferase; rossmann methyltransferase, protein repair isomerization; HET: SAH; 1.20A {Pyrococcus furiosus} SCOP: c.66.1.7 PDB: 1jg2_A* 1jg3_A* 1jg4_A* Back     alignment and structure
>2h1r_A Dimethyladenosine transferase, putative; SGC toronto dimethyladenosine transferase, structural genomics, structural genomics consortium; 1.89A {Plasmodium falciparum} Back     alignment and structure
>2f8l_A Hypothetical protein LMO1582; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: MSE SAM; 2.20A {Listeria monocytogenes} SCOP: c.66.1.45 Back     alignment and structure
>1nkv_A Hypothetical protein YJHP; structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.90A {Escherichia coli} SCOP: c.66.1.21 Back     alignment and structure
>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans} Back     alignment and structure
>2nyu_A Putative ribosomal RNA methyltransferase 2; SAM, structural genomics, structural genomics consortium, SGC; HET: SAM; 1.76A {Homo sapiens} Back     alignment and structure
>1uwv_A 23S rRNA (uracil-5-)-methyltransferase RUMA; RNA modification, iron-sulfur cluster, RNA processing; 1.95A {Escherichia coli} SCOP: b.40.4.12 c.66.1.40 PDB: 2bh2_A* Back     alignment and structure
>2jjq_A Uncharacterized RNA methyltransferase pyrab10780; metal-binding, tRNA methyltransferase, S-adenosyl-L-methionine, iron, 4Fe-4S, iron-sulfur; HET: SAH; 1.8A {Pyrococcus abyssi} PDB: 2vs1_A* Back     alignment and structure
>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>2vdv_E TRNA (guanine-N(7)-)-methyltransferase; S-adenosyl-L-methionine, phosphorylation, M7G, spout MT, tRNA processing; HET: SAM; 2.30A {Saccharomyces cerevisiae} PDB: 2vdu_E Back     alignment and structure
>1fbn_A MJ fibrillarin homologue; MJ proteins, ribosomal RNA processing, snoRNP, structural genomics, BSGC structure funded by NIH; 1.60A {Methanocaldococcus jannaschii} SCOP: c.66.1.3 PDB: 1g8s_A Back     alignment and structure
>2xvm_A Tellurite resistance protein TEHB; antibiotic resistance, transferase; HET: SAH; 1.48A {Escherichia coli} PDB: 2xva_A* 4dq0_A* 2i6g_A* Back     alignment and structure
>3dmg_A Probable ribosomal RNA small subunit methyltransf; monomethyltranserase, 16S rRNA methyltransferase, N2 G1207 methyltransferase; HET: SAH; 1.55A {Thermus thermophilus} PDB: 3dmf_A* 3dmh_A* 2zul_A* 2zwv_A* Back     alignment and structure
>1wy7_A Hypothetical protein PH1948; seven-stranded beta sheet, methyltransferase fold, structura genomics, transferase; HET: SAH; 2.20A {Pyrococcus horikoshii} SCOP: c.66.1.32 Back     alignment and structure
>1vbf_A 231AA long hypothetical protein-L-isoaspartate O- methyltransferase; trimeric coiled coil assembly; 2.80A {Sulfolobus tokodaii} SCOP: c.66.1.7 Back     alignment and structure
>3orh_A Guanidinoacetate N-methyltransferase; structura genomics, structural genomics consortium, SGC; HET: SAH; 1.86A {Homo sapiens} PDB: 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A* Back     alignment and structure
>2p41_A Type II methyltransferase; vizier, viral enzymes involved in replication, dengue virus methyltransferase, structural genomics; HET: G1G SAH CIT; 1.80A {Dengue virus 2} SCOP: c.66.1.25 PDB: 2p1d_A* 1l9k_A* 2p3o_A* 2p3q_A* 2p40_A* 2p3l_A* 1r6a_A* Back     alignment and structure
>3bus_A REBM, methyltransferase; rebeccamycin synthesis; HET: SAH; 2.65A {Lechevalieria aerocolonigenes} Back     alignment and structure
>3mgg_A Methyltransferase; NYSGXRC, PSI-II, protein structure initiative, structural genomics, NEW YORK SGX research center for structural genomics; 1.86A {Methanosarcina mazei} Back     alignment and structure
>3dlc_A Putative S-adenosyl-L-methionine-dependent methyltransferase; structural genomics, joint center for structural genomics; HET: MSE SAM; 1.15A {Methanococcus maripaludis} Back     alignment and structure
>3jwh_A HEN1; methyltransferase; HET: SAH; 2.20A {Anabaena variabilis} PDB: 3jwj_A Back     alignment and structure
>2o57_A Putative sarcosine dimethylglycine methyltransferase; structural genomics, protein structure initiative, PSI-2; 1.95A {Galdieria sulphuraria} SCOP: c.66.1.18 Back     alignment and structure
>1ri5_A MRNA capping enzyme; methyltransferase, M7G, messenger RNA CAP, structural genomics, PSI, protein structure initiative; 2.10A {Encephalitozoon cuniculi} SCOP: c.66.1.34 PDB: 1ri2_A* 1ri3_A* 1ri1_A* 1ri4_A 1z3c_A* 2hv9_A* Back     alignment and structure
>3ckk_A TRNA (guanine-N(7)-)-methyltransferase; mettl1, S-adenosyl-L-methionine, tRNA Pro structural genomics, structural genomics consortium, SGC; HET: SAM; 1.55A {Homo sapiens} Back     alignment and structure
>3gu3_A Methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative, northeast structural genomics consortium, NESG; HET: SAH; 2.30A {Bacillus cereus} SCOP: c.66.1.49 PDB: 2gh1_A Back     alignment and structure
>2fk8_A Methoxy mycolic acid synthase 4; S-adenosylmethionine-dependent methyltransferase fold, trans; HET: SAM; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 2fk7_A* 3ha3_A* 3ha5_A* 3ha7_A* Back     alignment and structure
>3ocj_A Putative exported protein; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: PLM; 1.39A {Bordetella parapertussis} Back     alignment and structure
>2pjd_A Ribosomal RNA small subunit methyltransferase C; gene duplication, RNA modification, SAM binding; 2.10A {Escherichia coli} Back     alignment and structure
>2ih2_A Modification methylase TAQI; DNA, DNA methyltransferase, target base partner, 5-methylpyr 2(1H)-ONE, base flipping; HET: 5PY 6MA NEA; 1.61A {Thermus aquaticus} SCOP: c.66.1.27 d.287.1.1 PDB: 2ibs_A* 2ibt_A* 2ih4_A* 2ih5_A* 2jg3_A* 2np6_A* 2np7_A* 1aqj_A* 1aqi_A* 2adm_A* 1g38_A* Back     alignment and structure
>3ujc_A Phosphoethanolamine N-methyltransferase; parasite; HET: PC; 1.19A {Plasmodium falciparum} PDB: 3uj9_A* 3uj6_A* 3uj7_A* 3uj8_A* 3uja_A 3ujb_A* 4fgz_A* 3ujd_A* Back     alignment and structure
>1jsx_A Glucose-inhibited division protein B; methyltransferase fold, structural genomics, PSI, protein structure initiative; 2.40A {Escherichia coli} SCOP: c.66.1.20 Back     alignment and structure
>2pxx_A Uncharacterized protein MGC2408; structural genomics consortium, SGC, methyltransferase, LOC84291, transferase; HET: SAH; 1.30A {Homo sapiens} Back     alignment and structure
>2okc_A Type I restriction enzyme stysji M protein; NP_813429.1, N-6 DNA methylase, type I restriction enzyme ST protein; HET: SAM; 2.20A {Bacteroides thetaiotaomicron vpi-5482} SCOP: c.66.1.45 Back     alignment and structure
>2nxc_A L11 mtase, ribosomal protein L11 methyltransferase; transferase S-adenosly-L-methionine dependent methyltransfer posttranslational modification; 1.59A {Thermus thermophilus} SCOP: c.66.1.39 PDB: 1ufk_A 2nxe_A* 2nxj_A 2nxn_A 2zbp_A* 2zbq_A* 2zbr_A* 3cjq_A* 3cjr_A* 3cju_A* 3egv_A* 3cjt_A* Back     alignment and structure
>3kr9_A SAM-dependent methyltransferase; class I rossmann-like methyltransferase fold; 2.00A {Streptococcus pneumoniae} PDB: 3ku1_A* Back     alignment and structure
>3dtn_A Putative methyltransferase MM_2633; structural genomics, unknown function, PSI-2, protein structure initiative; 2.09A {Methanosarcina mazei} Back     alignment and structure
>1kpg_A CFA synthase;, cyclopropane-fatty-acyl-phospholipid synthase 1; mixed alpha beta fold, structural genomics, PSI; HET: SAH 16A; 2.00A {Mycobacterium tuberculosis} SCOP: c.66.1.18 PDB: 1kp9_A* 1kph_A* 1tpy_A* 1l1e_A* Back     alignment and structure
>3mq2_A 16S rRNA methyltransferase; methyltranferase, ribosomal, antibiotic resistance, aminoglycoside, S-adenosyl-L-methionine; HET: SAH; 1.69A {Streptomyces SP} Back     alignment and structure
>3jwg_A HEN1, methyltransferase type 12; 1.90A {Clostridium thermocellum} PDB: 3jwi_A Back     alignment and structure
>1ve3_A Hypothetical protein PH0226; dimer, riken structural genomics/proteomics initiative, RSGI, structural genomics, unknown function, NPPSFA; HET: SAM; 2.10A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>3m70_A Tellurite resistance protein TEHB homolog; structural genomics, PSI-2, protein ST initiative; 1.95A {Haemophilus influenzae} Back     alignment and structure
>2kw5_A SLR1183 protein; structural genomics, northeast structural genomics consortium (NESG), PSI-2, protein structure initiative, unknown function; NMR {Synechocystis} PDB: 3mer_A Back     alignment and structure
>3g5t_A Trans-aconitate 3-methyltransferase; structural genomics, protein structure initiative, PSI, center for eukaryotic structural genomics; HET: MSE SAH T8N; 1.12A {Saccharomyces cerevisiae} Back     alignment and structure
>4fsd_A Arsenic methyltransferase; rossmann fold; 1.75A {Cyanidioschyzon SP} PDB: 4fr0_A* 4fs8_A 3p7e_A 3qnh_A 3qhu_A Back     alignment and structure
>3ou2_A SAM-dependent methyltransferase; O-methyltransferase, SAH; HET: SAH; 1.50A {Streptomyces luridus} PDB: 3ou6_A* 3ou7_A* Back     alignment and structure
>1m6y_A S-adenosyl-methyltransferase MRAW; SAM-dependent methyltransferase fold, protein-cofactor product complex, structural genomics, PSI; HET: SAH; 1.90A {Thermotoga maritima} SCOP: a.60.13.1 c.66.1.23 PDB: 1n2x_A* Back     alignment and structure
>3sm3_A SAM-dependent methyltransferases; NESG, structural genomics, PSI-biology, protein structure in northeast structural genomics; 2.20A {Methanosarcina mazei} Back     alignment and structure
>1zq9_A Probable dimethyladenosine transferase; SGC, structural genomics, structural genomics consortium; HET: SAM; 1.90A {Homo sapiens} SCOP: c.66.1.24 Back     alignment and structure
>3ofk_A Nodulation protein S; NODS, N-methyltransferase, SAH, SAM, NOD factor, fixation, symbiosis, alpha/beta structure; HET: SAH; 1.85A {Bradyrhizobium SP} PDB: 3ofj_A* Back     alignment and structure
>1pjz_A Thiopurine S-methyltransferase; polymorphism, S-adenosylmethionine, drug metabolism; NMR {Pseudomonas syringae PV} SCOP: c.66.1.36 Back     alignment and structure
>3bkx_A SAM-dependent methyltransferase; YP_807781.1, cyclopropane-fatty-acyl-phospholipid synthase-L protein, methyltransferase domain; 1.85A {Lactobacillus casei} Back     alignment and structure
>1xtp_A LMAJ004091AAA; SGPP, structural genomics, PSI, protein structure initiative dependent methyltransferase; HET: SAI; 1.94A {Leishmania major} SCOP: c.66.1.42 Back     alignment and structure
>2p8j_A S-adenosylmethionine-dependent methyltransferase; NP_349143.1; HET: PGE GOL; 2.00A {Clostridium acetobutylicum} Back     alignment and structure
>2h00_A Methyltransferase 10 domain containing protein; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.54 Back     alignment and structure
>2fyt_A Protein arginine N-methyltransferase 3; structural genomics, structural genomics consortium, SGC; HET: SAH; 2.00A {Homo sapiens} SCOP: c.66.1.6 PDB: 3smq_A* 1f3l_A* Back     alignment and structure
>3g07_A 7SK snRNA methylphosphate capping enzyme; structural genomics consortium (SGC), methyltransferase, phosphoprotein, S-adenosyl-L-methionine; HET: SAM; 2.65A {Homo sapiens} Back     alignment and structure
>3q7e_A Protein arginine N-methyltransferase 1; HET: SAH; 2.20A {Rattus norvegicus} PDB: 1orh_A* 1ori_A* 1or8_A* Back     alignment and structure
>3gnl_A Uncharacterized protein, DUF633, LMOF2365_1472; structural genomics, PSI-2, protein structure initiative; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>2bm8_A Cephalosporin hydroxylase CMCI; cephamycin biosynthesis; 2.5A {Streptomyces clavuligerus} SCOP: c.66.1.50 PDB: 2bm9_A* 2br5_A* 2br4_A* 2br3_A* Back     alignment and structure
>3lec_A NADB-rossmann superfamily protein; PSI, MCSG, structural genomics, midwest CENT structural genomics, protein structure initiative; 1.80A {Streptococcus agalactiae} Back     alignment and structure
>2xyq_A Putative 2'-O-methyl transferase; transferase-viral protein complex, rossman fold; HET: SAH; 2.00A {Sars coronavirus} PDB: 2xyv_A* 2xyr_A* Back     alignment and structure
>4htf_A S-adenosylmethionine-dependent methyltransferase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE SAM; 1.60A {Escherichia coli} Back     alignment and structure
>2ex4_A Adrenal gland protein AD-003; methyltransferase, structural genomics, SGC, structural genomics consortium; HET: SAH; 1.75A {Homo sapiens} SCOP: c.66.1.42 Back     alignment and structure
>2vdw_A Vaccinia virus capping enzyme D1 subunit; nucleotidyltransferase, S-adenosyl-L-methionine, RNA metabolism, mRNA processing, methyltransferase, poxvirus; HET: SAH; 2.70A {Vaccinia virus} Back     alignment and structure
>1mjf_A Spermidine synthase; spermidine synthetase, structural genomics, PSI, protein structure initiative; 1.80A {Pyrococcus furiosus} SCOP: c.66.1.17 PDB: 2e5w_A* 2zsu_A* Back     alignment and structure
>3g5l_A Putative S-adenosylmethionine dependent methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.35A {Listeria monocytogenes str} Back     alignment and structure
>2ar0_A M.ecoki, type I restriction enzyme ecoki M protein; structural genomics, protein structure initiative, nysgxrc; 2.80A {Escherichia coli} SCOP: c.66.1.45 PDB: 2y7c_B 2y7h_B* Back     alignment and structure
>3thr_A Glycine N-methyltransferase; GNMT, folate, methyltransferase binding, liver cytosol, transferase-transferase inhibitor C; HET: C2F TAM; 2.00A {Rattus norvegicus} SCOP: c.66.1.5 PDB: 3ths_A* 1xva_A* 1d2c_A 1kia_A* 1nbh_A* 1bhj_A* 2idj_A 2idk_A* 1d2g_A 1d2h_A* 1nbi_A* 1r8x_A 1r8y_A 1r74_A* 2azt_A* Back     alignment and structure
>3g2m_A PCZA361.24; SAM-dependent methyltransferase, glycopeptide antibiotics biosynthesis, structural genomics; 2.00A {Amycolatopsis orientalis} PDB: 3g2o_A* 3g2p_A* 3g2q_A* Back     alignment and structure
>2p35_A Trans-aconitate 2-methyltransferase; SAM dependent methyltrans agrobacterium tumefaciens, structural genomics, PSI-2; HET: SAH; 1.95A {Agrobacterium tumefaciens str} Back     alignment and structure
>3r0q_C Probable protein arginine N-methyltransferase 4.2; arginine methyltransferase, methylation; HET: SAH; 2.61A {Arabidopsis thaliana} Back     alignment and structure
>3hnr_A Probable methyltransferase BT9727_4108; structural genomics, PSI-2, protein structure initiative; 2.80A {Bacillus thuringiensis serovarkonkukian} Back     alignment and structure
>1g6q_1 HnRNP arginine N-methyltransferase; SAM-binding domain, beta-barrel, mixed alpha-beta, hexamer; 2.90A {Saccharomyces cerevisiae} SCOP: c.66.1.6 Back     alignment and structure
>3d2l_A SAM-dependent methyltransferase; ZP_00538691.1, structural G joint center for structural genomics, JCSG; HET: MSE; 1.90A {Exiguobacterium sibiricum 255-15} Back     alignment and structure
>3bkw_A MLL3908 protein, S-adenosylmethionine dependent methyltransferase; NP_104914.1; HET: MSE; 1.60A {Mesorhizobium loti} Back     alignment and structure
>2yqz_A Hypothetical protein TTHA0223; RNA methyltransferase, SAM, structural genomics, NPPSFA; HET: SAM; 1.80A {Thermus thermophilus} PDB: 2yr0_A Back     alignment and structure
>2y1w_A Histone-arginine methyltransferase CARM1; histone modification; HET: SFG 849; 2.10A {Homo sapiens} PDB: 2y1x_A* 3b3f_A* 3b3g_A 2v74_B* 2v7e_A Back     alignment and structure
>1ne2_A Hypothetical protein TA1320; structural genomics, conserved hypothetical protein, PSI, protein structure initiative; 1.75A {Thermoplasma acidophilum} SCOP: c.66.1.32 Back     alignment and structure
>1wzn_A SAM-dependent methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; HET: SAH; 1.90A {Pyrococcus horikoshii} SCOP: c.66.1.43 Back     alignment and structure
>3q87_B N6 adenine specific DNA methylase; SAM-methyltransferase, methyltransferase, methylation, trans activator-transferase complex; HET: SAM; 2.00A {Encephalitozoon cuniculi} Back     alignment and structure
>1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A Back     alignment and structure
>3uwp_A Histone-lysine N-methyltransferase, H3 lysine-79; epigenetics, tubercidin, structu genomics, structural genomics consortium, SGC; HET: 5ID; 2.05A {Homo sapiens} PDB: 4eqz_A* 3sx0_A* 4er0_A* 4er7_A* 1nw3_A* 4er6_A* 4er5_A* 3qow_A* 3qox_A* 4ek9_A* 4ekg_A* 4eki_A* 4er3_A* 3sr4_A* Back     alignment and structure
>2oxt_A Nucleoside-2'-O-methyltransferase; flavivirus, viral enzyme, RNA capping, S-adenosyl-L-methionine, viral protein; HET: SAM; 2.90A {Meaban virus} Back     alignment and structure
>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* Back     alignment and structure
>3cgg_A SAM-dependent methyltransferase; NP_600671.1, methyltransferase domain, structural genomics; HET: NHE CIT; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>1y8c_A S-adenosylmethionine-dependent methyltransferase; structural genomics, protein structure initiative, PSI; 2.50A {Clostridium acetobutylicum} SCOP: c.66.1.43 Back     alignment and structure
>2wa2_A Non-structural protein 5; transferase, S-adenosyl-L- methionine, virion, membrane, flavivirus, N7-methyltransferase, 2'-O-methyltransferase; HET: SAM; 1.80A {Modoc virus} PDB: 2wa1_A* Back     alignment and structure
>3p2e_A 16S rRNA methylase; methyltransferase, transferase, NPMA; HET: SAH; 1.68A {Escherichia coli} PDB: 3p2i_A 3p2k_A* 3pb3_A* 3mte_A* Back     alignment and structure
>3e23_A Uncharacterized protein RPA2492; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAM; 1.60A {Rhodopseudomonas palustris} Back     alignment and structure
>2r6z_A UPF0341 protein in RSP 3' region; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; 1.80A {Neisseria gonorrhoeae} Back     alignment and structure
>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17 Back     alignment and structure
>3bgv_A MRNA CAP guanine-N7 methyltransferase; alternative splicing, mRNA capping, mRNA processing, nucleus, phosphoprotein, RNA-binding; HET: SAH; 2.30A {Homo sapiens} PDB: 3epp_A* Back     alignment and structure
>3dli_A Methyltransferase; PSI-II, NYSGXRC, structural genomics, protein structure initiative; 2.46A {Archaeoglobus fulgidus} Back     alignment and structure
>2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A* 3rw9_A* Back     alignment and structure
>3ccf_A Cyclopropane-fatty-acyl-phospholipid synthase; YP_321342.1, putative methyltransferase; 1.90A {Anabaena variabilis atcc 29413} Back     alignment and structure
>3i9f_A Putative type 11 methyltransferase; structural genomics, PSI-2, protein structure initiative; 2.50A {Sulfolobus solfataricus} Back     alignment and structure
>2a14_A Indolethylamine N-methyltransferase; SGC,INMT, structural genomics, structural genomics consortium; HET: SAH; 1.70A {Homo sapiens} SCOP: c.66.1.15 Back     alignment and structure
>3m33_A Uncharacterized protein; structural genomics, PSI-2, protein structure initiative, MCSG, midwest center for structural genomics; 2.19A {Deinococcus radiodurans} Back     alignment and structure
>3ldu_A Putative methylase; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE GTP; 1.70A {Clostridium difficile} Back     alignment and structure
>3l8d_A Methyltransferase; structural genomics, PSI, nysgrc, protein structure initiative, NEW YORK SGX research center for STRU genomics; 1.70A {Bacillus thuringiensis} Back     alignment and structure
>3bwc_A Spermidine synthase; SAM, SGPP, structura genomics, PSI, protein structure initiative, structural GEN pathogenic protozoa consortium; HET: MSE SAM; 2.30A {Trypanosoma cruzi} PDB: 3bwb_A* Back     alignment and structure
>2i7c_A Spermidine synthase; transferase, structural genomics consor; HET: AAT 1PG; 1.71A {Plasmodium falciparum} PDB: 2hte_A* 3b7p_A* 3rie_A* 2pwp_A* Back     alignment and structure
>3iv6_A Putative Zn-dependent alcohol dehydrogenase; alpha/beta fold, rossmann-fold, structural genomics, PSI-2, structure initiative; HET: SAM; 2.70A {Rhodobacter sphaeroides} Back     alignment and structure
>2pt6_A Spermidine synthase; transferase, structural genomics consor SGC,dcadoMet complex; HET: S4M 1PG; 2.00A {Plasmodium falciparum} PDB: 2pss_A* 2pt9_A* Back     alignment and structure
>2p7i_A Hypothetical protein; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; 1.74A {Pectobacterium atrosepticum SCRI1043} SCOP: c.66.1.41 PDB: 2p7h_A Back     alignment and structure
>1q7h_A Conserved hypothetical protein; structural genomics, MCSG, PSI, PR structure initiative; 2.10A {Thermoplasma acidophilum dsm 1728} SCOP: b.122.1.1 d.17.6.2 Back     alignment and structure
>3k0b_A Predicted N6-adenine-specific DNA methylase; methylase,PF01170, putative RNA methylase, PSI,MCSG, structu genomics; 1.50A {Listeria monocytogenes str} Back     alignment and structure
>2i62_A Nicotinamide N-methyltransferase; structural genomics, structural genomics consortium, SGC; HET: SAH; 1.80A {Mus musculus} PDB: 2iip_A* 3rod_A* Back     alignment and structure
>1u2z_A Histone-lysine N-methyltransferase, H3 lysine-79 specific; histone methyltransferase, nucleosome; HET: SAH; 2.20A {Saccharomyces cerevisiae} SCOP: c.66.1.31 Back     alignment and structure
>3h2b_A SAM-dependent methyltransferase; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3r90_A Malignant T cell-amplified sequence 1; structural genomics consortium, surface entropy reduction, S binding protein; 1.70A {Homo sapiens} Back     alignment and structure
>3lkd_A Type I restriction-modification system methyltransferase subunit; Q5M500_STRT2, STU0711, NESG, SUR80, structural genomics, PSI-2; 2.25A {Streptococcus thermophilus} Back     alignment and structure
>3ege_A Putative methyltransferase from antibiotic biosyn pathway; YP_324569.1, putative methyltransferase from antibiotic BIOS pathway; 2.40A {Anabaena variabilis atcc 29413} Back     alignment and structure
>1uir_A Polyamine aminopropyltransferase; spermidien synthase, spermine synthase, riken STR genomics/proteomics initiative, RSGI; 2.00A {Thermus thermophilus} SCOP: c.66.1.17 PDB: 3anx_A* Back     alignment and structure
>3htx_A HEN1; HEN1, small RNA methyltransferase, protein-RNA complex; HET: SAH; 3.10A {Arabidopsis thaliana} Back     alignment and structure
>3d79_A PUA domain, putative uncharacterized protein PH0734; unknown function; 1.73A {Pyrococcus horikoshii} Back     alignment and structure
>3b3j_A Histone-arginine methyltransferase CARM1; protein arginine methyltransferase 4, APO catalytic domain, regulator, mRNA processing; 2.55A {Rattus norvegicus} Back     alignment and structure
>3ldg_A Putative uncharacterized protein SMU.472; YPSC, methyltransferase, transferase; HET: SAH; 1.96A {Streptococcus mutans} Back     alignment and structure
>2aot_A HMT, histamine N-methyltransferase; classic methyltransferase fold, protein-drug complex; HET: CSO 2PM SAH; 1.90A {Homo sapiens} SCOP: c.66.1.19 PDB: 1jqd_A* 2aou_A* 2aov_A* 2aox_A* 1jqe_A* 2aow_A* Back     alignment and structure
>3bzb_A Uncharacterized protein; RED ALGA, protein structure initiat center for eukaryotic structural genomics, CESG, structural genomics; 2.79A {Cyanidioschyzon merolae} Back     alignment and structure
>3lcc_A Putative methyl chloride transferase; halide methyltransferase; HET: SAH; 1.80A {Arabidopsis thaliana} Back     alignment and structure
>3ll7_A Putative methyltransferase; methytransferase, structural genomics, MCSG, PSI-2, protein initiative; HET: MSE; 1.80A {Porphyromonas gingivalis} Back     alignment and structure
>2b2c_A Spermidine synthase; beta-alpha, transferase; 2.50A {Caenorhabditis elegans} SCOP: c.66.1.17 Back     alignment and structure
>3zv0_C H/ACA ribonucleoprotein complex subunit 4; cell cycle, RNP assembly, X-linked dyskeratosis congenita; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3fzg_A 16S rRNA methylase; methyltransferase, plasmid, transferase; HET: SAM; 2.00A {Escherichia coli} Back     alignment and structure
>2gs9_A Hypothetical protein TT1324; methyl transferase, structural genomics, NPPSFA, national PR protein structural and functional analyses; HET: SAH; 2.60A {Thermus thermophilus} Back     alignment and structure
>3bxo_A N,N-dimethyltransferase; desosamine, sugar, carbohydrate, antibiotic, SAM, adoMet; HET: SAM UPP; 2.00A {Streptomyces venezuelae} Back     alignment and structure
>3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3khk_A Type I restriction-modification system methylation subunit; structural genomics, PSI-2, protein structure initiative; 2.55A {Methanosarcina mazei} Back     alignment and structure
>2g72_A Phenylethanolamine N-methyltransferase; HET: SAM F21; 2.00A {Homo sapiens} SCOP: c.66.1.15 PDB: 1yz3_A* 2an4_A* 2an5_A* 2g70_A* 2g71_A* 2an3_A* 2g8n_A* 2ony_A* 3hcb_A* 3hcc_A* 3hcd_A* 3hcf_A* 3kpj_A* 3kpu_A* 3kpv_A* 3kpw_A* 3kpy_A* 3kqm_A* 3kqo_A* 3kqp_A* ... Back     alignment and structure
>2avn_A Ubiquinone/menaquinone biosynthesis methyltransfe related protein; ubiquinone/menaquinone biosynthesis methyltransferase-relate protein; HET: SAI; 2.35A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>3e8s_A Putative SAM dependent methyltransferase; NP_744700.1, structural genomics, joint center for structural genom JCSG; HET: SAH; 2.10A {Pseudomonas putida KT2440} Back     alignment and structure
>4hg2_A Methyltransferase type 11; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MES; 1.60A {Anaeromyxobacter dehalogenans} Back     alignment and structure
>3pfg_A N-methyltransferase; N,N-dimethyltransferase, SAM binding, DTDP-linked sugar BIND transferase; HET: SAM TLO; 1.35A {Streptomyces fradiae} PDB: 3pfh_A* 3px3_A* 3px2_A* Back     alignment and structure
>1p91_A Ribosomal RNA large subunit methyltransferase A; RLMA, RRMA, 23S rRNA, NESG, structural genomics, PSI, protein structure initiative; HET: SAM; 2.80A {Escherichia coli} SCOP: c.66.1.33 Back     alignment and structure
>3ggd_A SAM-dependent methyltransferase; YP_325210.1, structural GEN joint center for structural genomics, JCSG; HET: SAH; 2.11A {Anabaena variabilis atcc 29413} Back     alignment and structure
>2r3s_A Uncharacterized protein; methyltransferase domain, structural genomics, joint center structural genomics, JCSG, protein structure initiative; HET: MSE; 2.15A {Nostoc punctiforme} Back     alignment and structure
>1yub_A Ermam, rRNA methyltransferase; MLS antibiotics; NMR {Streptococcus pneumoniae} SCOP: c.66.1.24 Back     alignment and structure
>1qzz_A RDMB, aclacinomycin-10-hydroxylase; anthracycline, methyltransferase, polyketide, tailoring enzymes, structural proteomics in E spine; HET: SAM; 2.10A {Streptomyces purpurascens} SCOP: a.4.5.29 c.66.1.12 PDB: 1r00_A* 1xds_A* 1xdu_A* Back     alignment and structure
>1tw3_A COMT, carminomycin 4-O-methyltransferase; anthracycline, methylate, tailoring enzyme, polyketide, S-adenosyl-L-homocystein; HET: SAH ERT; 2.35A {Streptomyces peucetius} SCOP: a.4.5.29 c.66.1.12 PDB: 1tw2_A* Back     alignment and structure
>1x19_A CRTF-related protein; methyltransferase, bacteriochllochlorophyll, BCHU, SAM, SAH, adenosylmethyonine, S-adenosylhomocysteine, ADO-Met; 2.27A {Chlorobium tepidum} PDB: 1x1a_A* 1x1b_A* 1x1c_A* 1x1d_A* Back     alignment and structure
>3cc8_A Putative methyltransferase; structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PS transferase; 1.64A {Bacillus cereus} Back     alignment and structure
>2oyr_A UPF0341 protein YHIQ; alpha-beta protein, structural genomics, PSI-2, protein structure initiative; HET: SAH; 2.00A {Shigella flexneri 2A} SCOP: c.66.1.55 PDB: 2pgx_A 2pkw_A Back     alignment and structure
>4hc4_A Protein arginine N-methyltransferase 6; HRMT1L6, S-adenosyl-L-homocysteine, struc genomics, structural genomics consortium, SGC; HET: SAH; 1.97A {Homo sapiens} Back     alignment and structure
>3i53_A O-methyltransferase; CO-complex, rossmann-like fold; HET: SAH; 2.08A {Streptomyces carzinostaticus subsp} PDB: 3i58_A* 3i5u_A* 3i64_A* Back     alignment and structure
>3gwz_A MMCR; methyltransferase, mitomycin, S-adenosyl methionine, transferase; HET: MSE SAH; 1.91A {Streptomyces lavendulae} PDB: 3gxo_A* Back     alignment and structure
>3v97_A Ribosomal RNA large subunit methyltransferase L; YCBY, RNA methyltransferase, ribosome RNA, SAH, RLML; HET: SAH OSU; 2.20A {Escherichia coli} PDB: 3v8v_A* Back     alignment and structure
>3gru_A Dimethyladenosine transferase; rossman fold, ribosomal assem adenosyl-L-methionine, rRNA, methyltransferase, RNA-binding processing; HET: AMP; 1.60A {Methanocaldococcus jannaschii} PDB: 3grr_A* 3grv_A* 3gry_A* 3fyd_A 3fyc_A* Back     alignment and structure
>2ip2_A Probable phenazine-specific methyltransferase; pyocyanin, phenazine-1-carboxy PHZM; 1.80A {Pseudomonas aeruginosa} Back     alignment and structure
>2px2_A Genome polyprotein [contains: capsid protein C (core protein); envelope protein M...; methyltransferase, SAH; HET: SAH; 2.00A {Murray valley encephalitis virus} PDB: 2px4_A* 2px5_A* 2pxa_A* 2pxc_A* 2px8_A* 2oy0_A* Back     alignment and structure
>3mcz_A O-methyltransferase; adomet_mtases, S-adenosylmethionine-dependent methyltransfer structural genomics, PSI-2; HET: MSE; 1.90A {Burkholderia thailandensis} Back     alignment and structure
>2cx0_A Hypothetical protein APE0525; PUA domain, structural genomics, NPPSFA, national project on structural and functional analyses; 1.80A {Aeropyrum pernix} SCOP: b.122.1.1 d.17.6.4 PDB: 2cx1_A* 1zs7_A Back     alignment and structure
>3sso_A Methyltransferase; macrolide, natural product, rossman fold; HET: SAH; 1.90A {Micromonospora griseorubida} PDB: 3ssn_A* 3ssm_A* Back     alignment and structure
>1qam_A ERMC' methyltransferase; rRNA methyltransferase ERMC', cofactor analogs; 2.20A {Bacillus subtilis} SCOP: c.66.1.24 PDB: 1qan_A* 1qao_A* 1qaq_A* 2erc_A Back     alignment and structure
>3s1s_A Restriction endonuclease bpusi; PD--(D/E)XK catalytic motif, gamma-N6M-adenosine methyltrans S-adenosyl-methionine binding, hydrolase; HET: SAH; 2.35A {Bacillus pumilus} Back     alignment and structure
>3ufb_A Type I restriction-modification system methyltran subunit; methyltransferase activity, transferase; 1.80A {Vibrio vulnificus} Back     alignment and structure
>3dp7_A SAM-dependent methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research; 2.33A {Bacteroides vulgatus} Back     alignment and structure
>3hp7_A Hemolysin, putative; structural genomics, APC64019, PSI-2, protein STR initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.53A {Streptococcus thermophilus} Back     alignment and structure
>1iq8_A Archaeosine tRNA-guanine transglycosylase; (alpha/beta)8 barrel, riken structural genomics/proteomics initiative, RSGI; 2.20A {Pyrococcus horikoshii} SCOP: b.122.1.1 c.1.20.1 d.17.6.1 PDB: 1it7_A* 1it8_A* 1j2b_A Back     alignment and structure
>2cmg_A Spermidine synthase; transferase, putrescine aminopropyltransferase, spermidine biosynthesis, polyamine biosynthesis, SPEE; 2.0A {Helicobacter pylori} PDB: 2cmh_A Back     alignment and structure
>2qe6_A Uncharacterized protein TFU_2867; putative methyltransferase, structural genomics, joint cente structural genomics, JCSG; HET: NEP SAM; 1.95A {Thermobifida fusca} Back     alignment and structure
>1vlm_A SAM-dependent methyltransferase; possible histamine methyltransferase, structural genomics, JCSG, protein struc initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.66.1.41 Back     alignment and structure
>3opn_A Putative hemolysin; structural genomics, PSI-2, protein structure initiative, NE SGX research center for structural genomics, nysgxrc; 2.05A {Lactococcus lactis subsp} Back     alignment and structure
>3frh_A 16S rRNA methylase; methyltransferase domain, helical N-terminal domain, methyltransferase, plasmid, transferase; HET: SAH; 1.20A {Escherichia coli} PDB: 3fri_A* 3b89_A* Back     alignment and structure
>1af7_A Chemotaxis receptor methyltransferase CHER; chemotaxis receptor methylation; HET: SAH; 2.00A {Salmonella typhimurium} SCOP: a.58.1.1 c.66.1.8 PDB: 1bc5_A* Back     alignment and structure
>2zfu_A Nucleomethylin, cerebral protein 1; nucleolar protein, SAM-binding protein, protein structure, N phosphoprotein, nuclear protein; HET: SAH; 2.00A {Homo sapiens} Back     alignment and structure
>4e2x_A TCAB9; kijanose, tetronitrose, tetradeoxy sugar, sugar methylation, transferase; HET: SAH TYD; 1.40A {Micromonospora chalcea} PDB: 3ndi_A* 3ndj_A* 4e32_A* 4e33_A* 4e2y_A* 4e31_A* 4e2w_A* 4e2z_A* 4e30_A* Back     alignment and structure
>1wg8_A Predicted S-adenosylmethionine-dependent methyltransferase; S-adenosyl-methyltransferase, MRAW; HET: SAM; 2.00A {Thermus thermophilus} SCOP: a.60.13.1 c.66.1.23 Back     alignment and structure
>3tqs_A Ribosomal RNA small subunit methyltransferase A; protein synthesis; 1.98A {Coxiella burnetii} SCOP: c.66.1.0 Back     alignment and structure
>3tka_A Ribosomal RNA small subunit methyltransferase H; HET: SAM CTN PG4; 2.25A {Escherichia coli} Back     alignment and structure
>3cvo_A Methyltransferase-like protein of unknown functio; rossman fold, structural genomics, joint center for structur genomics, JCSG; HET: MSE PG4; 1.80A {Silicibacter pomeroyi dss-3} Back     alignment and structure
>3eld_A Methyltransferase; flavivirus, RNA capping, guanylyltransfer viral enzyme structure; HET: SFG; 1.90A {Wesselsbron virus} PDB: 3elu_A* 3elw_A* 3ely_A* 3emb_A* 3emd_A* Back     alignment and structure
>3lst_A CALO1 methyltransferase; calicheamicin, enediyne, SAH, STRU genomics, PSI-2, protein structure initiative; HET: SAH; 2.40A {Micromonospora echinospora} Back     alignment and structure
>3evf_A RNA-directed RNA polymerase NS5; NS5 methyltransferase, RNA CAP binding, binding, capsid protein; HET: GTA SAH; 1.45A {Yellow fever virus} SCOP: c.66.1.0 PDB: 3evb_A* 3evc_A* 3evd_A* 3eve_A* 3eva_A* Back     alignment and structure
>3giw_A Protein of unknown function DUF574; rossmann-fold protein, structural genomics, joint center for structural genomics, JCSG; HET: MSE UNL; 1.45A {Streptomyces avermitilis} PDB: 3go4_A* Back     alignment and structure
>3lcv_B Sisomicin-gentamicin resistance methylase SGM; antibiotic resistance, methyltransferase, transferase; HET: SAM; 2.00A {Micromonospora zionensis} PDB: 3lcu_A* Back     alignment and structure
>2qy6_A UPF0209 protein YFCK; structural genomics, unknown function, PSI-2, protein struct initiative; 2.00A {Escherichia coli} Back     alignment and structure
>3gcz_A Polyprotein; flavivirus, RNA capping, methyltransferase, viral enzyme STR ATP-binding, nucleotide-binding, RNA replication, structura genomics; HET: SAM; 1.70A {Yokose virus} Back     alignment and structure
>3fut_A Dimethyladenosine transferase; methyltransferase, dimethyltransferase, dual-specific methyltransferase, 16S rRNA methyltransferase; 1.52A {Thermus thermophilus} PDB: 3fuu_A* 3fuv_A 3fuw_A* 3fux_A* Back     alignment and structure
>3uzu_A Ribosomal RNA small subunit methyltransferase A; ssgcid, seattle structural genomics center for infectio disease; 1.75A {Burkholderia pseudomallei} Back     alignment and structure
>2q07_A Uncharacterized protein AF0587; monomer, structural genomics, PSI-2, protein structure initiative; 2.04A {Archaeoglobus fulgidus dsm 4304} SCOP: b.122.1.1 c.18.1.4 d.17.6.5 Back     alignment and structure
>2ld4_A Anamorsin; methyltransferase-like fold, alpha/beta fold, iron-sulfur PR biogenesis, apoptosis; NMR {Homo sapiens} PDB: 2yui_A Back     alignment and structure
>4a6d_A Hydroxyindole O-methyltransferase; melatonin, circadian clock; HET: SAM; 2.40A {Homo sapiens} PDB: 4a6e_A* Back     alignment and structure
>3reo_A (ISO)eugenol O-methyltransferase; directed evolution, saturation mutagenesis, regioselectivity transferase; HET: SAH EUG; 1.90A {Clarkia breweri} PDB: 3tky_A* 1kyz_A* 1kyw_A* Back     alignment and structure
>4azs_A Methyltransferase WBDD; kinase; HET: AMP SAM; 2.15A {Escherichia coli} PDB: 4azt_A* 4azv_A* 4azw_A* Back     alignment and structure
>3p9c_A Caffeic acid O-methyltransferase; S-adenosylmethionine dependent O-methyltransferase; HET: SAH; 1.80A {Lolium perenne} PDB: 3p9i_A* 3p9k_A* Back     alignment and structure
>2wk1_A NOVP; transferase, O-methyltransferase, novobiocin, TYLF superfamily; HET: SAH; 1.40A {Streptomyces caeruleus} Back     alignment and structure
>4auk_A Ribosomal RNA large subunit methyltransferase M; YGDE; HET: TLA PGE; 1.90A {Escherichia coli} PDB: 4atn_A* 4b17_A* Back     alignment and structure
>1fp1_D Isoliquiritigenin 2'-O-methyltransferase; protein-substrate, protein-product complex; HET: SAH HCC; 1.82A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpq_A* Back     alignment and structure
>1fp2_A Isoflavone O-methyltransferase; protein-product complex; HET: SAH HMO; 1.40A {Medicago sativa} SCOP: a.4.5.29 c.66.1.12 PDB: 1fpx_A* 2qyo_A* Back     alignment and structure
>1qyr_A KSGA, high level kasugamycin resistance protein, S-adenosylMet; adenosine dimethyltransferase, rRNA modification, transferase, translation; 2.10A {Escherichia coli} SCOP: c.66.1.24 PDB: 4adv_V 3tpz_A Back     alignment and structure
>3ftd_A Dimethyladenosine transferase; KSGA, rossmann-like fold, RNA methyltransferase, mtase, anti resistance, methyltransferase, RNA-binding; 1.44A {Aquifex aeolicus} PDB: 3ftc_A 3fte_A 3ftf_A* 3r9x_B* Back     alignment and structure
>3p8z_A Mtase, non-structural protein 5; methyltransferase, RNA, ER, transferase-transferase inhibito; HET: 36A SAH; 1.70A {Dengue virus 3} SCOP: c.66.1.25 PDB: 3p97_A* 2xbm_A* 3evg_A* Back     alignment and structure
>2p38_A Protein involved in ribosomal biogenesis; two alpha/beta domains, PUA domain, biosynthetic protein; 1.80A {Pyrococcus abyssi} Back     alignment and structure
>2oo3_A Protein involved in catabolism of external DNA; structural genomics, unknown function, PSI-2, protein structure initiative; 2.00A {Legionella pneumophila subsp} SCOP: c.66.1.59 Back     alignment and structure
>1zg3_A Isoflavanone 4'-O-methyltransferase; rossman fold, plant Pro transferase; HET: 2HI SAH; 2.35A {Medicago truncatula} PDB: 1zga_A* 1zhf_A* 1zgj_A* Back     alignment and structure
>3r24_A NSP16, 2'-O-methyl transferase; methyltransferase, zinc-finger, transferase, viral protein; HET: SAM; 2.00A {Sars coronavirus} Back     alignment and structure
>3lkz_A Non-structural protein 5; flavivirus, methyltransferase, inhibitor, P nucleotide-binding, RNA replication, viral protein; HET: SFG; 2.00A {West nile virus} Back     alignment and structure
>3u28_A H/ACA ribonucleoprotein complex subunit 4; pseudouridine synthase, pseudouridylation, H/ACA RNA; 1.90A {Saccharomyces cerevisiae} PDB: 3uai_A Back     alignment and structure
>3o4f_A Spermidine synthase; aminopropyltransferase, polyamine synthase, rossmann fold, P biosynthesis, spermidine biosynthesis, transferase; 2.90A {Escherichia coli} Back     alignment and structure
>3c6k_A Spermine synthase; spermidine aminopropyltransferase, SPMSY, structural genomics, structural genomics consortium, SGC, phosphoprotein; HET: SPD MTA; 1.95A {Homo sapiens} PDB: 3c6m_A* Back     alignment and structure
>3ua3_A Protein arginine N-methyltransferase 5; TIM-barrel, rossmann fold, beta-barrel, symmetric arginine dimethylase, SAM binding; HET: SAH; 3.00A {Caenorhabditis elegans} PDB: 3ua4_A Back     alignment and structure
>4gqb_A Protein arginine N-methyltransferase 5; TIM barrel, beta-propeller, methyltransferase, methylation, transferase-protein binding complex; HET: 0XU; 2.06A {Homo sapiens} PDB: 4g56_A* Back     alignment and structure
>3g7u_A Cytosine-specific methyltransferase; DNA-binding, NAD-binding, structural GENO protein structure initiative, PSI; 1.75A {Escherichia coli O157} Back     alignment and structure
>2j5v_A Glutamate 5-kinase; proline biosynthesis, gamma glutamyl kinase, amino-acid biosynthesis, transferase, feedback regulation, PUA domain; HET: RGP; 2.5A {Escherichia coli} PDB: 2j5t_A* 2w21_A Back     alignment and structure
>1g55_A DNA cytosine methyltransferase DNMT2; human DNA methyltransferase homologue; HET: DNA SAH; 1.80A {Homo sapiens} SCOP: c.66.1.26 Back     alignment and structure
>1pl8_A Human sorbitol dehydrogenase; NAD, oxidoreductase; HET: NAD; 1.90A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 1pl7_A 1pl6_A* 3qe3_A Back     alignment and structure
>2zig_A TTHA0409, putative modification methylase; methyltransferase, S- adenosylmethionine, structural genomics, NPPSFA; 2.10A {Thermus thermophilus} PDB: 2zie_A* 2zif_A Back     alignment and structure
>2zig_A TTHA0409, putative modification methylase; methyltransferase, S- adenosylmethionine, structural genomics, NPPSFA; 2.10A {Thermus thermophilus} PDB: 2zie_A* 2zif_A Back     alignment and structure
>2c7p_A Modification methylase HHAI; DNA methyltransferase, methyltransferase, base flipping, restriction system, transferase; HET: 5CM A1P SAH EPE CIT; 1.7A {Haemophilus haemolyticus} SCOP: c.66.1.26 PDB: 10mh_A* 1m0e_A* 1mht_A* 1hmy_A* 1skm_A* 2c7o_A* 2c7q_A* 2hmy_B* 2hr1_A* 3eeo_A* 3mht_A* 4mht_A* 5mht_A* 6mht_A* 7mht_A* 8mht_A* 9mht_A* 2zcj_A* 2z6u_A* 2z6q_A* ... Back     alignment and structure
>3s2e_A Zinc-containing alcohol dehydrogenase superfamily; FURX, oxidoreductase; HET: NAD; 1.76A {Ralstonia eutropha} PDB: 3s1l_A* 3s2f_A* 3s2g_A* 3s2i_A* 1llu_A* 3meq_A* Back     alignment and structure
>2py6_A Methyltransferase FKBM; YP_546752.1, structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; 2.15A {Methylobacillus flagellatus KT} SCOP: c.66.1.56 Back     alignment and structure
>3jv7_A ADH-A; dehydrogenase, nucleotide binding, rossmann-fold, oxidoreduc; HET: NAD; 2.00A {Rhodococcus ruber} PDB: 2xaa_A* Back     alignment and structure
>2dph_A Formaldehyde dismutase; dismutation of aldehydes, oxidoreductase; HET: NAD; 2.27A {Pseudomonas putida} Back     alignment and structure
>1sqw_A Saccharomyces cerevisiae NIP7P homolog; PUA, unknown function; 1.90A {Homo sapiens} SCOP: b.122.1.1 d.17.6.3 PDB: 1t5y_A Back     alignment and structure
>4eez_A Alcohol dehydrogenase 1; site-saturation mutagenesis, directed evolution, isobutyraldehyde, biofuel, oxidoreductase; HET: PG4; 1.90A {Lactococcus lactis subsp} PDB: 4eex_A* Back     alignment and structure
>1e3j_A NADP(H)-dependent ketose reductase; oxidoreductase, fructose reduction; 2.3A {Bemisia argentifolii} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>4ej6_A Putative zinc-binding dehydrogenase; structural genomics, nysgrc, PSI-biology, NEW YORK structura genomics research consortium; 1.89A {Sinorhizobium meliloti} PDB: 4ejm_A* Back     alignment and structure
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Back     alignment and structure
>3fpc_A NADP-dependent alcohol dehydrogenase; oxydoreductase, bacterial alcohol dehydrogenase, domain exchange, chimera, metal-binding; 1.40A {Thermoanaerobacter brockii} PDB: 2nvb_A* 1ykf_A* 1bxz_A* 3ftn_A 3fsr_A 1y9a_A* 2oui_A* 3fpl_A* 1jqb_A 1kev_A* 1ped_A 2b83_A Back     alignment and structure
>3b5i_A S-adenosyl-L-methionine:salicylic acid carboxyl methyltransferase-like protein; sabath family, indole-3-acetic acid, S-AD methionine; HET: SAH; 2.75A {Arabidopsis thaliana} Back     alignment and structure
>1kol_A Formaldehyde dehydrogenase; oxidoreductase; HET: NAD; 1.65A {Pseudomonas putida} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>4a2c_A Galactitol-1-phosphate 5-dehydrogenase; oxidoreductase, metal binding-site; 1.87A {Escherichia coli} Back     alignment and structure
>2aus_C Pseudouridine synthase; isomerase, structural protein, isomerase-structural protein; 2.10A {Pyrococcus abyssi} PDB: 3lwr_A 3lwo_A* 3lwq_A* 3lwp_A 3lwv_A 3hax_A* 2hvy_A* 3hay_A* 2ey4_A 2rfk_A 3mqk_A 3hjw_A* 3hjy_A Back     alignment and structure
>1f8f_A Benzyl alcohol dehydrogenase; rossmann fold, oxidoreductase; HET: NAD; 2.20A {Acinetobacter calcoaceticus} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1p0f_A NADP-dependent alcohol dehydrogenase; ADH topology, NADP(H)-dependent, oxidoreductase; HET: NAP; 1.80A {Rana perezi} SCOP: b.35.1.2 c.2.1.1 PDB: 1p0c_A* Back     alignment and structure
>1cdo_A Alcohol dehydrogenase; oxidoreductase, oxidoreductase (CH-OH(D)-NAD(A)); HET: NAD; 2.05A {Gadus callarias} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1e3i_A Alcohol dehydrogenase, class II; HET: NAD; 2.08A {Mus musculus} SCOP: b.35.1.2 c.2.1.1 PDB: 1e3e_A* 1e3l_A* 3cos_A* Back     alignment and structure
>2jhf_A Alcohol dehydrogenase E chain; oxidoreductase, metal coordination, NAD, zinc, inhibition, acetylation, metal-binding; HET: NAD; 1.0A {Equus caballus} SCOP: b.35.1.2 c.2.1.1 PDB: 1adc_A* 1adf_A* 1adg_A* 1adb_A* 1bto_A* 1heu_A* 1hf3_A* 1hld_A* 1lde_A* 1ldy_A* 1mg0_A* 1n92_A* 1p1r_A* 1ye3_A 1het_A* 2jhg_A* 2ohx_A* 2oxi_A* 3bto_A* 4dwv_A* ... Back     alignment and structure
>2fzw_A Alcohol dehydrogenase class III CHI chain; S-nitrosoglutathione reductase, glutathione-dependent formaldehyde dehydrogenase, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 PDB: 3qj5_A* 1mc5_A* 2fze_A* 1m6w_A* 1ma0_A* 1mp0_A* 1teh_A* 1m6h_A* Back     alignment and structure
>2qrv_A DNA (cytosine-5)-methyltransferase 3A; DNA methyltransferase 3A (DNMT3A) and ITS regulatory factor; HET: DNA SAH; 2.89A {Homo sapiens} Back     alignment and structure
>1vj0_A Alcohol dehydrogenase, zinc-containing; TM0436, structural G JCSG, PSI, protein structure initiative, joint center for S genomics; 2.00A {Thermotoga maritima} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2apo_A Probable tRNA pseudouridine synthase B; protein-protein complex, box H/ACA, snoRNP, pseudouridine synthase, RNA modification; 1.95A {Methanocaldococcus jannaschii} SCOP: b.122.1.1 d.265.1.2 Back     alignment and structure
>3uko_A Alcohol dehydrogenase class-3; alcohol dehydrogenase III, homodimer, reduction of GSNO, NAD binding, oxidoreductase; HET: NAD SO4; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>1g60_A Adenine-specific methyltransferase MBOIIA; structural genomics, DNA methylation, S- adenosylmethionine, PSI, protein structure initiative; HET: SAM; 1.74A {Moraxella bovis} SCOP: c.66.1.11 Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Back     alignment and structure
>1i4w_A Mitochondrial replication protein MTF1; mitochondrial transcription factor, transcription initiation; 2.60A {Saccharomyces cerevisiae} SCOP: c.66.1.24 Back     alignment and structure
>3two_A Mannitol dehydrogenase; cinnamyl-alcohol dehydrogenase, NADP(H) oxidoreductase; HET: NDP; 2.18A {Helicobacter pylori} Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Back     alignment and structure
>4dvj_A Putative zinc-dependent alcohol dehydrogenase Pro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.99A {Rhizobium etli} Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>4h0n_A DNMT2; SAH binding, transferase; HET: SAH; 2.71A {Spodoptera frugiperda} Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>3qv2_A 5-cytosine DNA methyltransferase; DNMT2, ehmeth; HET: SAH; 2.15A {Entamoeba histolytica} Back     alignment and structure
>1boo_A Protein (N-4 cytosine-specific methyltransferase PVU II); type II DNA-(cytosine N4) methyltransferase, amino methylation, selenomethionine; HET: SAH; 2.80A {Proteus vulgaris} SCOP: c.66.1.11 Back     alignment and structure
>2k4m_A TR8_protein, UPF0146 protein MTH_1000; alpha+beta, rossman fold, structural genomics, PSI-2; NMR {Methanothermobacterthermautotrophicus str} Back     alignment and structure
>1g60_A Adenine-specific methyltransferase MBOIIA; structural genomics, DNA methylation, S- adenosylmethionine, PSI, protein structure initiative; HET: SAM; 1.74A {Moraxella bovis} SCOP: c.66.1.11 Back     alignment and structure
>3fbg_A Putative arginate lyase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.60A {Staphylococcus haemolyticus} Back     alignment and structure
>3ip1_A Alcohol dehydrogenase, zinc-containing; structural genomics, metal-binding, oxidoreductase, PSI-2, protein structure initiative; 2.09A {Thermotoga maritima} Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>2d8a_A PH0655, probable L-threonine 3-dehydrogenase; pyrococcus horikoshii OT3, structural genomics; HET: NAD; 2.05A {Pyrococcus horikoshii} PDB: 2dfv_A* 3gfb_A* Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Back     alignment and structure
>1eg2_A Modification methylase RSRI; rossmann fold, exocyclic amino DNA methyltransferase RSRI, D binding, DNA modification, DNA methylation; HET: MTA; 1.75A {Rhodobacter sphaeroides} SCOP: c.66.1.11 PDB: 1nw5_A* 1nw6_A* 1nw7_A* 1nw8_A Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>2b5w_A Glucose dehydrogenase; nucleotide binding motif, oxidoreductase; HET: FLC NAP; 1.60A {Haloferax mediterranei} PDB: 2b5v_A* 2vwg_A* 2vwh_A* 2vwp_A* 2vwq_A* Back     alignment and structure
>3gaz_A Alcohol dehydrogenase superfamily protein; oxidoreductase, PSI-II, alcohol dehydrogenase superf structural genomics; 1.96A {Novosphingobium aromaticivorans} Back     alignment and structure
>3vyw_A MNMC2; tRNA wobble uridine, modification enzyme, genetic CODE, 5- methylaminomethyl-2-thiouridine, methyltransferase; HET: SAM; 2.49A {Aquifex aeolicus} PDB: 2e58_A* Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>2efj_A 3,7-dimethylxanthine methyltransferase; SAM-dependant methyltransferase, SAH, theobromine; HET: SAH 37T; 2.00A {Coffea canephora} PDB: 2eg5_A* Back     alignment and structure
>4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* Back     alignment and structure
>3krt_A Crotonyl COA reductase; structural genomics, protein structure initiative, NYSGXRC, PSI-2; 2.19A {Streptomyces coelicolor} PDB: 3hzz_A Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>4a0s_A Octenoyl-COA reductase/carboxylase; oxidoreductase, transferase, cinnabaramide PKS biosynthesis; HET: CO8 NAP; 1.90A {Streptomyces SP} PDB: 4a10_A Back     alignment and structure
>3ubt_Y Modification methylase HAEIII; protein-DNA complex, DNA cytosine-5 methyltransferase, DNA B S-adenosyl methionine binding; HET: ATP 2PE; 2.50A {Haemophilus aegyptius} PDB: 1dct_A* Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>1m6e_X S-adenosyl-L-methionnine:salicylic acid carboxyl methyltransferase; rossmann fold, protein-small molecule complex; HET: SAH SAL; 3.00A {Clarkia breweri} SCOP: c.66.1.35 Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>1gu7_A Enoyl-[acyl-carrier-protein] reductase [NADPH, B-specific] 1,mitochondrial; oxidoreductase, thioester reduction, fatty acids; 1.70A {Candida tropicalis} SCOP: b.35.1.2 c.2.1.1 PDB: 1guf_A* 1n9g_B* 1n9g_A* 1gyr_A 1h0k_A Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>2c0c_A Zinc binding alcohol dehydrogenase, domain containing 2; oxidoreductase, quinone oxidoreductase, medium-chain dehydrogenase/reductase; HET: NAP; 1.45A {Homo sapiens} PDB: 2x1h_A* 2x7h_A* 2wek_A* Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Back     alignment and structure
>3tos_A CALS11; methyltransferase, calicheamicin, structural genomic protein structure initiative, PSI, natPro; HET: MSE SAH GLU; 1.55A {Micromonospora echinospora} PDB: 4gf5_A* Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>3tqh_A Quinone oxidoreductase; HET: NDP; 2.44A {Coxiella burnetii} Back     alignment and structure
>3me5_A Cytosine-specific methyltransferase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.75A {Shigella flexneri 2A} PDB: 3lx6_A Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Back     alignment and structure
>1boo_A Protein (N-4 cytosine-specific methyltransferase PVU II); type II DNA-(cytosine N4) methyltransferase, amino methylation, selenomethionine; HET: SAH; 2.80A {Proteus vulgaris} SCOP: c.66.1.11 Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>1eg2_A Modification methylase RSRI; rossmann fold, exocyclic amino DNA methyltransferase RSRI, D binding, DNA modification, DNA methylation; HET: MTA; 1.75A {Rhodobacter sphaeroides} SCOP: c.66.1.11 PDB: 1nw5_A* 1nw6_A* 1nw7_A* 1nw8_A Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Back     alignment and structure
>3pi7_A NADH oxidoreductase; groes-like fold, NAD(P)-binding rossmann fold, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.71A {Mesorhizobium loti} Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>3pvc_A TRNA 5-methylaminomethyl-2-thiouridine biosynthes bifunctional protein MNMC; structural genomics, PSI-biology; HET: FAD; 2.31A {Yersinia pestis} PDB: 3sgl_A* Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* Back     alignment and structure
>1zsy_A Mitochondrial 2-enoyl thioester reductase; medium-chain dehydrogenase/reductase, oxidoreductase, 2-ENOY thioester reductase; 1.75A {Homo sapiens} PDB: 2vcy_A Back     alignment and structure
>1uuf_A YAHK, zinc-type alcohol dehydrogenase-like protein YAHK; oxidoreductase, zinc binding, oxydoreductase, metal-binding; 1.76A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 495
d2b9ea1293 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) 3e-09
d1sqga2284 c.66.1.38 (A:145-428) Ribosomal RNA small subunit 7e-09
d1sqga2284 c.66.1.38 (A:145-428) Ribosomal RNA small subunit 6e-04
d1ixka_313 c.66.1.38 (A:) Hypothetical methyltransferase PH13 9e-08
d1ixka_313 c.66.1.38 (A:) Hypothetical methyltransferase PH13 6e-06
d2apoa185 b.122.1.1 (A:247-331) Pseudouridine synthase II Tr 3e-07
d2ey4a184 b.122.1.1 (A:253-336) Pseudouridine synthase II Tr 3e-06
d2as0a2324 c.66.1.51 (A:73-396) Hypothetical protein PH1915, 5e-06
d1q7ha185 b.122.1.1 (A:69-153) Hypothetical protein Ta1423, 8e-06
d1nt2a_209 c.66.1.3 (A:) Fibrillarin homologue {Archaeon Arch 2e-05
d1wxxa2318 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280 6e-05
d2cx1a193 b.122.1.1 (A:91-183) Hypothetical protein APE0525, 1e-04
d1g8aa_227 c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyro 1e-04
d2b25a1324 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 2e-04
d2igta1309 c.66.1.51 (A:1-309) Putative methyltransferase Atu 2e-04
d1iq8a377 b.122.1.1 (A:506-582) Archaeosine tRNA-guanine tra 5e-04
d2b78a2317 c.66.1.51 (A:69-385) Hypothetical protein SMu776, 7e-04
d1yb2a1250 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {T 0.002
d1r3ea181 b.122.1.1 (A:238-318) Pseudouridine synthase II Tr 0.002
d1l3ia_186 c.66.1.22 (A:) Precorrin-6Y methyltransferase (Cbi 0.002
>d2b9ea1 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) [TaxId: 9606]} Length = 293 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: NOL1/NOP2/sun
domain: NOL1R
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 55.9 bits (133), Expect = 3e-09
 Identities = 31/120 (25%), Positives = 56/120 (46%), Gaps = 3/120 (2%)

Query: 219 EGIAVDMHNRIFQLPSFYDVLEGEIFLQNLPSIVTAHALDPQKGERILDMCAAPGGKTTA 278
           E +       + + P +     G + LQ+  S + A  LDP  G  ++D CAAPG KT+ 
Sbjct: 55  ELLVFPAQTDLHEHPLY---RAGHLILQDRASCLPAMLLDPPPGSHVIDACAAPGNKTSH 111

Query: 279 IASLLRDEGEVVAVDRSHNKVMDIQKLAAEMGLKCITTYKLDALKAVRRKNESNDEPNMC 338
           +A+LL+++G++ A D    ++  +  L A  G+ C    + D L         ++   + 
Sbjct: 112 LAALLKNQGKIFAFDLDAKRLASMATLLARAGVSCCELAEEDFLAVSPSDPRYHEVHYIL 171
>d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]} Length = 284 Back     information, alignment and structure
>d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]} Length = 284 Back     information, alignment and structure
>d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 313 Back     information, alignment and structure
>d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 313 Back     information, alignment and structure
>d2apoa1 b.122.1.1 (A:247-331) Pseudouridine synthase II TruB, C-terminal domain {Archaeon Methanococcus jannaschii [TaxId: 2190]} Length = 85 Back     information, alignment and structure
>d2ey4a1 b.122.1.1 (A:253-336) Pseudouridine synthase II TruB, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Length = 84 Back     information, alignment and structure
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 324 Back     information, alignment and structure
>d1q7ha1 b.122.1.1 (A:69-153) Hypothetical protein Ta1423, C-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Length = 85 Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Length = 209 Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Length = 318 Back     information, alignment and structure
>d2cx1a1 b.122.1.1 (A:91-183) Hypothetical protein APE0525, C-terminal domain {Archaeon Aeropyrum pernix [TaxId: 56636]} Length = 93 Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 227 Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Length = 324 Back     information, alignment and structure
>d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} Length = 309 Back     information, alignment and structure
>d1iq8a3 b.122.1.1 (A:506-582) Archaeosine tRNA-guanine transglycosylase, C3 domain {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 77 Back     information, alignment and structure
>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} Length = 317 Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Length = 250 Back     information, alignment and structure
>d1r3ea1 b.122.1.1 (A:238-318) Pseudouridine synthase II TruB, C-terminal domain {Thermotoga maritima [TaxId: 2336]} Length = 81 Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 186 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query495
d1ixka_313 Hypothetical methyltransferase PH1374 {Archaeon Py 100.0
d1sqga2284 Ribosomal RNA small subunit methyltransferase B, R 100.0
d2b9ea1293 NOL1R {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1wxxa2318 Hypothetical protein TTHA1280, middle and C-termin 99.87
d2b78a2317 Hypothetical protein SMu776, middle and C-terminal 99.82
d2as0a2324 Hypothetical protein PH1915, middle and C-terminal 99.81
d2igta1309 Putative methyltransferase Atu0340 {Agrobacterium 99.68
d1o54a_266 Hypothetical protein TM0748 {Thermotoga maritima [ 99.58
d1i9ga_264 Probable methyltransferase Rv2118c {Mycobacterium 99.55
d1g8aa_227 Fibrillarin homologue {Archaeon Pyrococcus horikos 99.47
d1yb2a1250 Hypothetical protein Ta0852 {Thermoplasma acidophi 99.46
d1l3ia_186 Precorrin-6Y methyltransferase (CbiT) {Archaeon Me 99.45
d1nt2a_209 Fibrillarin homologue {Archaeon Archaeoglobus fulg 99.43
d1m6ya2192 TM0872, methyltransferase domain {Thermotoga marit 99.42
d2b25a1324 Hypothetical protein FLJ20628 {Human (Homo sapiens 99.4
d1xxla_234 Hypothetical protein YcgJ {Bacillus subtilis [TaxI 99.39
d1dusa_194 Hypothetical protein MJ0882 {Archaeon Methanococcu 99.39
d2frna1260 Hypothetical protein PH0793 {Pyrococcus horikoshii 99.37
d1dl5a1213 Protein-L-isoaspartyl O-methyltransferase {Thermot 99.37
d1vl5a_231 Hypothetical protein BH2331 {Bacillus halodurans [ 99.3
d1nkva_245 Hypothetical Protein YjhP {Escherichia coli [TaxId 99.24
d2o57a1282 Putative sarcosine dimethylglycine methyltransfera 99.22
d2apoa185 Pseudouridine synthase II TruB, C-terminal domain 99.22
d1i1na_224 Protein-L-isoaspartyl O-methyltransferase {Human ( 99.2
d2esra1152 Putative methyltransferase SPy1538 {Streptococcus 99.18
d2b3ta1274 N5-glutamine methyltransferase, HemK {Escherichia 99.17
d1kpia_291 CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} 99.15
d1uwva2358 rRNA (Uracil-5-)-methyltransferase RumA, catalytic 99.11
d2fcaa1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacil 99.09
d1ve3a1226 Hypothetical protein PH0226 {Archaeon Pyrococcus h 99.09
d2i6ga1198 Putative methyltransferase TehB {Salmonella typhim 99.08
d2ey4a184 Pseudouridine synthase II TruB, C-terminal domain 99.07
d1iq8a377 Archaeosine tRNA-guanine transglycosylase, C3 doma 99.06
d2fhpa1182 Putative methylase EF2452 {Enterococcus faecalis [ 99.06
d1ri5a_252 mRNA cap (Guanine N-7) methyltransferase {Fungus ( 99.05
d2fpoa1183 Methylase YhhF {Escherichia coli [TaxId: 562]} 99.05
d2fk8a1280 Methoxy mycolic acid synthase 4, Mma4 {Mycobacteri 99.05
d1ws6a1171 Methyltransferase TTHA0928 {Thermus thermophilus [ 99.04
d2nxca1254 PrmA-like protein TTHA0656 (TT0836) {Thermus therm 99.04
d1jg1a_215 Protein-L-isoaspartyl O-methyltransferase {Archaeo 99.03
d1kpga_285 CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} 99.02
d2ex4a1222 Adrenal gland protein AD-003 (C9orf32) {Human (Hom 99.01
d1zx0a1229 Guanidinoacetate methyltransferase {Human (Homo sa 99.0
d1q7ha185 Hypothetical protein Ta1423, C-terminal domain {Ar 99.0
d1r3ea181 Pseudouridine synthase II TruB, C-terminal domain 98.97
d1vbfa_224 Protein-L-isoaspartyl O-methyltransferase {Sulfolo 98.96
d1im8a_225 Hypothetical protein HI0319 (YecO) {Haemophilus in 98.96
d1g8sa_230 Fibrillarin homologue {Archaeon Methanococcus jann 98.95
d1y8ca_246 Putative methyltransferase CAC2371 {Clostridium ac 98.95
d1wzna1251 Hypothetical methyltransferase PH1305 {Archaeon Py 98.95
d1wy7a1201 Hypothetical protein PH1948 {Archaeon Pyrococcus h 98.94
d1yzha1204 tRNA (guanine-N(7)-)-methyltransferase TrmB {Strep 98.93
d2gh1a1281 Methyltransferase BC2162 {Bacillus cereus [TaxId: 98.91
d1r18a_223 Protein-L-isoaspartyl O-methyltransferase {Fruit f 98.89
d2ifta1183 Putative methylase HI0767 {Haemophilus influenzae 98.85
d1wg8a2182 TM0872, methyltransferase domain {Thermus thermoph 98.83
d2avna1246 Hypothetical methyltransferase TM1389 {Thermotoga 98.82
d1xvaa_292 Glycine N-methyltransferase {Rat (Rattus norvegicu 98.78
d2ih2a1223 DNA methylase TaqI, N-terminal domain {Thermus aqu 98.77
d1pjza_201 Thiopurine S-methyltransferase {Pseudomonas syring 98.77
d2bzga1229 Thiopurine S-methyltransferase {Human (Homo sapien 98.76
d1p91a_268 rRNA methyltransferase RlmA {Escherichia coli [Tax 98.74
d2f8la1328 Hypothetical protein Lmo1582 {Listeria monocytogen 98.7
d2cx1a193 Hypothetical protein APE0525, C-terminal domain {A 98.67
d1xtpa_254 Hypothetical protein Lmaj004091aaa (LmjF30.0810) { 98.66
d2cl5a1214 Catechol O-methyltransferase, COMT {Rat (Rattus no 98.65
d1ej0a_180 RNA methyltransferase FtsJ {Escherichia coli [TaxI 98.64
d2avda1219 COMT domain-containing protein 1, COMTD1 {Human (H 98.63
d2a14a1257 Indolethylamine N-methyltransferase, INMT {Human ( 98.61
d1tw3a2253 Carminomycin 4-O-methyltransferase {Streptomyces p 98.58
d1nv8a_271 N5-glutamine methyltransferase, HemK {Thermotoga m 98.55
d1vlma_208 Possible histamine N-methyltransferase TM1293 {The 98.55
d2dula1375 N(2),N(2)-dimethylguanosine tRNA methyltransferase 98.53
d2fyta1311 Protein arginine N-methyltransferase 3, PRMT3 {Hum 98.49
d1susa1227 Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicag 98.47
d1oria_316 Protein arginine N-methyltransferase 1, PRMT1 {Rat 98.45
d2g72a1263 Phenylethanolamine N-methyltransferase, PNMTase {H 98.44
d1g6q1_328 Arginine methyltransferase, HMT1 {Baker's yeast (S 98.43
d2p7ia1225 Hypothetical protein ECA1738 {Erwinia carotovora [ 98.42
d1ne2a_197 Hypothetical protein Ta1320 {Archaeon Thermoplasma 98.42
d1jqea_280 Histamine methyltransferase {Human (Homo sapiens) 98.41
d2okca1425 Type I restriction enzyme StySJI M protein {Bacter 98.4
d2q07a168 Uncharacterized protein AF0587 {Archaeoglobus fulg 98.37
d2h00a1250 Methyltransferase 10 domain containing protein MET 98.34
d1nw3a_328 Catalytic, N-terminal domain of histone methyltran 98.32
d1qzza2256 Aclacinomycin-10-hydroxylase RdmB {Streptomyces pu 98.18
d1u2za_406 Catalytic, N-terminal domain of histone methyltran 98.11
d2ar0a1 524 M.EcoKI {Escherichia coli [TaxId: 562]} 97.99
d1jsxa_207 Glucose-inhibited division protein B (GidB) {Esche 97.74
d2oyra1250 Hypothetical protein YhiQ {Shigella flexneri [TaxI 97.67
d1xdza_239 Glucose-inhibited division protein B (GidB) {Bacil 97.62
d1uira_312 Spermidine synthase {Thermus thermophilus [TaxId: 97.6
d2p41a1257 An RNA cap (nucleoside-2'-O-)-methyltransferase do 97.41
d1inla_295 Spermidine synthase {Thermotoga maritima [TaxId: 2 97.38
d1mjfa_276 Putative spermidine synthetase PF0127 (SpeE) {Arch 97.36
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 97.32
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 97.3
d1iy9a_274 Spermidine synthase {Bacillus subtilis [TaxId: 142 97.23
d1kola2195 Formaldehyde dehydrogenase {Pseudomonas putida [Ta 97.17
d2o07a1285 Spermidine synthase {Human (Homo sapiens) [TaxId: 97.17
d2b2ca1312 Spermidine synthase {Caenorhabditis elegans [TaxId 97.11
d1qama_235 rRNA adenine dimethylase {Bacillus subtilis, Ermc' 97.09
d1f8fa2174 Benzyl alcohol dehydrogenase {Acinetobacter calcoa 96.93
d1xj5a_290 Spermidine synthase {Thale cress (Arabidopsis thal 96.89
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 96.67
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 96.67
d1piwa2168 Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeas 96.62
d1af7a2193 Chemotaxis receptor methyltransferase CheR, C-term 96.45
d1zq9a1278 Probable dimethyladenosine transferase {Human (Hom 96.43
d1e3ia2174 Alcohol dehydrogenase {Mouse (Mus musculus), class 96.32
d1h2ba2172 Alcohol dehydrogenase {Archaeon Aeropyrum pernix [ 96.24
d1yuba_245 rRNA adenine dimethylase {Streptococcus pneumoniae 96.05
d1rjwa2168 Alcohol dehydrogenase {Bacillus stearothermophilus 96.02
d1llua2166 Alcohol dehydrogenase {Pseudomonas aeruginosa [Tax 95.97
d2as0a172 Hypothetical protein PH1915, N-terminal domain {Ar 95.97
d1jvba2170 Alcohol dehydrogenase {Archaeon Sulfolobus solfata 95.96
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 95.87
d1iz0a2171 Quinone oxidoreductase {Thermus thermophilus [TaxI 95.72
d1qyra_252 High level kasugamycin resistance protein KsgA {Es 95.69
d2bm8a1232 Cephalosporin hydroxylase CmcI {Streptomyces clavu 95.68
d2fzwa2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 95.63
d2jhfa2176 Alcohol dehydrogenase {Horse (Equus caballus) [Tax 95.3
d1uufa2168 Hypothetical protein YahK {Escherichia coli [TaxId 95.1
d1fp1d2244 Chalcone O-methyltransferase {Alfalfa (Medicago sa 94.95
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 94.87
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 94.62
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 93.71
d1cdoa2175 Alcohol dehydrogenase {Cod (Gadus callarias) [TaxI 93.4
d1g60a_256 Methyltransferase mboII {Moraxella bovis [TaxId: 4 93.11
d1d1ta2176 Alcohol dehydrogenase {Human (Homo sapiens), diffe 92.73
d1eg2a_279 m.RsrI N6 adenosine-specific DNA methyltransferase 92.54
d1p0fa2174 Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 92.36
d1xa0a2176 B. subtilis YhfP homologue {Bacillus stearothermop 92.05
d1fp2a2244 Isoflavone O-methyltransferase {Alfalfa (Medicago 91.67
d1g55a_ 343 DNMT2 {Human (Homo sapiens) [TaxId: 9606]} 91.59
d1g60a_ 256 Methyltransferase mboII {Moraxella bovis [TaxId: 4 91.4
d1booa_ 320 m.PvuII N4 cytosine-specific DNA methyltransferase 91.38
d1booa_320 m.PvuII N4 cytosine-specific DNA methyltransferase 91.36
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 90.93
d2c7pa1327 DNA methylase HhaI {Haemophilus haemolyticus [TaxI 90.65
d1kyza2243 Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltra 90.65
d1wmaa1275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 90.54
d1eg2a_ 279 m.RsrI N6 adenosine-specific DNA methyltransferase 90.06
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 90.05
d1dcta_324 DNA methylase HaeIII {Haemophilus aegyptius [TaxId 89.52
d1o9ga_249 rRNA methyltransferase AviRa {Streptomyces viridoc 89.45
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 88.95
d1i4wa_322 Transcription factor sc-mtTFB {Baker's yeast (Sacc 88.54
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 88.05
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 86.82
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 84.57
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 83.79
d2py6a1395 Methyltransferase FkbM {Methylobacillus flagellatu 83.19
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 83.03
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 82.7
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 82.3
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 82.03
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 81.47
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 81.1
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 81.01
d2f1ka2165 Prephenate dehydrogenase TyrA {Synechocystis sp. p 80.58
d1gu7a2189 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 80.51
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 80.18
>d1ixka_ c.66.1.38 (A:) Hypothetical methyltransferase PH1374 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: S-adenosyl-L-methionine-dependent methyltransferases
superfamily: S-adenosyl-L-methionine-dependent methyltransferases
family: NOL1/NOP2/sun
domain: Hypothetical methyltransferase PH1374
species: Archaeon Pyrococcus horikoshii [TaxId: 53953]

Probab=100.00  E-value=5.3e-50  Score=405.30  Aligned_cols=243  Identities=30%  Similarity=0.551  Sum_probs=198.3

Q ss_pred             cccCHHHHHHHHHhhchhhHHHHHHHhcCCCCccEEEeecCCCCHHHHHHHHHHHHHhcCCCccccccccccccCCCccc
Q 011036           13 LRWNPQVEEYFIRAYGADHFSRISKALTRPSCYSCIRVNTLKTTTDDVIQKLLAIIQNSGSSEADVASSVKGRLQNGTIS   92 (495)
Q Consensus        13 ~~~~~~v~~~l~~~~~~~~~~~~~~~l~~pp~~~~iRVNTl~~s~~~~~~~L~~~~~~~~~~~~~~~~~~~~~~~~~~~~   92 (495)
                      +.+.+-+.+.+.+.||+ .+++|++++.+||.. ||||||+|+|+++++++|.+.         |             +.
T Consensus        12 ~~~p~wl~~~~~~~~Ge-e~~~l~~a~~~~~p~-~iRvN~~k~~~e~~~~~L~~~---------g-------------~~   67 (313)
T d1ixka_          12 LGYSKLFADRYFQLWGE-RAIRIAEAMEKPLPR-CFRVNTLKISVQDLVKRLNKK---------G-------------FQ   67 (313)
T ss_dssp             TTCCHHHHHHHHHHHTT-HHHHHHHHTTSCCCC-EEEECTTTSCHHHHHHHHHHT---------T-------------CE
T ss_pred             cCCCHHHHHHHHHHhhH-HHHHHHHHcCCCCCe-EEEEcCCcCCHHHHHHHHHhC---------C-------------Cc
Confidence            45678899999999995 589999999998755 899999999999999998754         3             33


Q ss_pred             cccCCCCCceEEEeCCCCccccCCCCCCCCCCeEEEccchHHHHHcccccccCceeeccCCccCCCeEEEEEcccCCcCC
Q 011036           93 ESQIPGLEYVVFVKGSGPHTIDYGYEPDKPPKEVIVSRKCAEAVLRGAQVYVPGVMACSSHVEKGDVVAVSVAVEQPTLD  172 (495)
Q Consensus        93 ~~~~~~l~~~l~i~~~gp~~~~~~~~~~~~~k~ViVd~~~~eAVLrGA~v~aPGIl~~~~~i~~Gd~VaV~~~l~~~~~~  172 (495)
                      ...+|.+|+.+++... +                                                              
T Consensus        68 ~~~~~~~~~~~~~~~~-~--------------------------------------------------------------   84 (313)
T d1ixka_          68 FKRVPWAKEGFCLTRE-P--------------------------------------------------------------   84 (313)
T ss_dssp             EEEETTEEEEEEEEEC-S--------------------------------------------------------------
T ss_pred             eEECCCCcchhhhccC-C--------------------------------------------------------------
Confidence            3344444444433110 0                                                              


Q ss_pred             CCCccccccccccccCCCCCCcccCCCceEeecccccccccccccccceeeecCCcccccCCccccccccEEEccccHHH
Q 011036          173 GGWGLGITRGTVLQGSQTDPYYFERSGLYIGQGTAMMSRAGIFRASEGIAVDMHNRIFQLPSFYDVLEGEIFLQNLPSIV  252 (495)
Q Consensus       173 ~~w~~~~~rg~~l~~~~~~~~~~~r~~l~Vg~GialmSr~elf~~p~GIaVe~~~~v~~lp~~~~~~~G~i~lQ~l~S~v  252 (495)
                                                                            ..+..+|.   +++|.+++||.+|++
T Consensus        85 ------------------------------------------------------~~l~~~~~---~~~G~~~vQD~aS~l  107 (313)
T d1ixka_          85 ------------------------------------------------------FSITSTPE---FLTGLIYIQEASSMY  107 (313)
T ss_dssp             ------------------------------------------------------SCGGGSHH---HHTTSEEECCHHHHH
T ss_pred             ------------------------------------------------------CccccCHh---hhhceEEEecccccc
Confidence                                                                  00112222   358999999999999


Q ss_pred             HHhhcCCCCCCeEEEecCCCChHHHHHHHhcCCCcEEEEEeCChHHHHHHHHHHHHhCCCceEEEEcchhHHHHhhCCCC
Q 011036          253 TAHALDPQKGERILDMCAAPGGKTTAIASLLRDEGEVVAVDRSHNKVMDIQKLAAEMGLKCITTYKLDALKAVRRKNESN  332 (495)
Q Consensus       253 ~~~~LdpqpGerVLDmCAaPGgKT~~iA~lm~~~G~ViA~D~s~~kv~~i~~~a~~~gl~~i~~~~~Da~~~~~~~~~~~  332 (495)
                      ++++|+|+||++||||||||||||+|||.+|+++|.|+|+|++.+|+..++++++++|+.++..+..|++..-       
T Consensus       108 ~~~~l~~~~g~~vlD~CAapGgKt~~l~~~~~~~~~i~a~d~~~~r~~~l~~~~~r~~~~~i~~~~~d~~~~~-------  180 (313)
T d1ixka_         108 PPVALDPKPGEIVADMAAAPGGKTSYLAQLMRNDGVIYAFDVDENRLRETRLNLSRLGVLNVILFHSSSLHIG-------  180 (313)
T ss_dssp             HHHHHCCCTTCEEEECCSSCSHHHHHHHHHTTTCSEEEEECSCHHHHHHHHHHHHHHTCCSEEEESSCGGGGG-------
T ss_pred             hhhcccCCccceeeecccchhhhhHhhhhhcccccceeeeccCHHHHHHHHHHHHHHHhhccccccccccccc-------
Confidence            9999999999999999999999999999999999999999999999999999999999999888877765420       


Q ss_pred             CCCCccCCCCCccccccccccccccccccchhccCCCCCCcccccccccccccccccchhhhhhhhhhccCCCCCCccCC
Q 011036          333 DEPNMCNSKDNNYITSQTSDSMKLHKEVPSIAAEGLNGDKSCKEKVSNEKGVERTYVSKADTRKNMRRMRNGPGRNQCLG  412 (495)
Q Consensus       333 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~k~~~~~~~~~~~~~~~~  412 (495)
                                                                                                      
T Consensus       181 --------------------------------------------------------------------------------  180 (313)
T d1ixka_         181 --------------------------------------------------------------------------------  180 (313)
T ss_dssp             --------------------------------------------------------------------------------
T ss_pred             --------------------------------------------------------------------------------
Confidence                                                                                            


Q ss_pred             CCccCCCCCCCCCccEEEEcCCCCCCCCc---ccchhhhhcHHHHHHhHHHHHHHHHHHHhcCCCCCEEEEEeCCCCCcC
Q 011036          413 GRAENSKGFSPNSFDRVLLDAPCSALGLR---PRLFAAEETIQSLRNHGKYQRRMFDQAVQLVRPGGIIVYSTCTINPGE  489 (495)
Q Consensus       413 g~~~~~~~f~~~sFDrVLlDaPCSglG~r---p~l~~~~~t~~~l~~~a~~Qrrll~~A~~lLkpGG~LVYSTCTi~p~E  489 (495)
                              .....||+||+||||||+|+.   |.+.+ .++.+++..++.+|++||.+|+++|||||+|||||||++++|
T Consensus       181 --------~~~~~fD~ILvDaPCSg~G~~~r~p~~~~-~~~~~~~~~l~~~Q~~iL~~a~~~lk~gG~lVYsTCSl~~eE  251 (313)
T d1ixka_         181 --------ELNVEFDKILLDAPCTGSGTIHKNPERKW-NRTMDDIKFCQGLQMRLLEKGLEVLKPGGILVYSTCSLEPEE  251 (313)
T ss_dssp             --------GGCCCEEEEEEECCTTSTTTCC---------CCHHHHHHHHHHHHHHHHHHHHHEEEEEEEEEEESCCCGGG
T ss_pred             --------cccccccEEEEccccccCCceeeccchhh-hhhhhHHHHHHHHHHHHHHhhhheeCCCcEEEEeeccCChHh
Confidence                    013479999999999999983   66666 678899999999999999999999999999999999999999


Q ss_pred             cccccC
Q 011036          490 NEALCA  495 (495)
Q Consensus       490 NE~vV~  495 (495)
                      ||+||+
T Consensus       252 NE~VV~  257 (313)
T d1ixka_         252 NEFVIQ  257 (313)
T ss_dssp             THHHHH
T ss_pred             HHHHHH
Confidence            999983
>d1sqga2 c.66.1.38 (A:145-428) Ribosomal RNA small subunit methyltransferase B, RsmB (Sun, Fmu/Fmv), C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b9ea1 c.66.1.38 (A:133-425) NOL1R {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d2as0a2 c.66.1.51 (A:73-396) Hypothetical protein PH1915, middle and C-terminal domains {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2igta1 c.66.1.51 (A:1-309) Putative methyltransferase Atu0340 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1o54a_ c.66.1.13 (A:) Hypothetical protein TM0748 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1i9ga_ c.66.1.13 (A:) Probable methyltransferase Rv2118c {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1g8aa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1yb2a1 c.66.1.13 (A:6-255) Hypothetical protein Ta0852 {Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1l3ia_ c.66.1.22 (A:) Precorrin-6Y methyltransferase (CbiT) {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1nt2a_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1m6ya2 c.66.1.23 (A:2-114,A:216-294) TM0872, methyltransferase domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2b25a1 c.66.1.13 (A:6-329) Hypothetical protein FLJ20628 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xxla_ c.66.1.41 (A:) Hypothetical protein YcgJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1dusa_ c.66.1.4 (A:) Hypothetical protein MJ0882 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2frna1 c.66.1.47 (A:19-278) Hypothetical protein PH0793 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1dl5a1 c.66.1.7 (A:1-213) Protein-L-isoaspartyl O-methyltransferase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vl5a_ c.66.1.41 (A:) Hypothetical protein BH2331 {Bacillus halodurans [TaxId: 86665]} Back     information, alignment and structure
>d1nkva_ c.66.1.21 (A:) Hypothetical Protein YjhP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2o57a1 c.66.1.18 (A:16-297) Putative sarcosine dimethylglycine methyltransferase {Red algae (Galdieria sulphuraria) [TaxId: 130081]} Back     information, alignment and structure
>d2apoa1 b.122.1.1 (A:247-331) Pseudouridine synthase II TruB, C-terminal domain {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1i1na_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2esra1 c.66.1.46 (A:28-179) Putative methyltransferase SPy1538 {Streptococcus pyogenes [TaxId: 1314]} Back     information, alignment and structure
>d2b3ta1 c.66.1.30 (A:2-275) N5-glutamine methyltransferase, HemK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1kpia_ c.66.1.18 (A:) CmaA2 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1uwva2 c.66.1.40 (A:75-432) rRNA (Uracil-5-)-methyltransferase RumA, catalytic domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fcaa1 c.66.1.53 (A:10-213) tRNA (guanine-N(7)-)-methyltransferase TrmB {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ve3a1 c.66.1.43 (A:2-227) Hypothetical protein PH0226 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2i6ga1 c.66.1.44 (A:1-198) Putative methyltransferase TehB {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2ey4a1 b.122.1.1 (A:253-336) Pseudouridine synthase II TruB, C-terminal domain {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1iq8a3 b.122.1.1 (A:506-582) Archaeosine tRNA-guanine transglycosylase, C3 domain {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2fhpa1 c.66.1.46 (A:1-182) Putative methylase EF2452 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1ri5a_ c.66.1.34 (A:) mRNA cap (Guanine N-7) methyltransferase {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]} Back     information, alignment and structure
>d2fpoa1 c.66.1.46 (A:10-192) Methylase YhhF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2fk8a1 c.66.1.18 (A:22-301) Methoxy mycolic acid synthase 4, Mma4 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1ws6a1 c.66.1.46 (A:15-185) Methyltransferase TTHA0928 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2nxca1 c.66.1.39 (A:1-254) PrmA-like protein TTHA0656 (TT0836) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jg1a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1kpga_ c.66.1.18 (A:) CmaA1 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ex4a1 c.66.1.42 (A:2-224) Adrenal gland protein AD-003 (C9orf32) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zx0a1 c.66.1.16 (A:8-236) Guanidinoacetate methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q7ha1 b.122.1.1 (A:69-153) Hypothetical protein Ta1423, C-terminal domain {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1r3ea1 b.122.1.1 (A:238-318) Pseudouridine synthase II TruB, C-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vbfa_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1im8a_ c.66.1.14 (A:) Hypothetical protein HI0319 (YecO) {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1g8sa_ c.66.1.3 (A:) Fibrillarin homologue {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1wzna1 c.66.1.43 (A:1-251) Hypothetical methyltransferase PH1305 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1wy7a1 c.66.1.32 (A:4-204) Hypothetical protein PH1948 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1yzha1 c.66.1.53 (A:8-211) tRNA (guanine-N(7)-)-methyltransferase TrmB {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2gh1a1 c.66.1.49 (A:13-293) Methyltransferase BC2162 {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1r18a_ c.66.1.7 (A:) Protein-L-isoaspartyl O-methyltransferase {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d2ifta1 c.66.1.46 (A:11-193) Putative methylase HI0767 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1wg8a2 c.66.1.23 (A:5-108,A:207-284) TM0872, methyltransferase domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2avna1 c.66.1.41 (A:1-246) Hypothetical methyltransferase TM1389 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xvaa_ c.66.1.5 (A:) Glycine N-methyltransferase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ih2a1 c.66.1.27 (A:21-243) DNA methylase TaqI, N-terminal domain {Thermus aquaticus [TaxId: 271]} Back     information, alignment and structure
>d1pjza_ c.66.1.36 (A:) Thiopurine S-methyltransferase {Pseudomonas syringae [TaxId: 317]} Back     information, alignment and structure
>d2bzga1 c.66.1.36 (A:17-245) Thiopurine S-methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p91a_ c.66.1.33 (A:) rRNA methyltransferase RlmA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2f8la1 c.66.1.45 (A:2-329) Hypothetical protein Lmo1582 {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2cx1a1 b.122.1.1 (A:91-183) Hypothetical protein APE0525, C-terminal domain {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1xtpa_ c.66.1.42 (A:) Hypothetical protein Lmaj004091aaa (LmjF30.0810) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2cl5a1 c.66.1.1 (A:3-216) Catechol O-methyltransferase, COMT {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ej0a_ c.66.1.2 (A:) RNA methyltransferase FtsJ {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2avda1 c.66.1.1 (A:44-262) COMT domain-containing protein 1, COMTD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2a14a1 c.66.1.15 (A:5-261) Indolethylamine N-methyltransferase, INMT {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tw3a2 c.66.1.12 (A:99-351) Carminomycin 4-O-methyltransferase {Streptomyces peucetius [TaxId: 1950]} Back     information, alignment and structure
>d1nv8a_ c.66.1.30 (A:) N5-glutamine methyltransferase, HemK {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1vlma_ c.66.1.41 (A:) Possible histamine N-methyltransferase TM1293 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2dula1 c.66.1.58 (A:3-377) N(2),N(2)-dimethylguanosine tRNA methyltransferase Trm1 {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2fyta1 c.66.1.6 (A:238-548) Protein arginine N-methyltransferase 3, PRMT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1susa1 c.66.1.1 (A:21-247) Caffeoyl-CoA O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1oria_ c.66.1.6 (A:) Protein arginine N-methyltransferase 1, PRMT1 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2g72a1 c.66.1.15 (A:18-280) Phenylethanolamine N-methyltransferase, PNMTase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g6q1_ c.66.1.6 (1:) Arginine methyltransferase, HMT1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2p7ia1 c.66.1.41 (A:22-246) Hypothetical protein ECA1738 {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d1ne2a_ c.66.1.32 (A:) Hypothetical protein Ta1320 {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1jqea_ c.66.1.19 (A:) Histamine methyltransferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2okca1 c.66.1.45 (A:9-433) Type I restriction enzyme StySJI M protein {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2q07a1 b.122.1.1 (A:460-527) Uncharacterized protein AF0587 {Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2h00a1 c.66.1.54 (A:5-254) Methyltransferase 10 domain containing protein METT10D {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1nw3a_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qzza2 c.66.1.12 (A:102-357) Aclacinomycin-10-hydroxylase RdmB {Streptomyces purpurascens [TaxId: 1924]} Back     information, alignment and structure
>d1u2za_ c.66.1.31 (A:) Catalytic, N-terminal domain of histone methyltransferase Dot1l {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ar0a1 c.66.1.45 (A:6-529) M.EcoKI {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jsxa_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2oyra1 c.66.1.55 (A:1-250) Hypothetical protein YhiQ {Shigella flexneri [TaxId: 623]} Back     information, alignment and structure
>d1xdza_ c.66.1.20 (A:) Glucose-inhibited division protein B (GidB) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1uira_ c.66.1.17 (A:) Spermidine synthase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d2p41a1 c.66.1.25 (A:8-264) An RNA cap (nucleoside-2'-O-)-methyltransferase domain of RNA polymerase NS5 {Dengue virus 2 [TaxId: 11060]} Back     information, alignment and structure
>d1inla_ c.66.1.17 (A:) Spermidine synthase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1mjfa_ c.66.1.17 (A:) Putative spermidine synthetase PF0127 (SpeE) {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iy9a_ c.66.1.17 (A:) Spermidine synthase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1kola2 c.2.1.1 (A:161-355) Formaldehyde dehydrogenase {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d2o07a1 c.66.1.17 (A:16-300) Spermidine synthase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b2ca1 c.66.1.17 (A:3-314) Spermidine synthase {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1qama_ c.66.1.24 (A:) rRNA adenine dimethylase {Bacillus subtilis, Ermc' [TaxId: 1423]} Back     information, alignment and structure
>d1f8fa2 c.2.1.1 (A:163-336) Benzyl alcohol dehydrogenase {Acinetobacter calcoaceticus [TaxId: 471]} Back     information, alignment and structure
>d1xj5a_ c.66.1.17 (A:) Spermidine synthase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1piwa2 c.2.1.1 (A:153-320) Cinnamyl alcohol dehydrogenase, ADH6 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1af7a2 c.66.1.8 (A:92-284) Chemotaxis receptor methyltransferase CheR, C-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1zq9a1 c.66.1.24 (A:36-313) Probable dimethyladenosine transferase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e3ia2 c.2.1.1 (A:168-341) Alcohol dehydrogenase {Mouse (Mus musculus), class II [TaxId: 10090]} Back     information, alignment and structure
>d1h2ba2 c.2.1.1 (A:155-326) Alcohol dehydrogenase {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1yuba_ c.66.1.24 (A:) rRNA adenine dimethylase {Streptococcus pneumoniae, Ermam [TaxId: 1313]} Back     information, alignment and structure
>d1rjwa2 c.2.1.1 (A:138-305) Alcohol dehydrogenase {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1llua2 c.2.1.1 (A:144-309) Alcohol dehydrogenase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2as0a1 b.122.1.9 (A:1-72) Hypothetical protein PH1915, N-terminal domain {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1jvba2 c.2.1.1 (A:144-313) Alcohol dehydrogenase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iz0a2 c.2.1.1 (A:99-269) Quinone oxidoreductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qyra_ c.66.1.24 (A:) High level kasugamycin resistance protein KsgA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bm8a1 c.66.1.50 (A:2-233) Cephalosporin hydroxylase CmcI {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d2fzwa2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d2jhfa2 c.2.1.1 (A:164-339) Alcohol dehydrogenase {Horse (Equus caballus) [TaxId: 9796]} Back     information, alignment and structure
>d1uufa2 c.2.1.1 (A:145-312) Hypothetical protein YahK {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fp1d2 c.66.1.12 (D:129-372) Chalcone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1cdoa2 c.2.1.1 (A:165-339) Alcohol dehydrogenase {Cod (Gadus callarias) [TaxId: 8053]} Back     information, alignment and structure
>d1g60a_ c.66.1.11 (A:) Methyltransferase mboII {Moraxella bovis [TaxId: 476]} Back     information, alignment and structure
>d1d1ta2 c.2.1.1 (A:163-338) Alcohol dehydrogenase {Human (Homo sapiens), different isozymes [TaxId: 9606]} Back     information, alignment and structure
>d1eg2a_ c.66.1.11 (A:) m.RsrI N6 adenosine-specific DNA methyltransferase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1p0fa2 c.2.1.1 (A:1164-1337) Alcohol dehydrogenase {Frog (Rana perezi) [TaxId: 8403]} Back     information, alignment and structure
>d1xa0a2 c.2.1.1 (A:119-294) B. subtilis YhfP homologue {Bacillus stearothermophilus [TaxId: 1422]} Back     information, alignment and structure
>d1fp2a2 c.66.1.12 (A:109-352) Isoflavone O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1g55a_ c.66.1.26 (A:) DNMT2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g60a_ c.66.1.11 (A:) Methyltransferase mboII {Moraxella bovis [TaxId: 476]} Back     information, alignment and structure
>d1booa_ c.66.1.11 (A:) m.PvuII N4 cytosine-specific DNA methyltransferase {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d1booa_ c.66.1.11 (A:) m.PvuII N4 cytosine-specific DNA methyltransferase {Proteus vulgaris [TaxId: 585]} Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2c7pa1 c.66.1.26 (A:1-327) DNA methylase HhaI {Haemophilus haemolyticus [TaxId: 726]} Back     information, alignment and structure
>d1kyza2 c.66.1.12 (A:120-362) Caffeic acid/5-hydroxyferulic acid 3/5-O-methyltransferase {Alfalfa (Medicago sativa) [TaxId: 3879]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1eg2a_ c.66.1.11 (A:) m.RsrI N6 adenosine-specific DNA methyltransferase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcta_ c.66.1.26 (A:) DNA methylase HaeIII {Haemophilus aegyptius [TaxId: 197575]} Back     information, alignment and structure
>d1o9ga_ c.66.1.29 (A:) rRNA methyltransferase AviRa {Streptomyces viridochromogenes [TaxId: 1938]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1i4wa_ c.66.1.24 (A:) Transcription factor sc-mtTFB {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2py6a1 c.66.1.56 (A:14-408) Methyltransferase FkbM {Methylobacillus flagellatus [TaxId: 405]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2f1ka2 c.2.1.6 (A:1-165) Prephenate dehydrogenase TyrA {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure