Citrus Sinensis ID: 039847


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170--
MSSDDTDMDWELVPAANAFVTAVKPALEFLNINGEWDDAGDNLMFKATLPTGTKMEELKIESTEDGKLLKLSKVLPEGDNGDGEHEAAVMWVLKECCSSGDGKIDISKSFNLPEGVIVKPNCFKASVEDGVLNVIFTKLKSKKKIMSKVLGVVAKAVPVVVLIAVNIVDDNN
cccccccccccccccccccccccccccccccccEEEEEccccEEEEEEcccccccccEEEEEEccccEEEEEEEEccccccccccEEEEcEEEEEEEEccccccEEEEEEEcccccccccccEEEEEEccEEEEEEccccccccccEEEEEEEcccccEEEEEEEEEEcccc
cccccccccHHHcccHcccHHHHHHHHHHHcccccHccccccEEEEEcccccccccEEEEEEEccccEEEEEEEEcccccccccEEEEEEEEEEEEccccccEEEEEEEEEccccEEEEccHEEEEEcccEEEEEEcccccHHHHHHHHHHHHHccccEEEEEEEEEEcccc
mssddtdmdwelVPAANAFVTAVKPALEFLningewddagdnlmfkatlptgtkmeelkiestedgkllklskvlpegdngdgeHEAAVMWVLKECcssgdgkidisksfnlpegvivkpncfkasveDGVLNVIFTKLKSKKKIMSKVLGVVAKAVPVVVLIAVNIVDDNN
MSSDDTDMDWELVPAANAFVTAVKPALEFLNINGEWDDAGDNLMFKATLPTGTKMEELKiestedgkllklskvlpegdngDGEHEAAVMWVLKECCSSGDGKIDISKSFNLPEGVIVKPNCFKASVEDGVLNVIFTKLKSKKKIMSKvlgvvakavpVVVLIAVNIVDDNN
MSSDDTDMDWELVPAANAFVTAVKPALEFLNINGEWDDAGDNLMFKATLPTGTKMEELKIESTEDGKLLKLSKVLPEGDNGDGEHEAAVMWVLKECCSSGDGKIDISKSFNLPEGVIVKPNCFKASVEDGVLNVIFTklkskkkimskvlgvvakavpvvvliavnivddnN
********DWELVPAANAFVTAVKPALEFLNINGEWDDAGDNLMFKATLP***********************************EAAVMWVLKECCSSGDGKIDISKSFNLPEGVIVKPNCFKASVEDGVLNVIFTKLKSKKKIMSKVLGVVAKAVPVVVLIAVNIV****
******D*DWELVPAANA**T**K*ALEFLNINGEWDDAGDNLMFKATLPTGTKMEELKIESTEDGKLL*********************WVLKECCSSGDGKIDISKSFNLPEGVIVKPNCFKASVEDGVLNVIF******************KAVPVVVLIAVNIVD***
********DWELVPAANAFVTAVKPALEFLNINGEWDDAGDNLMFKATLPTGTKMEELKIESTEDGKLLKLSKVLPEGDNGDGEHEAAVMWVLKECCSSGDGKIDISKSFNLPEGVIVKPNCFKASVEDGVLNVIFTKLKSKKKIMSKVLGVVAKAVPVVVLIAVNIVDDNN
******DMDWELVPAANAFVTAVKPALEFLNINGEWDDAGDNLMFKATLPTGTKMEELKIESTEDGKLLKLSKVLPEGDNGDGEHEAAVMWVLKECCSSGDGKIDISKSFNLPEGVIVKPNCFKASVEDGVLNVIFTKLKSKKKIMSKVLGVVAKAVPVVVLIAVNIVDD**
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MSSDDTDMDWELVPAANAFVTAVKPALEFLNINGEWDDAGDNLMFKATLPTGTKMEELKIESTEDGKLLKLSKVLPEGDNGDGEHEAAVMWVLKECCSSGDGKIDISKSFNLPEGVIVKPNCFKASVEDGVLNVIFTKLKSKKKIMSKVLGVVAKAVPVVVLIAVNIVDDNN
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query172 2.2.26 [Sep-21-2011]
Q9XIE3155 17.6 kDa class I heat sho yes no 0.581 0.645 0.368 2e-06
Q84J50159 17.7 kDa class I heat sho yes no 0.651 0.704 0.340 7e-06
P13853157 17.6 kDa class I heat sho no no 0.610 0.668 0.352 9e-06
Q9LNW0157 17.8 kDa class I heat sho no no 0.581 0.636 0.359 2e-05
Q84Q77161 17.9 kDa class I heat sho no no 0.587 0.627 0.339 3e-05
P04794154 17.5 kDa class I heat sho no no 0.587 0.655 0.330 0.0006
P02519153 17.3 kDa class I heat sho no no 0.587 0.660 0.330 0.0006
>sp|Q9XIE3|HS17A_ARATH 17.6 kDa class I heat shock protein 1 OS=Arabidopsis thaliana GN=HSP17.6A PE=1 SV=1 Back     alignment and function desciption
 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/114 (36%), Positives = 59/114 (51%), Gaps = 14/114 (12%)

Query: 31  NINGEWDDAGDNLMFKATLPTGTKMEELKIESTEDGKLLKLSKVLPEGDNGDGEHEAAVM 90
           N   +W +  +  +FKA LP G K EE+K+E  ED  +LK+S     G+    + E    
Sbjct: 45  NARVDWKETAEAHVFKADLP-GMKKEEVKVE-IEDDSVLKIS-----GERHVEKEEKQDT 97

Query: 91  WVLKECCSSGDGKIDISKSFNLPEGVIVKPNCFKASVEDGVLNVIFTKLKSKKK 144
           W   E  S G      S+ F LPE V  K +  KAS+E+GVL V   K+++ KK
Sbjct: 98  WHRVERSSGG-----FSRKFRLPENV--KMDQVKASMENGVLTVTVPKVETNKK 144




Possesses chaperone activity.
Arabidopsis thaliana (taxid: 3702)
>sp|Q84J50|HS177_ORYSJ 17.7 kDa class I heat shock protein OS=Oryza sativa subsp. japonica GN=HSP17.7 PE=2 SV=1 Back     alignment and function description
>sp|P13853|HS17C_ARATH 17.6 kDa class I heat shock protein 3 OS=Arabidopsis thaliana GN=HSP17.6C PE=2 SV=2 Back     alignment and function description
>sp|Q9LNW0|HS178_ARATH 17.8 kDa class I heat shock protein OS=Arabidopsis thaliana GN=HSP17.8 PE=2 SV=1 Back     alignment and function description
>sp|Q84Q77|HS17A_ORYSJ 17.9 kDa class I heat shock protein OS=Oryza sativa subsp. japonica GN=HSP17.9A PE=2 SV=1 Back     alignment and function description
>sp|P04794|HSP14_SOYBN 17.5 kDa class I heat shock protein OS=Glycine max GN=HSP17.5-E PE=3 SV=1 Back     alignment and function description
>sp|P02519|HSP11_SOYBN 17.3 kDa class I heat shock protein OS=Glycine max GN=HSP17.3-B PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query172
297840571156 hypothetical protein ARALYDRAFT_893564 [ 0.627 0.692 0.360 1e-05
21592809155 heat shock protein, putative [Arabidopsi 0.581 0.645 0.368 6e-05
15218934155 HSP20-like chaperone [Arabidopsis thalia 0.581 0.645 0.368 7e-05
38639431154 17.5 kDa class I heat shock protein [Car 0.587 0.655 0.356 0.0003
449439950200 PREDICTED: 18.5 kDa class I heat shock p 0.726 0.625 0.307 0.0003
115452123159 Os03g0267200 [Oryza sativa Japonica Grou 0.651 0.704 0.340 0.0003
312983216160 18.0 kDa heat shock protein [Oryza sativ 0.709 0.762 0.337 0.0003
125543242159 hypothetical protein OsI_10886 [Oryza sa 0.651 0.704 0.340 0.0004
15220832157 HSP20-like chaperone [Arabidopsis thalia 0.610 0.668 0.352 0.0004
159138945159 low molecular weight heat shock protein 0.674 0.729 0.323 0.0007
>gi|297840571|ref|XP_002888167.1| hypothetical protein ARALYDRAFT_893564 [Arabidopsis lyrata subsp. lyrata] gi|297334008|gb|EFH64426.1| hypothetical protein ARALYDRAFT_893564 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
 Score = 54.3 bits (129), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 63/122 (51%), Gaps = 14/122 (11%)

Query: 31  NINGEWDDAGDNLMFKATLPTGTKMEELKIESTEDGKLLKLSKVLPEGDNGDGEHEAAVM 90
           N   +W +  +  +FKA LP G K EE+K+E  ED  +LK+S     G+    + E    
Sbjct: 47  NARVDWKETEEAHVFKADLP-GMKKEEVKVE-IEDDTVLKIS-----GERHVEKEEKQDT 99

Query: 91  WVLKECCSSGDGKIDISKSFNLPEGVIVKPNCFKASVEDGVLNVIFTKLKSKKKIMSKVL 150
           W   E  S G      S+ F LPE V  K +  KAS+E+GVL V   K+++KKK   K +
Sbjct: 100 WHRVERSSGG-----FSRKFRLPENV--KMDQVKASMENGVLTVTVPKVETKKKAQVKSI 152

Query: 151 GV 152
            +
Sbjct: 153 EI 154




Source: Arabidopsis lyrata subsp. lyrata

Species: Arabidopsis lyrata

Genus: Arabidopsis

Family: Brassicaceae

Order: Brassicales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|21592809|gb|AAM64758.1| heat shock protein, putative [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|15218934|ref|NP_176195.1| HSP20-like chaperone [Arabidopsis thaliana] gi|75315310|sp|Q9XIE3.1|HS17A_ARATH RecName: Full=17.6 kDa class I heat shock protein 1; AltName: Full=17.6 kDa heat shock protein 1; Short=AtHsp17.6A gi|5080819|gb|AAD39328.1|AC007258_17 Putative Heat shock hsp20 protein [Arabidopsis thaliana] gi|51968438|dbj|BAD42911.1| unknown protein [Arabidopsis thaliana] gi|51968672|dbj|BAD43028.1| unknown protein [Arabidopsis thaliana] gi|88900414|gb|ABD57519.1| At1g59860 [Arabidopsis thaliana] gi|332195508|gb|AEE33629.1| HSP20-like chaperone [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|38639431|gb|AAR25848.1| 17.5 kDa class I heat shock protein [Carica papaya] Back     alignment and taxonomy information
>gi|449439950|ref|XP_004137748.1| PREDICTED: 18.5 kDa class I heat shock protein-like [Cucumis sativus] gi|449511076|ref|XP_004163855.1| PREDICTED: 18.5 kDa class I heat shock protein-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|115452123|ref|NP_001049662.1| Os03g0267200 [Oryza sativa Japonica Group] gi|75297657|sp|Q84J50.1|HS177_ORYSJ RecName: Full=17.7 kDa class I heat shock protein; AltName: Full=17.7 kDa heat shock protein; Short=OsHsp17.7 gi|1815664|gb|AAC78394.1| low molecular mass heat shock protein Oshsp17.7 [Oryza sativa Japonica Group] gi|29893630|gb|AAP06884.1| shock protein, low molecular weight [Oryza sativa Japonica Group] gi|29893637|gb|AAP06891.1| putative heat shock protein [Oryza sativa Japonica Group] gi|108707362|gb|ABF95157.1| 17.4 kDa class I heat shock protein, putative, expressed [Oryza sativa Japonica Group] gi|113548133|dbj|BAF11576.1| Os03g0267200 [Oryza sativa Japonica Group] gi|125585716|gb|EAZ26380.1| hypothetical protein OsJ_10263 [Oryza sativa Japonica Group] gi|215697489|dbj|BAG91483.1| unnamed protein product [Oryza sativa Japonica Group] gi|313575789|gb|ADR66974.1| 17.4 kDa heat shock protein [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|312983216|gb|ADR30405.1| 18.0 kDa heat shock protein [Oryza sativa Indica Group] Back     alignment and taxonomy information
>gi|125543242|gb|EAY89381.1| hypothetical protein OsI_10886 [Oryza sativa Indica Group] Back     alignment and taxonomy information
>gi|15220832|ref|NP_175759.1| HSP20-like chaperone [Arabidopsis thaliana] gi|21264442|sp|P13853.2|HS17C_ARATH RecName: Full=17.6 kDa class I heat shock protein 3; AltName: Full=17.6 kDa heat shock protein 3; Short=AtHsp17.6C gi|12324023|gb|AAG51972.1|AC024260_10 17.6 kDa heat shock protein (AA 1-156); 91675-91202 [Arabidopsis thaliana] gi|4376161|emb|CAA34208.1| unnamed protein product [Arabidopsis thaliana] gi|88900420|gb|ABD57522.1| At1g53540 [Arabidopsis thaliana] gi|332194833|gb|AEE32954.1| HSP20-like chaperone [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|159138945|gb|ABW89472.1| low molecular weight heat shock protein [Gossypium hirsutum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query172
TAIR|locus:2024862157 AT1G53540 [Arabidopsis thalian 0.627 0.687 0.349 6.8e-08
UNIPROTKB|Q84J50159 HSP17.7 "17.7 kDa class I heat 0.616 0.666 0.333 8.7e-08
UNIPROTKB|P31673154 HSP17.4 "17.4 kDa class I heat 0.616 0.688 0.341 1.1e-07
TAIR|locus:2075256156 HSP17.4 "heat shock protein 17 0.563 0.621 0.351 1.1e-07
TAIR|locus:2025921155 AT1G59860 [Arabidopsis thalian 0.523 0.580 0.375 1.4e-07
UNIPROTKB|Q84Q72161 HSP18.1 "18.1 kDa class I heat 0.5 0.534 0.37 1.8e-07
TAIR|locus:2024997157 AT1G07400 [Arabidopsis thalian 0.523 0.573 0.384 2.3e-07
UNIPROTKB|Q84Q77161 HSP17.9A "17.9 kDa class I hea 0.5 0.534 0.35 4.8e-07
UNIPROTKB|Q943E7149 HSP16.9C "16.9 kDa class I hea 0.604 0.697 0.349 6.1e-07
TAIR|locus:2174269161 HSP18.2 "heat shock protein 18 0.604 0.645 0.333 1.3e-06
TAIR|locus:2024862 AT1G53540 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 123 (48.4 bits), Expect = 6.8e-08, P = 6.8e-08
 Identities = 43/123 (34%), Positives = 62/123 (50%)

Query:    12 LVPAANAFVTAVKPALEFLNINGEWDDAGDNLMFKATLPTGTKMEELKIESTEDGKLLKL 71
             L P+  A   A+  A  F N   +W +  +  +FKA LP G + EE+K+E  EDG +L++
Sbjct:    31 LTPSGLANAPAMDVAA-FTNAKVDWRETPEAHVFKADLP-GLRKEEVKVE-VEDGNILQI 87

Query:    72 SKVLPEGDNGDGEHEAAVMWVLKECCSSGDGKIDISKSFNLPEGVIVKPNCFKASVEDGV 131
             S     G+  +   E    W   E  S   GK   ++ F LPE    K    KAS+E+GV
Sbjct:    88 S-----GERSNENEEKNDKWHRVERSS---GKF--TRRFRLPENA--KMEEIKASMENGV 135

Query:   132 LNV 134
             L+V
Sbjct:   136 LSV 138




GO:0005737 "cytoplasm" evidence=ISM
GO:0009408 "response to heat" evidence=ISS;RCA
GO:0006457 "protein folding" evidence=RCA
GO:0009644 "response to high light intensity" evidence=RCA
GO:0034976 "response to endoplasmic reticulum stress" evidence=RCA
GO:0042542 "response to hydrogen peroxide" evidence=RCA
UNIPROTKB|Q84J50 HSP17.7 "17.7 kDa class I heat shock protein" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|P31673 HSP17.4 "17.4 kDa class I heat shock protein" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2075256 HSP17.4 "heat shock protein 17.4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025921 AT1G59860 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q84Q72 HSP18.1 "18.1 kDa class I heat shock protein" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2024997 AT1G07400 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q84Q77 HSP17.9A "17.9 kDa class I heat shock protein" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|Q943E7 HSP16.9C "16.9 kDa class I heat shock protein 3" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
TAIR|locus:2174269 HSP18.2 "heat shock protein 18.2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

No confident hit detected by STRING


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 172
PRK11597142 heat shock chaperone IbpB; Provisional 99.95
PRK10743137 heat shock protein IbpA; Provisional 99.95
COG0071146 IbpA Molecular chaperone (small heat shock protein 99.95
cd0647292 ACD_ScHsp26_like Alpha crystallin domain (ACD) fou 99.95
cd0647193 ACD_LpsHSP_like Group of bacterial proteins contai 99.93
cd0647090 ACD_IbpA-B_like Alpha-crystallin domain (ACD) foun 99.92
PF00011102 HSP20: Hsp20/alpha crystallin family This prints e 99.91
cd0649786 ACD_alphaA-crystallin_HspB4 Alpha-crystallin domai 99.89
cd0647883 ACD_HspB4-5-6 Alpha-crystallin domain found in alp 99.88
cd0649884 ACD_alphaB-crystallin_HspB5 Alpha-crystallin domai 99.87
cd0647981 ACD_HspB7_like Alpha crystallin domain (ACD) found 99.87
cd0647586 ACD_HspB1_like Alpha crystallin domain (ACD) found 99.87
cd0648187 ACD_HspB9_like Alpha crystallin domain (ACD) found 99.86
cd0647683 ACD_HspB2_like Alpha crystallin domain (ACD) found 99.85
cd0646488 ACD_sHsps-like Alpha-crystallin domain (ACD) of al 99.84
cd0648287 ACD_HspB10 Alpha crystallin domain (ACD) found in 99.84
cd0647783 ACD_HspB3_Like Alpha crystallin domain (ACD) found 99.83
cd0652683 metazoan_ACD Alpha-crystallin domain (ACD) of meta 99.82
KOG0710196 consensus Molecular chaperone (small heat-shock pr 99.81
cd0648091 ACD_HspB8_like Alpha-crystallin domain (ACD) found 99.66
cd0029880 ACD_sHsps_p23-like This domain family includes the 99.53
KOG3591173 consensus Alpha crystallins [Posttranslational mod 99.49
cd0646978 p23_DYX1C1_like p23_like domain found in proteins 99.32
PF05455177 GvpH: GvpH; InterPro: IPR008633 This family consis 99.14
cd0646384 p23_like Proteins containing this p23_like domain 98.99
cd0646684 p23_CS_SGT1_like p23_like domain similar to the C- 98.74
PF0496979 CS: CS domain; InterPro: IPR017447 The function of 98.33
cd06465108 p23_hB-ind1_like p23_like domain found in human (h 98.04
cd0648984 p23_CS_hSgt1_like p23_like domain similar to the C 97.73
PF08190328 PIH1: pre-RNA processing PIH1/Nop17 97.72
cd0646785 p23_NUDC_like p23_like domain of NUD (nuclear dist 97.52
cd0648887 p23_melusin_like p23_like domain similar to the C- 97.49
cd0646892 p23_CacyBP p23_like domain found in proteins simil 97.44
cd0649385 p23_NUDCD1_like p23_NUDCD1: p23-like NUD (nuclear 97.32
cd0649493 p23_NUDCD2_like p23-like NUD (nuclear distribution 96.92
cd00237106 p23 p23 binds heat shock protein (Hsp)90 and parti 96.46
PLN03088356 SGT1, suppressor of G2 allele of SKP1; Provisional 96.25
KOG1309196 consensus Suppressor of G2 allele of skp1 [Signal 96.09
cd0649087 p23_NCB5OR p23_like domain found in NAD(P)H cytoch 94.9
cd0649287 p23_mNUDC_like p23-like NUD (nuclear distribution) 94.7
cd06495102 p23_NUDCD3_like p23-like NUD (nuclear distribution 93.29
PF14913194 DPCD: DPCD protein family 81.71
COG5091368 SGT1 Suppressor of G2 allele of skp1 and related p 80.37
>PRK11597 heat shock chaperone IbpB; Provisional Back     alignment and domain information
Probab=99.95  E-value=6.1e-28  Score=188.71  Aligned_cols=102  Identities=19%  Similarity=0.277  Sum_probs=86.5

Q ss_pred             cCceeeEEEC-CCeEEEEEecCCCCCCCceEEEEEeCCCEEEEEEEecCCCCCCCcccccccEEEEeeeecCCCeeeEEE
Q 039847           30 LNINGEWDDA-GDNLMFKATLPTGTKMEELKIESTEDGKLLKLSKVLPEGDNGDGEHEAAVMWVLKECCSSGDGKIDISK  108 (172)
Q Consensus        30 ~~p~vDi~Et-~d~~vv~adLP~Gv~kedI~V~v~~d~~~L~IsGer~~~~~~~e~~~~~~~~~~~Er~~~G~~~~~F~R  108 (172)
                      ..|++||+|+ +++|+|.|+|| |++|+||+|++  ++++|+|+|++     +.+  .++.+|+++|| ++|  +  |+|
T Consensus        31 ~~P~vdI~e~~~~~y~v~adlP-Gv~kedi~V~v--~~~~LtI~ge~-----~~~--~~~~~~~~~Er-~~g--~--F~R   95 (142)
T PRK11597         31 SFPPYNIEKSDDNHYRITLALA-GFRQEDLDIQL--EGTRLTVKGTP-----EQP--EKEVKWLHQGL-VNQ--P--FSL   95 (142)
T ss_pred             CCCcEEEEEcCCCEEEEEEEeC-CCCHHHeEEEE--ECCEEEEEEEE-----ccc--cCCCcEEEEEE-eCc--E--EEE
Confidence            4589999984 77999999999 99999999999  68899999998     322  24568999999 899  8  999


Q ss_pred             EEECCCCCcCCCCcEEEEEeCCEEEEEEeccCCCCcceeeec
Q 039847          109 SFNLPEGVIVKPNCFKASVEDGVLNVIFTKLKSKKKIMSKVL  150 (172)
Q Consensus       109 ~f~LP~~vd~~~d~I~A~~~nGVL~V~vPK~~~~k~~~~~I~  150 (172)
                      +|.||++|+.  +  +|+|+||||+|+|||.+++..+.++|.
T Consensus        96 ~f~LP~~vd~--~--~A~~~nGVL~I~lPK~~~~~~~~rkI~  133 (142)
T PRK11597         96 SFTLAENMEV--S--GATFVNGLLHIDLIRNEPEAIAPQRIA  133 (142)
T ss_pred             EEECCCCccc--C--cCEEcCCEEEEEEeccCccccCCcEEE
Confidence            9999999988  6  799999999999999854444445553



>PRK10743 heat shock protein IbpA; Provisional Back     alignment and domain information
>COG0071 IbpA Molecular chaperone (small heat shock protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd06472 ACD_ScHsp26_like Alpha crystallin domain (ACD) found in Saccharomyces cerevisiae (Sc) small heat shock protein (Hsp)26 and similar proteins Back     alignment and domain information
>cd06471 ACD_LpsHSP_like Group of bacterial proteins containing an alpha crystallin domain (ACD) similar to Lactobacillus plantarum (Lp) small heat shock proteins (sHsp) HSP 18 Back     alignment and domain information
>cd06470 ACD_IbpA-B_like Alpha-crystallin domain (ACD) found in Escherichia coli inclusion body-associated proteins IbpA and IbpB, and similar proteins Back     alignment and domain information
>PF00011 HSP20: Hsp20/alpha crystallin family This prints entry is a subset of the Pfam entry Back     alignment and domain information
>cd06497 ACD_alphaA-crystallin_HspB4 Alpha-crystallin domain found in the small heat shock protein (sHsp) alphaA-crystallin (HspB4, 20kDa) Back     alignment and domain information
>cd06478 ACD_HspB4-5-6 Alpha-crystallin domain found in alphaA-crystallin (HspB4), alphaB-crystallin (HspB5), and the small heat shock protein (sHsp) HspB6, also known as Hsp20 Back     alignment and domain information
>cd06498 ACD_alphaB-crystallin_HspB5 Alpha-crystallin domain found in the small heat shock protein (sHsp) alphaB-crystallin (HspB5, 20kDa) Back     alignment and domain information
>cd06479 ACD_HspB7_like Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB7, also known as cardiovascular small heat shock protein (cvHsp), and similar proteins Back     alignment and domain information
>cd06475 ACD_HspB1_like Alpha crystallin domain (ACD) found in mammalian small (s)heat shock protein (Hsp)-27 (also denoted HspB1 in human) and similar proteins Back     alignment and domain information
>cd06481 ACD_HspB9_like Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB9 and similar proteins Back     alignment and domain information
>cd06476 ACD_HspB2_like Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB2/heat shock 27kDa protein 2 and similar proteins Back     alignment and domain information
>cd06464 ACD_sHsps-like Alpha-crystallin domain (ACD) of alpha-crystallin-type small(s) heat shock proteins (Hsps) Back     alignment and domain information
>cd06482 ACD_HspB10 Alpha crystallin domain (ACD) found in mammalian small heat shock protein (sHsp) HspB10, also known as sperm outer dense fiber protein (ODFP), and similar proteins Back     alignment and domain information
>cd06477 ACD_HspB3_Like Alpha crystallin domain (ACD) found in mammalian HspB3, also known as heat-shock protein 27-like protein (HSPL27, 17-kDa) and similar proteins Back     alignment and domain information
>cd06526 metazoan_ACD Alpha-crystallin domain (ACD) of metazoan alpha-crystallin-type small(s) heat shock proteins (Hsps) Back     alignment and domain information
>KOG0710 consensus Molecular chaperone (small heat-shock protein Hsp26/Hsp42) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd06480 ACD_HspB8_like Alpha-crystallin domain (ACD) found in mammalian 21 Back     alignment and domain information
>cd00298 ACD_sHsps_p23-like This domain family includes the alpha-crystallin domain (ACD) of alpha-crystallin-type small heat shock proteins (sHsps) and a similar domain found in p23-like proteins Back     alignment and domain information
>KOG3591 consensus Alpha crystallins [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd06469 p23_DYX1C1_like p23_like domain found in proteins similar to dyslexia susceptibility 1 (DYX1) candidate 1 (C1) protein, DYX1C1 Back     alignment and domain information
>PF05455 GvpH: GvpH; InterPro: IPR008633 This family consists of archaeal GvpH proteins which are thought to be involved in gas vesicle synthesis [] Back     alignment and domain information
>cd06463 p23_like Proteins containing this p23_like domain include p23 and its Saccharomyces cerevisiae (Sc) homolog Sba1 Back     alignment and domain information
>cd06466 p23_CS_SGT1_like p23_like domain similar to the C-terminal CHORD-SGT1 (CS) domain of Sgt1 (suppressor of G2 allele of Skp1) Back     alignment and domain information
>PF04969 CS: CS domain; InterPro: IPR017447 The function of the CS domain is unknown Back     alignment and domain information
>cd06465 p23_hB-ind1_like p23_like domain found in human (h) butyrate-induced transcript 1 (B-ind1) and similar proteins Back     alignment and domain information
>cd06489 p23_CS_hSgt1_like p23_like domain similar to the C-terminal CS (CHORD-SGT1) domain of human (h) Sgt1 and related proteins Back     alignment and domain information
>PF08190 PIH1: pre-RNA processing PIH1/Nop17 Back     alignment and domain information
>cd06467 p23_NUDC_like p23_like domain of NUD (nuclear distribution) C and similar proteins Back     alignment and domain information
>cd06488 p23_melusin_like p23_like domain similar to the C-terminal (tail) domain of vertebrate Melusin and related proteins Back     alignment and domain information
>cd06468 p23_CacyBP p23_like domain found in proteins similar to Calcyclin-Binding Protein(CacyBP)/Siah-1-interacting protein (SIP) Back     alignment and domain information
>cd06493 p23_NUDCD1_like p23_NUDCD1: p23-like NUD (nuclear distribution) C-like domain found in human NUD (nuclear distribution) C domain-containing protein 1, NUDCD1 (also known as CML66), and similar proteins Back     alignment and domain information
>cd06494 p23_NUDCD2_like p23-like NUD (nuclear distribution) C-like found in human NUDC domain-containing protein 2 (NUDCD2) and similar proteins Back     alignment and domain information
>cd00237 p23 p23 binds heat shock protein (Hsp)90 and participates in the folding of a number of Hsp90 clients, including the progesterone receptor Back     alignment and domain information
>PLN03088 SGT1, suppressor of G2 allele of SKP1; Provisional Back     alignment and domain information
>KOG1309 consensus Suppressor of G2 allele of skp1 [Signal transduction mechanisms] Back     alignment and domain information
>cd06490 p23_NCB5OR p23_like domain found in NAD(P)H cytochrome b5 (NCB5) oxidoreductase (OR) and similar proteins Back     alignment and domain information
>cd06492 p23_mNUDC_like p23-like NUD (nuclear distribution) C-like domain of mammalian(m) NUDC and similar proteins Back     alignment and domain information
>cd06495 p23_NUDCD3_like p23-like NUD (nuclear distribution) C-like domain found in human NUDC domain-containing protein 3 (NUDCD3) and similar proteins Back     alignment and domain information
>PF14913 DPCD: DPCD protein family Back     alignment and domain information
>COG5091 SGT1 Suppressor of G2 allele of skp1 and related proteins [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query172
1gme_A151 Heat shock protein 16.9B; small heat shock protein 3e-07
4eld_A161 MJ16.5-P1, small heat shock protein HSP16.5; chape 3e-05
3aab_A123 Putative uncharacterized protein ST1653; alpha-cry 4e-05
>1gme_A Heat shock protein 16.9B; small heat shock protein, chaperone, alpha-crystallin; 2.70A {Triticum aestivum} SCOP: b.15.1.1 PDB: 2h50_A 2h53_A 2byu_A Length = 151 Back     alignment and structure
 Score = 46.6 bits (111), Expect = 3e-07
 Identities = 41/144 (28%), Positives = 57/144 (39%), Gaps = 14/144 (9%)

Query: 1   MSSDDTDMDWELVPAANAFVTAVKPALEFLNINGEWDDAGDNLMFKATLPTGTKMEELKI 60
            +    D          A          F N   +W +  +  +FKA LP G K EE+K+
Sbjct: 13  FADLWADPFDTFRSIVPAISGGGSETAAFANARMDWKETPEAHVFKADLP-GVKKEEVKV 71

Query: 61  ESTEDGKLLKLSKVLPEGDNGDGEHEAAVMWVLKECCSSGDGKIDISKSFNLPEGVIVKP 120
           E  EDG +L +S     G+    + +    W   E  S   GK    + F L E    K 
Sbjct: 72  E-VEDGNVLVVS-----GERTKEKEDKNDKWHRVERSS---GKF--VRRFRLLEDA--KV 118

Query: 121 NCFKASVEDGVLNVIFTKLKSKKK 144
              KA +E+GVL V   K + KK 
Sbjct: 119 EEVKAGLENGVLTVTVPKAEVKKP 142


>4eld_A MJ16.5-P1, small heat shock protein HSP16.5; chaperone; 2.70A {Methanocaldococcus jannaschii} PDB: 1shs_A Length = 161 Back     alignment and structure
>3aab_A Putative uncharacterized protein ST1653; alpha-crystallin domain, chaperone; 1.85A {Sulfolobus tokodaii} PDB: 3aac_A Length = 123 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query172
3gla_A100 Low molecular weight heat shock protein; HSPA, SHP 99.96
1gme_A151 Heat shock protein 16.9B; small heat shock protein 99.96
4fei_A102 Heat shock protein-related protein; stress respons 99.94
4eld_A161 MJ16.5-P1, small heat shock protein HSP16.5; chape 99.94
3aab_A123 Putative uncharacterized protein ST1653; alpha-cry 99.93
2wj5_A101 Heat shock protein beta-6; chaperone, disulfide bo 99.92
3l1e_A106 Alpha-crystallin A chain; lens transparency, polyd 99.91
3q9p_A85 Heat shock protein beta-1; alpha-crystallin domain 99.89
2y1y_A90 Alpha-crystallin B chain,; small heat shock protei 99.88
2klr_A175 Alpha-crystallin B chain; protein, dimer, oligomer 99.86
2bol_A314 TSP36, small heat shock protein; A-crystallin, mol 99.84
2bol_A314 TSP36, small heat shock protein; A-crystallin, mol 99.84
1rl1_A114 Suppressor of G2 allele of SKP1 homolog; beta sand 99.06
2xcm_C92 SGT1-like protein, cytosolic heat shock protein 90 99.04
2k8q_A134 Protein SHQ1; beta-sandwich, CS domain, nucleus, s 97.9
3eud_A115 Protein SHQ1; CS domain HSP20-like domain SHQ1 H/A 97.81
1x5m_A127 Calcyclin-binding protein; CS domain, structural g 97.68
1wh0_A134 Ubiquitin carboxyl-terminal hydrolase 19; USP, CS 97.53
1wgv_A124 KIAA1068 protein; CS domain, HSP20-like fold, stru 97.44
1ejf_A125 Progesterone receptor P23; chaperone, CO-chaperone 97.31
3igf_A374 ALL4481 protein; two-domained protein consisting o 97.21
3qor_A121 Nuclear migration protein NUDC; beta-sandwich, cha 97.19
2o30_A131 Nuclear movement protein; MCSG, structural genomic 96.97
2rh0_A157 NUDC domain-containing protein 2; 13542905, nuclea 96.95
2kmw_A150 Uncharacterized protein AT3G03773; protein structu 96.92
1wfi_A131 Nuclear distribution gene C homolog; NUDC, riken s 96.87
2cg9_X134 CO-chaperone protein SBA1; chaperone complex, HSP9 96.71
>3gla_A Low molecular weight heat shock protein; HSPA, SHP, SHSP, high resolution, stress response, chaperone; 1.64A {Xanthomonas axonopodis PV} PDB: 3gt6_A 3guf_A Back     alignment and structure
Probab=99.96  E-value=8e-29  Score=179.58  Aligned_cols=97  Identities=16%  Similarity=0.265  Sum_probs=87.8

Q ss_pred             cCceeeEEECCCeEEEEEecCCCCCCCceEEEEEeCCCEEEEEEEecCCCCCCCcccccccEEEEeeeecCCCeeeEEEE
Q 039847           30 LNINGEWDDAGDNLMFKATLPTGTKMEELKIESTEDGKLLKLSKVLPEGDNGDGEHEAAVMWVLKECCSSGDGKIDISKS  109 (172)
Q Consensus        30 ~~p~vDi~Et~d~~vv~adLP~Gv~kedI~V~v~~d~~~L~IsGer~~~~~~~e~~~~~~~~~~~Er~~~G~~~~~F~R~  109 (172)
                      +.|++||+|++++|+|.++|| |++++||+|++  +++.|+|+|++     ..+.+.++.+|+++|| ++|  +  |.|+
T Consensus         3 ~~P~~di~e~~~~~~v~~~lP-G~~~edi~v~~--~~~~L~I~g~~-----~~~~~~~~~~~~~~er-~~g--~--f~r~   69 (100)
T 3gla_A            3 WVPRVDIKEEVNHFVLYADLP-GIDPSQIEVQM--DKGILSIRGER-----KSESSTETERFSRIER-RYG--S--FHRR   69 (100)
T ss_dssp             SCCCEEEEECSSEEEEEEECT-TSCGGGCEEEE--ETTEEEEEEEE-----CCGGGSSGGGEEEECC-CCE--E--EEEE
T ss_pred             ccCcEEEEECCCEEEEEEECC-CCCHHHEEEEE--ECCEEEEEEEE-----cCcCccCCccEEEEee-cce--E--EEEE
Confidence            568999999999999999999 99999999999  67899999999     5555556778999999 888  8  9999


Q ss_pred             EECCCCCcCCCCcEEEEEeCCEEEEEEeccCC
Q 039847          110 FNLPEGVIVKPNCFKASVEDGVLNVIFTKLKS  141 (172)
Q Consensus       110 f~LP~~vd~~~d~I~A~~~nGVL~V~vPK~~~  141 (172)
                      |.||.+++.  ++|+|+|+||||+|++||.+.
T Consensus        70 ~~LP~~vd~--~~i~A~~~~GvL~I~~pK~~~   99 (100)
T 3gla_A           70 FALPDSADA--DGITAAGRNGVLEIRIPKRPA   99 (100)
T ss_dssp             EECCTTBCT--TSCEEEEETTEEEEEEEBC--
T ss_pred             EECCCCcCh--HHeEEEEeCCEEEEEEecCCC
Confidence            999999988  999999999999999999864



>1gme_A Heat shock protein 16.9B; small heat shock protein, chaperone, alpha-crystallin; 2.70A {Triticum aestivum} SCOP: b.15.1.1 PDB: 2h50_A 2h53_A 2byu_A Back     alignment and structure
>4fei_A Heat shock protein-related protein; stress response, alpha-crystallin domain fold, aggregates, C chaperone; 2.40A {Deinococcus radiodurans} Back     alignment and structure
>4eld_A MJ16.5-P1, small heat shock protein HSP16.5; chaperone; 2.70A {Methanocaldococcus jannaschii} PDB: 1shs_A Back     alignment and structure
>3aab_A Putative uncharacterized protein ST1653; alpha-crystallin domain, chaperone; 1.85A {Sulfolobus tokodaii} PDB: 3aac_A Back     alignment and structure
>2wj5_A Heat shock protein beta-6; chaperone, disulfide bond, stress response; 1.12A {Rattus norvegicus} Back     alignment and structure
>3l1e_A Alpha-crystallin A chain; lens transparency, polydispersity, protein aggregation, CRYS eye lens protein, chaperone; 1.15A {Bos taurus} PDB: 3l1f_A 3n3e_A Back     alignment and structure
>3q9p_A Heat shock protein beta-1; alpha-crystallin domain, chaperone, charcot-marie-tooth DISE neuronopathy, IG-like fold, stress response; 2.00A {Homo sapiens} PDB: 3q9q_A Back     alignment and structure
>2y1y_A Alpha-crystallin B chain,; small heat shock protein, chaperone, stress protein, eye LEN protein, cataract; HET: MSE; 2.00A {Homo sapiens} PDB: 2y22_A 2wj7_A 3l1g_A 2y1z_A Back     alignment and structure
>2klr_A Alpha-crystallin B chain; protein, dimer, oligomer, heterogeneity, intermolecular INTE chaperone, SHSP, human, small heat-shock protein, cataract; NMR {Homo sapiens} PDB: 2ygd_A Back     alignment and structure
>2bol_A TSP36, small heat shock protein; A-crystallin, molecular chaperone; 2.5A {Taenia saginata} Back     alignment and structure
>2bol_A TSP36, small heat shock protein; A-crystallin, molecular chaperone; 2.5A {Taenia saginata} Back     alignment and structure
>1rl1_A Suppressor of G2 allele of SKP1 homolog; beta sandwich, 7 beta strands, similar to P23, lacking LAST beta strand SEEN in P23, protein degradation; NMR {Homo sapiens} SCOP: b.15.1.3 Back     alignment and structure
>2xcm_C SGT1-like protein, cytosolic heat shock protein 90; chaperone-protein binding complex, stress response; HET: ADP; 2.20A {Arabidopsis thaliana} PDB: 2jki_S* Back     alignment and structure
>2k8q_A Protein SHQ1; beta-sandwich, CS domain, nucleus, structural protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3eud_A Protein SHQ1; CS domain HSP20-like domain SHQ1 H/ACA snoRNP ribosome biogenesis, nucleus, nuclear protein; HET: MSE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>1x5m_A Calcyclin-binding protein; CS domain, structural genomics, NPPSFA national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1wh0_A Ubiquitin carboxyl-terminal hydrolase 19; USP, CS domain, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: b.15.1.3 Back     alignment and structure
>1wgv_A KIAA1068 protein; CS domain, HSP20-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: b.15.1.4 Back     alignment and structure
>1ejf_A Progesterone receptor P23; chaperone, CO-chaperone, beta-sandwich; 2.49A {Homo sapiens} SCOP: b.15.1.2 Back     alignment and structure
>3igf_A ALL4481 protein; two-domained protein consisting of the N-terminal alpha-beta the C-terminal all beta domain., structural genomics; 2.00A {Nostoc SP} Back     alignment and structure
>3qor_A Nuclear migration protein NUDC; beta-sandwich, chaperone, protein cell cycle; HET: OCS; 1.75A {Homo sapiens} PDB: 3qor_B* 2cr0_A Back     alignment and structure
>2o30_A Nuclear movement protein; MCSG, structural genomics, PSI-2, structure initiative; 1.66A {Encephalitozoon cuniculi} Back     alignment and structure
>2rh0_A NUDC domain-containing protein 2; 13542905, nuclear movement protein, structural genomics, joint center for structural genomics, JCSG; 1.95A {Mus musculus} Back     alignment and structure
>2kmw_A Uncharacterized protein AT3G03773; protein structure initiative, center for eukaryotic structural genomics, CESG, structural genomics; NMR {Arabidopsis thaliana} Back     alignment and structure
>1wfi_A Nuclear distribution gene C homolog; NUDC, riken structural genomics/proteomics initiative, RSGI, structural genomics, transport protein; NMR {Mus musculus} SCOP: b.15.1.4 Back     alignment and structure
>2cg9_X CO-chaperone protein SBA1; chaperone complex, HSP90, heat shock protein, ATP-binding, heat shock, nucleotide-binding, acetylation; HET: ATP; 3.1A {Saccharomyces cerevisiae} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query172
d1gmea_150 Small heat shock protein {Wheat (Triticum aestivum 99.95
d1shsa_115 Small heat shock protein {Archaeon Methanococcus j 99.94
d1rl1a_92 Suppressor of G2 allele of skp1 homolog, gst1 {Hum 98.26
d1wh0a_134 Ubiquitin carboxyl-terminal hydrolase 19, USP19 {H 96.98
d1ejfa_110 Co-chaperone p23 {Human (Homo sapiens) [TaxId: 960 96.93
d1wgva_124 NudC domain containing protein 3, NUDCD3 (KIAA1068 96.0
d1wfia_131 Nuclear migration protein nudC {Mouse (Mus musculu 95.74
>d1gmea_ b.15.1.1 (A:) Small heat shock protein {Wheat (Triticum aestivum) [TaxId: 4565]} Back     information, alignment and structure
class: All beta proteins
fold: HSP20-like chaperones
superfamily: HSP20-like chaperones
family: HSP20
domain: Small heat shock protein
species: Wheat (Triticum aestivum) [TaxId: 4565]
Probab=99.95  E-value=1.2e-28  Score=189.53  Aligned_cols=108  Identities=36%  Similarity=0.530  Sum_probs=96.9

Q ss_pred             ccCceeeEEECCCeEEEEEecCCCCCCCceEEEEEeCCCEEEEEEEecCCCCCCCcccccccEEEEeeeecCCCeeeEEE
Q 039847           29 FLNINGEWDDAGDNLMFKATLPTGTKMEELKIESTEDGKLLKLSKVLPEGDNGDGEHEAAVMWVLKECCSSGDGKIDISK  108 (172)
Q Consensus        29 ~~~p~vDi~Et~d~~vv~adLP~Gv~kedI~V~v~~d~~~L~IsGer~~~~~~~e~~~~~~~~~~~Er~~~G~~~~~F~R  108 (172)
                      +..|++||.|++++|+|+++|| |++++||+|++ +++++|+|+|++     ..+.+.++..|+++|| .+|  +  |+|
T Consensus        40 ~~~p~~dv~e~~~~~~i~~~lP-G~~~edi~v~v-~~~~~l~i~~~~-----~~~~~~~~~~~~~~e~-~~~--~--f~r  107 (150)
T d1gmea_          40 FANARMDWKETPEAHVFKADLP-GVKKEEVKVEV-EDGNVLVVSGER-----TKEKEDKNDKWHRVER-SSG--K--FVR  107 (150)
T ss_dssp             HGGGCEEEEECSSEEEEEEECT-TCCGGGEEEEE-ETTTEEEEEECC-----CCCCCCTTCEEEECCC-CCC--C--EEE
T ss_pred             cCCCceeEEECCCEEEEEEEeC-CCccCCEEEEE-EEccceeEEEEE-----ecccccccceeeeeee-ccc--e--EEE
Confidence            4568999999999999999999 99999999999 467899999998     5555566778999999 888  8  999


Q ss_pred             EEECCCCCcCCCCcEEEEEeCCEEEEEEeccCCCCcceeeec
Q 039847          109 SFNLPEGVIVKPNCFKASVEDGVLNVIFTKLKSKKKIMSKVL  150 (172)
Q Consensus       109 ~f~LP~~vd~~~d~I~A~~~nGVL~V~vPK~~~~k~~~~~I~  150 (172)
                      +|.||.+++.  ++|+|+|+||||+|+|||.+.++++.++|.
T Consensus       108 ~~~LP~~vd~--~~i~A~~~nGvL~I~lpK~~~~~~~~~~I~  147 (150)
T d1gmea_         108 RFRLLEDAKV--EEVKAGLENGVLTVTVPKAEVKKPEVKAIQ  147 (150)
T ss_dssp             EEECSSCCCG--GGCEEEEETTEEEEEEECCCCCTTCCCCCC
T ss_pred             EEECCCCeee--ceeEEEEECCEEEEEEEcCCcCCCCceEEe
Confidence            9999999988  999999999999999999988888776664



>d1shsa_ b.15.1.1 (A:) Small heat shock protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1rl1a_ b.15.1.3 (A:) Suppressor of G2 allele of skp1 homolog, gst1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wh0a_ b.15.1.3 (A:) Ubiquitin carboxyl-terminal hydrolase 19, USP19 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ejfa_ b.15.1.2 (A:) Co-chaperone p23 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wgva_ b.15.1.4 (A:) NudC domain containing protein 3, NUDCD3 (KIAA1068) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wfia_ b.15.1.4 (A:) Nuclear migration protein nudC {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure